4FQ7A

Crystal structure of the maleate isomerase iso from pseudomonas putida s16
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
248
structure length
248
Chain Sequence
KVVRVGQIVPSSNITMETEIPALLKARELVAPERFTFHSSRMRMKHVTKEELARMDGDSDRCALELSDARVDVMGYACLVAIMSMGHGYHRVSAERLRNVTENNDAATPIITSAGALIDGIRALGAKRVAVVTPYMKPLTELVVDYIRHEGIEVGDYRALEISDNLAVAAHDPMNLPGIIASMRTDDVDAIVISACVQMPSLNAITMVEAQTRKPVISAAVATTWAMLTALDLPTRVPGGGTLLSGAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maleate cis-trans isomerase
publication title Structural and computational studies of the maleate isomerase from Pseudomonas putida S16 reveal a breathing motion wrapping the substrate inside.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 94
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17645 Amdase Arylmalonate decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12500 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fq7A00
3DG9A 3DTVD 3IP8A 3QVLA 3QVKA 4IX1A 2XEDA 3EISA 3DTVA 3IXMA 3IXLA 2VLBA 4FQ7A 3QVJA 3DTVB 4FQ5A 2XECA
chains in the Genus database with same CATH superfamily
1UBMS 2O5CA 2DC1A 2GVZC 4R3WA 4H3HB 3HBMA 4Q9HA 3JR7A 3MSCA 1V1RA 2XA1A 1C81A 4C7JA 4F2DA 4P3KA 1XLUA 2ORYA 4R8SA 4FYYA 3TIXB 3AF2A 1SC4A 5HMLA 2XUFA 3AZOA 4MEBA 5D7NA 5B3JC 1AGNA 3HPRA 3JWPA 1PW5A 1BDJA 2IYTA 1M6HA 3I9V6 5EE0A 3JZDA 1UINA 4X64B 2QL5A 4NEHB 4G8JA 1Z2PX 4X7PA 4D9BA 3KUUA 1M72A 1QYVA 4RNDB 5KS2A 3N8IA 4L5CA 3H2YA 2GFQA 1JDBC 3ZWQA 2IZ1A 3UENA 1B41A 2TECE 4UMEA 3EEIA 4WLNA 3F3KA 2A0XA 3M33A 1GU0A 2E2WA 2JFGA 1M5UA 1OHHA 2OGSA 2B1GA 3VR6D 1K75A 5HF9A 3MA0A 3BJRA 1Y7TA 3RJTA 2B4KA 2GJAA 3ESZA 1FA9A 5FQNA 3TKAA 4DNPA 4DUPA 2JF0A 1W581 3PQDA 3SJCA 2WUEA 5DHRA 5MFPA 4AJ1A 5K4GA 4IH9A 3KQWA 1U80A 1ZMRA 3GG2A 2O7RA 1BE1A 1KC1A 1G7RA 1P3DA 1TM4E 2IY9A 3LNCA 4TLLB 3MERA 3BQ9A 4B80A 2XUDA 4YUXA 1BN6A 3PXAA 3OG9A 1SVLA 2GF9A 3HABA 1G8FA 4QPCA 3L41A 4ZK2A 1ADBA 1E79D 1TAHA 3ED5A 1VL1A 2JIQA 3CW8X 1Q1NA 4HL6A 4PCVA 4CLHA 5CXXA 1T3GA 1GPJA 1YSCA 1KERA 4R8RA 3HA2A 3G2JA 3HO1A 4OKNA 3W2EA 2DWOA 2OHXA 4XAQA 3QQPA 1I9CA 1A9RA 1KHTA 1P62B 2HTEA 3F8TA 2ZT7A 3Q6NA 3S27A 4B73A 2HMWA 4FEYA 5JMWA 3G2IA 4YJKA 3OCVA 4UVEA 2NZXA 2C3UA 2RJ3A 2Z2JA 5TGZA 1ISPA 1ZXXA 2ZI9A 1YZTA 3FI9A 1A7JA 3GGGA 2CVPA 2VH1A 5BN4B 1OIVA 1LNQA 5EWMA 3FZYA 3W3ZB 1DJPA 1OASA 1Y6RA 2LBPA 5GZ1A 1E3DA 1EFRA 3TDKA 3IEVA 2FEMA 1YZNA 2CV2A 2BCEA 2Q07A 4ZRMA 5E6SA 3UCFA 3RSHA 5KYXA 2ROQA 3V1LA 1J06A 1KHHA 5FNVF 1OWOA 3O7WA 2GILA 4BZWA 1Q7BA 2OXEA 4EENA 1WM1A 3ZLJA 2VN8A 1UP7A 3RFVA 3LU1A 4UEQA 3CW2A 5D7BA 3RREA 3B1JA 4QA9A 2Q2QA 1P9WA 3NX4A 4EQ6A 5D6NA 1N0UA 1A72A 3DBHA 5KTOA 2I4TA 2FPKA 4G0YA 4ZKDA 3LFTA 1F7VA 1T2AA 4RTSA 1OROA 2NZ8A 2JGLA 5TV2A 4B3BA 4DS3A 1FDOA 3FIJA 4IBOA 3ER8A 1TVCA 3I9LA 1ORIA 2HJRA 4FHCA 4HDRB 4YT2A 4HTFA 4YK7A 4EZIA 2H3EA 2PL5A 3CZAA 4MDEA 3RYCA 3MMNA 3MJCA 3KETA 1A2OA 4HQLA 1TJ5A 4OHMA 2XH8A 1AGRA 4MV8A 1M8GA 2NADA 1M2HA 3ZWDA 1XZBA 4DHWA 2IOQA 2PX5A 1NJSA 1S2LA 4O4HB 4JBWA 5BUSA 5ED4A 1OA1A 4TTVA 3MT9A 1GGJA 1KPIA 5E1BA 1KA9H 1PU2A 4CI0B 2ZCVA 3AETB 3BQMB 2IWHA 4C43A 2QXYA 1G4UR 4F2WA 1ZJ6A 1IN8A 2F6RA 4N0QA 8MHTA 1YNOA 3HDVA 3IDQA 5DRTA 5JWOA 1HYEA 1Y3DE 5EMMA 1QC5A 4N0EA 3AEUA 3HCBA 3PFGA 4BGUA 3M70A 5IJWA 5BNIA 2B9VA 2Z56A 2QD1A 1RRCA 1XRMA 1QSGA 4LDPA 2MSWA 4Q02A 1Q1GA 2ACVA 2KJQA 2JCYA 3JV7A 1GL3A 4YR7A 2YIMA 4GM4A 4M0MA 1FFHA 2QRQA 2Z8YM 2ZBDA 1TK2A 4GPTA 3NWEA 4JSRA 5AKZA 3CY6A 1B0UA 1TM1E 2V4MA 2B69A 4MW7A 1J1UA 4TMZA 4WJZA 4KRFA 2ZAIA 1EUYA 4AG6A 1OPRA 1NVGA 1OA0A 1OXSC 2H7XA 3QI2A 1JE0A 3UHOA 1ZVKA 1N3LA 4XGIA 4RKQA 1VHDA 4FFSA 4D46A 1Z4JA 1Q3TA 1O54A 1WY7A 3PQEA 4KJZA 4QVKA 2WTNA 2VXCA 2WJ4A 4TROA 1UPFA 3E7DA 4ZO7A 1N36B 3CXUA 4W6ZA 5FUWA 4BLSA 1LPNA 1KAOA 3IVAA 1S89A 1N33B 4G9EA 1MN6A 4TTPA 4NXMB 1JX6A 5GY7A 4X65B 3VYWA 5K2MA 2DX7A 5IAGA 3HXLA 1FNDA 4ZEXA 3U1TA 3O4IA 4BNWA 5AVRA 5IAAA 4F4UA 2ZWIA 1VXOA 1DFHA 1JYFA 3SNKA 5AW6A 4A8HA 4HEHA 4PPFA 4R1UA 1MC1A 1E9CA 4TKUB 1C4XA 4ZREA 2OK7A 4NG5A 1QVVA 2BEWA 3K94A 1CTQA 3A4MA 4EA8A 4D0SA 4PR3A 1GU1A 1ZGHA 1BAPA 2AEFA 3UNXA 1TYEB 1CWUA 2BV3A 3ILYA 3Q2IA 3CH6A 4D9MA 2J8ZA 2JEYA 4Q93A 4QUBA 1TYZA 2P0YA 1WABA 3NTVA 4I36A 3OQHA 1YDMA 3N7AA 1T8UA 2ZB4A 4H77A 1BD3A 4MUEA 4O08A 1OB5A 2XT9A 4U4AA 3S5JA 4BNDB 2JZOA 4YRBA 4WVFA 3MUOA 3WSWA 4I4NA 1ECCA 2AC2A 2YJ3A 5EG5A 5COAA 1H4VB 1CNFA 1QIGA 2IHNA 2QW8A 1Y6JA 1O03A 4UOQA 1N9ZA 1SA0A 2WAYA 3FPEA 4DIUA 1HE5A 2FH5B 2HZBA 1JF8A 1DTSA 1N2CE 4R3NA 4XPZA 4A91A 5ADHA 2P90A 3NV7A 3PXXA 3IDAA 4I1OA 4ZCPA 1DIOB 3QXGA 3ZHRA 1BJRE 1JLHA 2PU5A 4L1KA 3LLVA 2BGMA 4OO3A 1LS1A 1ZMTA 1RJGA 1SULA 4QASA 4TRMA 3OEWA 3WLLA 5GZ6A 4UBKA 3OF5A 4J1TC 4C1NA 2JH9A 2HUPA 1PUJA 3KJIA 3OO0A 1WZ2A 4WLOA 5JSUA 1Y42X 4RPIA 3GLFE 2R9VA 5EIWA 2UVQA 4PC1A 13PKA 3Q11A 4B4UA 3AEQA 4B4WA 3T5TA 4F9GA 3C3BA 4HLCA 4GM0A 1RKXA 4UNIA 1UC9A 2IOFA 5I3CA 3AHCA 3OUZA 4JL8A 3KSDO 3DZIA 5BWCA 3K05A 1EM8A 5JCOA 4TLAA 1YTUA 4CN9A 4D4KA 1EK6A 1UH5A 4XPIB 1QR6A 2GZHA 3JZAA 2DFPA 1Z2NX 3QJGA 1X94A 2VDNB 4QE3A 2VJKA 2E7ZA 2YYAA 1MC8A 4L8YA 3H2GA 3WLRA 2H1SA 2YZNA 2ZRBA 2IEYA 2GNAA 3KKLA 5JXHA 2FE4A 3LQ1A 3WV4A 5KTYA 5AW1A 5AW2A 4FIZA 1WXXA 4BKOA 4ONEA 5CUQA 1GZVA 4G4IA 2Q1XA 5B5SA 1KJ8A 4G4SP 4KXFB 3PSAA 3QU5A 1NC3A 4YCNA 2O5EA 3NWBA 4U8GA 1EX9A 1F2DA 4P82A 2H0QA 1E6UA 1O6GA 2JFZA 1EXMA 5JD4A 3QKSB 1H3NA 2RI1A 3ZV3A 4TVBA 3JYLA 3AOEA 4HDQB 3S7TA 2O3TA 5BMVA 2ILVA 4R8KA 2J87A 3OCXA 1W7AA 1JKJA 3I04M 4U3JA 1NI5A 2QSYA 2V5UA 4QSHA 5CFQA 5FOSA 3V00A 4RADA 1JU3A 3X2EA 3UMRA 1O4VA 3ANMA 3RS4A 2BKAA 1L5FA 4FX5A 4IQ8A 4NECA 2EP7A 3WA6A 1HH4A 1DU4A 1BXGB 2HHAA 3BBPA 3SF8B 5LYYA 4Y2HA 2G7ZA 5EZQA 3M4JA 7GPBA 1SVNA 2WY2D 4F6RA 4LY0A 4OAOA 2C5SA 1ZG3A 4YBRA 5D00A 5TMDA 1CBUA 2VZEA 3DT9A 1UPCA 4C22A 1NXPA 5LP6A 5IT0A 4FUQA 5HCIA 1QPGA 3EUAA 1Z7YA 2VQ3A 5HBGA 3DPIA 3FYUB 1KP3A 2BPOA 2WYHA 3ZV7A 4LSMA 1X38A 3OOYA 1RP1A 1U0OC 3KT0A 3M6IA 4FBGA 4I4TB 5KVVA 3ENZA 2IE8A 1HYQA 2R25B 3KNZA 3MHPA 3FZNA 3MJRA 5EJGA 3WIEA 1M3SA 3ASZA 1S3GA 1TEZA 1S1MA 2QRPA 2CEAA 2WJGA 1B00A 1DEHA 1NW8A 1UOPA 4PO3X 2ONYA 3OLWA 2WHEA 1NDQA 3IT2A 2R8EA 4L27A 4S1WA 4ZAXA 5G2OA 1EIZA 2ODBA 2JI4A 3DEIA 3H9CA 5EE1A 2HLDD 4YJ3B 4P81A 4CKCA 3ESDA 4E30A 1G7TA 3QMWA 1HE4A 2B30A 1RQRA 2R2AA 3BWMA 1QOQB 5KNBH 4RABA 4TS3A 2QQGA 1UQTA 4EHJA 4XRRA 4IH1A 1L9KA 1GLGA 1FK8A 3A9CA 2WD9A 4RCZA 3TW8B 1XP8A 2A9PA 4MVJF 1BX3A 1K08A 1VJCA 3L8CA 4QDKA 5L40A 3IA2A 3V48A 3KQUA 3JQ7A 3AUKA 3KE9A 3B38A 3F3MA 1LFDB 4HWRA 2JAHA 1L7EA 3HNRA 4LZLA 3TNLA 4CHTA 3UGQA 1P6QA 5FOUA 3EOAI 2J5KA 2D5BA 1MH1A 1NP3A 3B8HA 3CWCA 1IIRA 1RS0A 3DW3X 3I53A 4KLAA 2A0WA 1E58A 4ZYVA 3ITEA 3VZPA 1E7QA 3DG9A 5CDHA 4A4DA 2IOYA 1P1HA 4ZZ3A 5B36A 4JA0A 1KWKA 2HMTA 2NTEA 3BRSA 3G1UA 2BFWA 1F4PA 3GD5A 4C3ZA 5AJTA 2OBNA 3EZ6A 5JATA 2I80A 5AR1A 2SECE 3AG5A 3Q4GA 4HS4A 4YMWA 3HR7A 2ODTX 1XRJA 4Z7NB 1XTPA 1K8ZB 1Z0IA 1E2GA 5EHGA 5A7FA 1DRKA 3W9SA 4KIUA 4X3OA 4ERNA 2A84A 1FMFA 2AJTA 2GAAA 1S96A 3WLSA 4AMZA 3D8UA 4X61A 5HKKA 2HPVA 4E5SA 2V7GA 2CFOA 2UYOA 3MOIA 5F77A 4RJJA 1BD4A 1AURA 1NTOA 4B7ZA 2BMJA 1MZVA 3AHEA 1ZIYA 2C4UA 4INAA 1ZIPA 4JLJA 4P58A 1HLGA 1HM5A 5FBHA 3S5UA 5CPFA 4NV1A 4DCNA 5K99A 3C6ZA 4EMSA 5AW9A 2GLUA 1Y81A 3OM0A 4IKEA 1VL8A 4LOLA 1XD2A 3KQYA 3ZIUA 4C04A 4YALA 8GPBA 1YVUA 1LPSA 4IGFA 4PCLA 2PK3A 3ZDQA 5JHGB 4GXRA 1MOPA 1YZKA 3IUBA 3AY3A 4LCBA 3DTYA 3C6MA 4AD8A 4D4MA 4G5OA 1IZZA 1TZ2A 2TSYB 2ZRHA 3L7LA 3KR9A 5TEWA 4NJMB 5JJ5A 1YR3A 3N58A 1AXEA 1U3DA 3FETA 4IJ6A 4QGGA 4R1OA 4AK9A 4TSFA 1U2TA 2HIGA 5BYJA 1XKQA 1FB5A 3QKUA 5BWMA 2XMCA 3M5CA 3LXUX 5G1NA 2E5LB 4LJRA 1EBUA 5DMXA 4CIWA 5DNAA 1ZGJA 2GB4A 4YJHB 1KOLA 1KOFA 3REQB 3SEFA 3DCNA 5DM70 4R7TA 5FNZA 7MDHA 4FDMA 1UXGA 1FMLA 2P2CA 3KUKA 3ERCA 1MA0A 3ZEIA 1L3BA 2AG0A 3T52A 1YR7A 3HXMA 1FJXA 1YS7A 1PJQA 1WKCA 1YRHA 5EIBD 3MRVA 5BNWA 4QUIA 2XIJA 2P5UA 4K6FA 4YJ2F 2BFCB 2C5GA 3JD0A 4FS3A 3IOEA 1VPVA 1Y1RA 2GCOA 1T3ZA 2G1PA 1GKUB 2HQBA 1RWBA 2QMYA 2Q3JA 3MT7A 1MPTA 4DILA 1V43A 2WF5A 2NO4A 4RK5A 2YX1A 2O8BB 3EFEA 2HO4A 2V0CA 1K8YB 4NP6A 4UBMA 1J24A 1SVSA 2XUAA 3WJ1A 4F91B 3IPYA 3SZ3A 1S5PA 3EPRA 2OD2A 4IWXA 4DRZA 4DJTA 2WDPA 1Z4LA 3DOFA 3B3GA 2FPGB 4G0NA 5TPZA 4AP6A 1ODIA 1EK1A 1TZCA 3SSMA 3FVRA 4HNRA 3H9UA 5FBRB 3DJFA 4RYLA 3G9QA 1AQIA 3FZGA 2B35A 2C03A 3OZEA 1RYYA 4OJTA 3CJQA 5DHSA 1ZGGA 3OJEA 5A0FA 1J4AA 1FZQA 1N2GA 4M98A 1NJ8A 1HTTA 2GUGA 1XVVA 1EX7A 5EYPA 1D1TA 1SK9A 4M99A 3K5IA 3Q7IA 3O38A 1D7OA 3W5DA 3L82B 2VH5R 1G5HA 1NZFA 1OBOA 2H4HA 3A9WA 3KM0A 3PLRA 5FR2A 1C3LA 4BMCA 5AVVA 2ZYDA 4HJRA 3TZHA 5FLYA 2HA3A 3KJXA 4BATA 3DEZA 4G1MB 4BBPA 2QGFA 4B3IA 1GAEO 4M8NE 2VWHA 4ZOBA 4NULA 5P21A 3H0EA 4OL0A 2H65A 2WJYA 3LY8A 4ZT2A 3Q10A 1LC0A 3NNNA 1JIKA 4UTPA 5CCXA 1GTSA 1RYDA 2QRMA 4U5XA 5GV8A 4KUEA 3MTAA 4PAMA 5G0SA 3T3OA 4G36A 1EJ2A 1BTOA 2IYXA 1HI9A 1C3OA 1ZK2A 1CJBA 2QX9A 2PWZA 2YV3A 4CLEA 5JNUA 1XZKA 1W9MA 2NACA 2GKOA 3JQCA 2PH3A 4C4ZA 1G6HA 1WEKA 4LXHA 4PLWA 5ICSA 1JQAA 4CWAA 3T7DA 3IP9A 3CC8A 4MKIA 3BCHA 4LOJA 5E0KB 3VUFA 3KG2A 5A5DA 3WB1A 1DIGA 1RMTA 4KN6A 2IZ0A 5IBPA 1GD1O 3ELUA 1FU8A 2IYLD 3E2IA 3NG1A 3O95A 1BU5A 2VSFA 1GKKA 3C3JA 4HWTA 4QYWA 3ND6A 4IDQA 4P4GA 1MJHA 3I9MA 1FEZA 4H18A 5FTJA 2BMDA 3U31A 1SA0B 3RC7A 4BQSA 4N5NA 3OZFA 5EXEA 5CHEA 5B7PA 1J09A 1A76A 1U2GC 1WNTA 2CLMB 3FY4A 2WG0A 4JT4A 4L9WA 3WNDA 3GFQA 4OGLA 3UH0A 1YXMA 1F38A 3A9VA 3WIOA 1A96A 1C9JA 4CR8A 3C3KA 4L7QA 1HZZC 4RJIA 3TRKA 2OMKA 2XT6A 3KSRA 5ALUA 3PNQA 2G4CA 2QAJA 5C52B 2OFWA 3BZBA 3RR2A 3TGWA 2JLQA 5AVYA 1JHXA 4NEQA 4PE5B 3L1IA 3II6X 4QUGA 3JAKB 1TCAA 2OQVA 3R7DA 3D0RA 2ZI6A 3JU3A 3LT0A 4V02A 2IPAB 5TDHA 4DXHA 1ZBDA 1W44A 2CSXA 4E4RA 2BYTA 1R4NB 1I2MA 3GNSA 4DBLE 1ENZA 2AC4A 4U7WA 2DTDA 2ZK7A 4JLMA 4U2GA 3QXCA 3YASA 2CLFB 4MWCA 2BM0A 1OTYA 2R1TB 4ENQA 1QK3A 1AZLA 2IFTA 1KI2A 3F74A 3KHKA 4LYDA 4NJEB 1ORHA 3IALA 3URKA 3KCQA 1V8PA 1U8CB 2VHJA 1A5AB 1OYVA 2MIIA 1JJAA 2YZ7A 1PR6A 3FCSB 3KQOA 3MFYA 3H9QA 3PYXA 4HB3A 5M3BA 4B2YA 4EEZA 5HCUA 2BFMA 3FGNA 3VMMA 1T4CB 2I9KA 1ND5A 4RTJA 5KC9A 4RZ2A 3LAWA 4L6CA 2XR1A 3PWZA 4UD6A 3IDZA 3OESA 3COJA 5DTRA 2H63A 3RYTC 4KDRA 3UMVA 3EC1A 3H11A 1E98A 1V6CA 1YHZA 2O05A 3H4MA 1T29A 4EY8A 1GGHA 3WI7A 3M5DA 4DXDA 1QKKA 3L01A 1T3TA 3A7DA 5IZCC 3I32A 3DC7A 5KSYA 3K1JA 2YL2A 5BN5B 2OCLA 4X5OA 4IDEA 2OFFA 2SKCA 3FTDA 3DZCA 4WZ6A 2PSHA 2AJLI 2QM3A 3G2HA 3IR7A 2WICA 1R4MA 4XVRA 1S8OA 3GH1A 1P4SA 3AMVA 3VPXA 3ETHA 4A73A 4EJ6A 3K71B 1JWBB 3QVGB 2Y0BA 1EESA 3SYRA 3NASA 5IAOA 1KTIA 4DIKA 1UBCA 3L8EA 4WK4B 3ZKWB 2XMSA 1G8YA 3DZKA 4O4LA 1F9EA 1VYVA 1YU9A 1OH5A 1IWBB 4OHFA 4IUYA 3TX6A 5H70A 3W5BA 1U0NA 3N74A 4US1R 3F49S 4FD2A 4GIBA 4JWKA 1BOFA 4LE1A 5FUVA 5HX7A 1KJJA 3DR3A 3G9XA 3LY7A 1QONA 1NOIA 5J4HA 1H05A 1O6FA 2A1UA 3GGCA 5KYWA 2L0XA 3UT5B 4H3VA 5LNK1 1DL5A 1TOAA 4KQFA 3FUWA 1Q14A 2WD8A 4BYMA 1H0HA 1P5FA 3CEPB 2GXAA 2JGAA 3D3JA 4HRXA 5I4BA 2BBSA 3JYOA 5AD1A 2UUCB 2JA1A 2R87A 1Z2EA 4J94A 1WDTA 5JLJA 2VYVD 2QXTA 2GZRA 2H1IA 3GRVA 2FQWA 4FGUA 4WNAA 3Q9SA 1JDPA 4BO8A 1L7MA 2FP3A 4U2FA 2QGNA 1M2FA 1GG8A 5A9TA 5GONF 1TC1A 5HF5A 4MWTA 5DVZA 3EA4A 1VXRA 3O2SB 5KYXB 3ZWYA 3G17A 3E22A 2O2EA 4U6QA 2FJUA 2ZKLA 3AUYA 3EH1A 5BMVB 1A9PA 4UU1A 2PGJA 3N2KA 3QX7A 1SU7A 4YR9A 5IM4F 1EUQA 5BN4A 4IDDA 1SQGA 1IUNA 4WXYB 1TCVA 4GPBA 1M9NA 4IG4A 3CLUC 4R2WA 3DXFA 4FS8A 1CQIA 2NNWB 3ZVMA 4CG3A 5J2TA 2FF5A 4JNKA 1DC3A 1R1DA 1R0BA 2IOFK 3FWNA 4P3PA 4C5AA 3TPFA 5JSZA 2QDKA 3WL6A 1NQ5A 2D0DA 3V9PA 3TG2A 1AO0A 1YASA 4X8OA 5B1HA 3BF8A 3EEBA 4ALJA 4Z4EA 2NW6A 2QP4A 1L7PA 1U99A 1ZO8A 2I8CA 3QWIA 4HH0A 5IT5A 4UVGA 3VR5A 4JH0A 4R5HA 3EPLA 4DXAA 4FWBA 4BCDA 5K0SA 1RM4A 1WSBA 1Y1QA 4FZRA 4HQ0A 1UXJA 4TT8A 3TF5A 1GTG1 2GBFA 7REQB 3UT0A 1J9GA 4NCXA 3GJXC 2RAPA 3B7PA 3GLRA 1X7XB 5ICFA 1Q6YA 1W6UA 3QLJA 4HDMB 5IBQA 1X8JA 2VA8A 4DMHA 3ZHOA 2WYUA 2Y68A 1X13A 2I71A 4ZVRA 2GK6A 4R40A 1IN1A 5B1IA 4Q3DA 3O8QA 3MWDB 3THOA 5FLEX 3UYLA 4G5GA 3V33A 3NKFA 1GPAA 4RELA 1QH9A 1AUPA 4XUEA 3UOWA 3K73O 4BB0A 5AESA 3EF3A 3K1AA 3ESAA 3H7AA 4BFYA 4CW7A 1JIIA 1N2IA 1ZJ5A 2VDRB 3IAS1 2D2FA 3JZIA 4KGZA 4R8MA 4XEHA 3VYVA 1KEKA 1GZDA 5JO9A 1VHJA 3BWEA 4HP8A 1QYIA 2O7VA 3D7KA 3NTRA 4HWPA 2PO5A 3UJ6A 3MJSA 5EIFA 2WIKA 3G8YA 3D7LA 4PG7A 1KVSA 4WL0A 4AG5A 4EF6A 4EB0A 1A2KC 3E35A 1RAEA 3NOXA 1H23A 4KV9A 3DT8A 1CYDA 1L8AA 2B2CA 5SY9A 3TTUA 3B9QA 4H6WA 5L4SA 1O6BA 3JR3A 4GZMA 3LHDA 2UZ1A 4FE3A 4EW3A 3DH0A 4TXNA 4L07A 4HVCA 2X86A 5BV8A 5C7IO 1X2EA 1Q7RA 2NU7A 3SX4A 3R76A 1PQPA 4QBIA 3DVAB 1PGQA 3AX6A 3BIOA 1N4AA 2QORA 1P0IA 3K5WA 3DBLB 3OKPA 1R9MA 4Z4GA 2B4TO 1WTCA 2XUIA 3OOJA 4BX8A 3ONVA 3I01M 4AM8A 2I87A 3OE4A 3UAWA 3NUZA 3ZPXA 4K6CA 1RRFA 2NU9B 5KO2A 1XZEA 3KOXA 5CBKA 2XEDA 4PCAA 4RACA 4ENUA 3X1JA 2WAAA 2HSDA 5KNDH 2OLJA 3VU1A 4U39A 1NFQA 4LQDA 2HO5A 4B47A 1ODSA 4BLVA 2HOQA 4RVFA 2IUTA 2F4VB 2K2WA 5FPKA 4NJOA 1IHXA 3AB8A 2YZ2A 4H1TA 1J70A 2PGXA 5EWJA 1MQ8B 3EWNA 1K8XB 3D6UA 1WKBA 4G6ZA 3RVDA 1Q1ZA 2IODA 4MRRA 3JWEA 4F1KA 4EUNA 1W6RA 2PANA 1K0UA 2XE6A 3DHEA 1MENA 4BMOB 2XKKA 2JZNA 4G23A 3L5OA 3JYNA 1LF5A 3LXRA 3P52A 1ZLYA 4WXHA 2AQ8A 1SO8A 1XYVA 1NQAO 2NVWA 4BDTA 3L43A 5A4KA 2OV2A 1B1AA 1ELOA 3ZHCA 4D98A 4P0PB 4AKIA 2IKQA 4YCBA 1EBFA 3HU3A 4L22A 3E6AA 1GPMA 5BSGA 4Z49A 1EFVB 1VPLA 3D81A 3R3HA 4EJMA 4CKWA 5J2UB 1JHDA 5KI6A 5DNYB 4RTMA 3P45A 3EC2A 1NNEA 4GZ6A 4MITA 5LLTA 1RM3A 5FOQA 1F0YA 4RL4A 1U1DA 1I5EA 1RAHA 1TIKA 1KH2A 1UQRA 3NO4A 4FDUA 5HFNA 3RODA 5LFAA 1Y82A 1BKYA 2XGGA 2Z6UA 3BMQB 3HBNA 3AFOA 2ORVA 3R0ZA 2EBUA 3NBUA 3BE8A 3ONEA 4OBEA 5F7JA 3ZBQA 1JQDA 1QHFA 3E23A 4BFSA 4DCUA 3DMDA 1DV1A 1S4QA 1Y8RB 2V1XA 3Q7SA 5EJ4A 1JPVA 1KMMA 2DFNA 2YV1A 4F4CA 4DMGA 3NTUA 1VYHA 2RCYA 3IJEB 4M9CA 4S0ZA 4YECA 3N7UA 4H16A 1KOJA 1VJDA 4WRRA 3F78A 2HKIA 4G4JA 2WTBA 3RC2A 3IP3A 1JXOA 1U04A 4Y1EA 3TKYA 3BDIA 2EXXA 1LVGA 1VJ0A 2BISA 2J32A 3GA0A 5CX4A 5HVNA 3O5AA 4EH1A 1OLSA 4ZPXA 3DHVA 3R8FA 4XE5A 5KNCH 1BVYF 1KYWA 5I8ZA 2IDJA 3T1TA 1X3LA 3A6JA 2JAXA 4FFLA 4FMDB 4TUYF 3ZK7A 3U2QA 2C4WA 3JALA 4C07A 1GHTA 1G17A 1DAHA 4G65A 4X60A 3QY0A 1J97A 1YCFA 1QU3A 5HJ5A 4PLPA 5ERXA 3ZHQA 3C0KA 3GZTB 1R9NA 4DWWA 2CMKA 2I2WA 3DD1A 1JQKA 3FCOA 4KHPB 1U9JA 2PSFA 5B7GA 2JW5A 3N2KB 2V4UA 2CLDX 4WADA 4BO9A 4YXFA 4DPLA 4KKVA 1R10A 2VTVA 4GECA 4R5MA 2ETVA 2Q3LA 3D6AA 5G0VA 4BNYA 2FR1A 4ZYZA 1L4YA 4ZQHA 1GGEA 3EG9B 4L8LA 1XE3A 1W73A 3IJPA 4HPWA 1L4KA 1CQPA 4ZZ0A 1YIAA 1DLJA 1TTQB 2H8GA 4PBTA 2Y1FA 4E88A 1IY0A 1YQGA 1E4YA 2GJ9A 2PGIA 1G5FA 1XQ9A 5ALMA 5FDFA 1UWCA 3AQ4A 1LDBA 3ZY4A 3F7NA 4QUDA 3RE1A 2Z8ZA 1EGAA 1P2BA 1T0PA 4GGOA 1QMGA 2BMWA 4G0WA 2DHRA 1Q84A 5K3SA 4Q9NA 5JAIA 2PX3A 1BXRB 2AG6A 3M82A 4ABTA 2JI6A 4LRQA 2AW3A 3OIUA 3U39A 3PR1A 4L75A 1E1LA 1H3FA 3ZTTA 1C41A 4CDNA 4BQIA 2QT0A 2VBCA 1ZUNB 3T35A 2XYQA 1SXJA 3WGYA 5HS4A 2FWNA 2GPWA 5DBIA 3WLMA 5CB4A 5IMBA 4YT4A 2PH1A 1GQYA 1T9HA 3K9NA 5KYUA 3RVLA 3FPCA 4N3AA 5EJ6A 2QUHA 2IE0A 2YZGA 4QYTA 2E55A 5H80A 1U0BB 2BGNA 4YAWA 4BVKA 5J43A 1O95C 3H5RA 3TRIA 3WBBA 1QTRA 1FW8A 1AMUA 4W5WA 1Z45A 2O7NA 3MGCA 4RKYA 2OYCA 4R9SA 3PXUA 4YO8A 3GX1A 5GM2A 2O8DA 3K0CA 1OYWA 2BGIA 1PBTA 1JFTA 4FM9A 1GTL1 3RSZA 1A71A 5IW8A 2E21A 1KBOA 3GJRA 1NHWA 1GSIA 3O0DA 4MDHA 2HLHA 5LIRA 5ICEA 3HLTA 3FGPA 3C4QA 3KEFA 4JJ8A 1JPUA 1IN4A 4FJ0A 4GOLD 4OIMA 2FRDC 4UE3S 1Z6YA 1ETUA 3H0CA 5K8JB 2N3ZA 4Z9AA 2PZ8A 3K0AB 2F55A 5H59A 1PNQA 1OWLA 1RLIA 1CR1A 2FFRA 2IGBA 4D3SA 5CA0F 3K70B 3J7AC 2PTGA 2PV0A 2Y1OA 3LPNA 3ZCTA 5A04A 3ICQB 3PEYA 1HDYA 1K4YA 3RYHA 1MJFA 1E92A 1X7YB 4ACAA 2O7QA 1NMQA 1T9ZA 3R6DA 2HBYA 3KQSA 4DLWA 2CT8A 5GJBA 2FZKA 4M1TA 2DHCA 3SAJA 4PSVA 4DPMA 1QE5A 2GGSA 3FXAA 5AM4A 3TZ6A 1QHIA 3T9CA 4UFNA 8ABPA 1JG2A 1JFVA 3F67A 1XRLA 3A1EA 3NIGB 3WL4A 4LRTB 1U6KA 5F78A 2JIPA 1XF1A 1ENPA 3OP4A 4MWGA 3NP9A 3M3HA 4QECA 3S2FA 3T7TA 2FPUA 2VNJA 3RRXA 3KJZA 3S1AB 3WZMA 3DGFC 3KOWA 4PAQA 4I1YA 2WYOA 5IF9A 2H2HA 2IUEA 3IOYA 2YASA 5JG7A 3KZ1E 2FX3A 1XEWX 5M29A 2ZBVA 3MAJA 2WJ6A 2W4QA 1FSZA 1VHWA 1T5LA 1Z47A 3ECSA 5KYTA 4IM7A 4JLNA 2Z4RA 1P0CA 4ZU1X 4G01B 3JZFA 2VSQA 3MXTA 4LDQA 3RTGA 2F48A 2FEOA 3B51X 2B1QA 3LP6A 3B20A 3HEBA 3WHPA 4MB2A 4F9TA 4OQ4A 1WW3A 4A10A 2GA8A 2ECPA 3ABZA 3BZWA 3QPUA 4NMWA 1GPKA 4X90A 4AICA 4UPEA 3BHIA 2PXHA 2BBOA 1KYYA 4FCTA 4HDNB 3I09A 4UDOA 3UK0A 3EIUA 1B93A 2XB4A 1CLUA 3V42A 2ZRNA 1C4KA 3OLYA 4L0MA 3UHPA 3R6TA 4EGCB 3GEPA 2CXUA 2GNPA 4DRYA 4U00A 4CLOA 3JQBA 4LJ5A 3VR4A 3RC8A 3LJKA 3NNDA 4C4RA 3PUZA 3QOXA 5ANRB 3ND5A 2QB5A 2OGTA 3KB2A 4TSFD 1NW3A 4GW3A 3K70D 4CM6A 2X0RA 1PJRA 5A6SA 5TVKA 3WFZA 4XLLA 5CB4F 4CKEB 1B1CA 2VNIA 2VZ9A 2W2QA 3VU8A 4C21A 2HFKA 2PRKA 1WF3A 1NW5A 4ENPA 2VJPA 5JJCA 2HF9A 2FG5A 2K4MA 1NRJB 3CURA 5THXA 2PGNA 1M8KA 2P8JA 1OFIA 4UJ5A 5HFJA 4G24A 1DJLA 1I51A 3VDRA 4EJSC 4MYUA 4P9NA 4JJZA 2H1WA 2H4WA 3ICOA 1XMPA 3ENQA 1XTBA 1JDUA 2OD9A 4L85A 4LC0A 2P4UA 3P9PA 4QKQA 5A3QA 3A9TA 1MTZA 3F71A 1CZLA 1UK6A 4URWR 1NW6A 3U4QA 1ORTA 1X87A 4JEHA 3SC4A 1XZMA 5IT4A 2EFGA 2UZ4A 3PC2A 4CTJA 5EYPB 2WOJA 1K6EA 1KI1A 1Q16A 1XTZA 2HDOA 2IUFA 2LCIA 2NYAA 2YHIA 4N0DA 1SR8A 3P4XA 4UBIA 3EMVA 5KNBA 3NATA 1WZIA 3RVMA 4GQBA 4EW1A 4K05A 3H2IA 2ZR8A 1KOGA 2DLDA 1NBAA 1OT5A 2ZCUA 4YT5A 3T1VA 1Q11A 1JEJA 3ON5A 3PIIA 4ESVA 2CXPA 2ZU6A 4YJDA 3WY9A 3IAUA 3TZEA 1VIDA 2F43A 5C8YB 4X7RA 2M6LA 3CX8A 1G3QA 2BEVA 2GSDA 2WWWA 3S81A 3PBKA 2PFKA 3RSCA 2CYCA 3DQQA 3LLSA 4QRHA 4DWOA 2O8BA 1HGXA 4BQEA 2H29A 5A4FS 4LY6A 2HREA 2G9VA 1H2RS 1DZ3A 3LPAA 2QRLA 2X0JA 1PZFA 3R6GA 4Y2SA 2C9BA 4IJWA 4EABA 4GLLA 1G60A 1MJNA 4YIHA 1W1IA 3K8ZA 3WRXC 3FCYA 2X0IA 4JL6A 2G0NA 2OV4A 1QLHA 5ALRA 4MO2A 1F51E 2FZVA 3HB7A 2XDYA 5JAQA 5FWYA 3GEGA 4HYTA 2PN1A 3S2SA 3T9FA 3CLVA 2GCEA 2OYSA 2QD2A 2LTAA 4MYSA 1ECBA 2JGFA 1WMSA 4WK2B 3EH2A 5KKNB 3CNQS 1U2GA 1XZIA 1KC3A 2J9FA 2Q5JA 2JGKA 4IHJF 1BNCA 4MRNA 4ARAA 4UE6A 3ZLVA 1QDLB 1AK1A 4WLUA 4TL7A 1K8QA 4HUQA 4M6WB 2HLDA 2WTUA 2QX8A 2OQRA 1XNJA 3DYVA 3QUQA 4EHFA 1RYZA 2GESA 4IIVA 4EIWA 3ZXXA 1SHKA 2BUBA 3NHUA 3IUEA 2HJVA 4HFNA 4O2AF 5LOVA 2C2BA 3HY4A 4B48A 3ZWKA 1ACLA 2CFRA 2GAJA 4XJSA 1LZLA 1DX6A 3IPLA 1E1MA 3GH3A 1EWTA 2LP4Y 1G21B 4QUAA 5HS6A 5L3SB 2ET6A 2FN8A 3RT7A 2LDXA 3GRKA 3GRAA 3R7LA 2WNHA 3V46A 2H4JA 5ALGA 3Q6MA 5F5XA 5ITSA 1H6DA 5BUZA 1WUHS 2C2GA 1CS0B 3D2AA 3F6SA 4CKYA 5AKKA 4RVGA 1UDCA 4WCFC 2D1FA 3I8XA 4MYTA 2CJFA 4HEJA 3SHFA 4RXMA 4IQ0A 1EE1A 1TUIA 3GAFA 4KK3A 1L1FA 3R20A 2WSSD 1W46A 3QVVA 1BCRA 3OE7A 1Q0UA 2YHAA 1STOA 4HLNA 1QH1B 3IQFA 1XYYA 3ELBA 5COQA 3G0IA 1UZMA 1U81A 3G8BA 1GG5A 3MINA 2CE7A 4BVEA 3E9ZA 5F3RA 2M1XA 2TS1A 1IY9A 4XLZA 1N6HA 4JXJA 4RKEA 2C2OA 3DFZA 4CF3A 3EA0A 4K46A 1JW9B 1P7VA 4KUHA 4NNOA 4GUAA 3WLAA 3GF4A 5F76A 4CEJA 3PK0A 1KORA 4OQZA 2M9MA 1OXVA 4MKXA 2OCAA 3QKTA 1I24A 3FF1A 3FN4A 3D1LA 3HYLA 3OTOB 2BFFB 4Q4HA 3TVTA 3UBMA 4ZI7F 3UCEA 4F6LA 4Z4CA 2J7PA 3W5UA 3J81A 2IT1A 4UE2A 2XNKA 4UPVA 1I2BA 2FXVA 2NSJA 4L73A 3AEYA 3B12A 1ODJA 3K0FB 4YDSA 1QKIA 1Z2CA 1WVMA 1XTJA 2QR3A 1C3EA 5THQA 3RU9A 3TW8A 3UHJA 3QQ5A 4G5HA 3TDNA 2QE7D 1RZVA 3OT1A 5JWHA 3KHTA 2PRZA 5HQJA 4EY7A 4IIEA 5CFOA 1DUVG 3DZGA 5LMUB 3MOGA 1DAKA 3DWFA 5KTSA 1AVTA 4U8HA 1U2EA 3IX7A 1ZA1A 4OMDA 2JC3A 1UK8A 4O2BA 4GYJA 4RJLA 2F1KA 3C5WP 4W9NC 4AJLA 4ARBA 5EIBC 2CHEA 3WNVA 2HNAA 2G5CA 3ZBTA 3EVAA 3NIDB 3PGXA 4I14A 3O84A 4Z8XA 3VR3D 1UT8A 4J76A 3HUDA 3S1LA 4MKFA 1XA0A 2FQYA 3D3QA 4H3SA 4RZQA 1P7CA 2ASVA 3KKPA 3RFFA 3WQRA 2IZ5A 1EQUA 4IH4A 3CE9A 3CZQA 4LI0A 4O4IB 3HTXA 1KYXA 4E5NA 1PFYA 4G5XA 2VHYA 5DOVA 3AVXA 1RHUA 3SQOA 1DQNA 4NCHA 3DM9B 3SU8A 3BM5A 2YJTD 4JR2A 5ILQA 4AWAA 3KFVA 5KDDA 221PA 4X54A 3S6JA 3OECA 4L4SA 3G79A 3SD7A 1Y3IA 3RSGA 1OW3B 2O2GA 3QVXA 3REFA 4K9OA 3W34A 4PTZA 1I14A 4BRSA 3P5SA 1W35A 2P65A 2IP4A 1W4RA 1LUAA 3KKZA 4MA5A 3W1EA 3I5XA 3KXKA 4CL3A 2GZAA 4G5YA 3N6XA 3AVYA 4WD3A 3DLCA 4U7GA 3DFFA 2HMUA 4NR0A 4NL4H 4X8HA 3RB8A 5AVXA 3P9NA 1X7YA 1OWNA 3Q3JB 1ECPA 3IIKA 3RROA 3IQZA 1GPUA 5FL7A 1LDGA 3SJZA 4F8JA 1M1YA 3UJ8A 2EYUA 2K5UA 5KTNA 2WF6A 2E4XA 1JLSA 4BEVA 4CM1A 4EKEA 4GNKA 1IJBA 1XQWA 3K0AA 3B82A 5CDFE 3U7RA 3AW8A 3D0OA 5KZMB 1GFWA 2CD7A 2NU6B 2IV3A 4XH9B 2C59A 3DFUA 3DV0A 3R5HA 2BGLA 4IRXA 4FN5A 4N1AA 3VGPA 1T0UA 3AUUA 3IEIA 3AFHA 4JSYA 5AKIA 2P9HA 4MNTA 4ZALA 1D03A 1RQ2A 3KUXA 4LS3A 1YQQA 4A16A 4AULA 1Z74A 2B92A 4PNHA 2WLSA 1XNRB 2BGTA 1GG2A 5K0JA 3A58B 2HWUA 3PHLA 4K9MA 1PNRA 1QDUA 3P9KA 3ZHYA 3A06A 4ZQCB 3VHRA 4DR3B 2GD1O 3DZDA 3DEYX 3HJGA 1TU0A 3L1JA 4LECA 3QIVA 4MYDA 4XFDA 5AI0A 4JUDX 3ESBA 4IFIA 3SJUA 4YMLA 2IF2A 5CA0A 1J99A 3CLSC 1EM8B 4YMSA 4QU8A 1EJBA 1V5GA 3N2GB 4LFCB 4XWTA 3VPAA 4DHEA 5KHOC 1TRKA 4IWNA 4KFTA 2C4HA 4N6NA 4NYIR 3UKDA 1CUYA 1T8RA 2QRGA 3FAKA 4AW9A 3V3TA 5B2FA 3R23A 4S1VA 1CUIA 1T25A 2EQBA 2Q28A 1E5DA 3N0RA 1I4OA 1FDIA 2FOXA 3BL5A 4IRMA 1E1DA 2QI9C 2AT1A 4PTLA 1G5TA 5ALQA 4E6EA 5GOTA 1KRXA 4EY4A 3FTPA 4UUMA 5FCDA 5M34A 1Z06A 4B34A 4EHIA 2V54A 4WY8A 3THSA 1UOQA 2X1MA 2DERA 1JKXA 1ZI6A 2DF8A 3QVUA 5FBZA 1L5KA 4B4OA 1SUWA 4EHNA 1E63A 3EXAA 5AKHA 4TKVA 4KPUA 1T0HB 4J0DA 4K8RB 1VPTA 5HG0A 4YUYA 2PRYA 4UUOA 1GSHA 3FFAA 1OXBB 4G41A 4PO9A 4BWGA 5KMGB 1DKLA 1FSFA 1EKXA 5CG2A 5KNCA 2DYKA 2EKPA 3WLHA 3SKXA 4FOOA 5KJCA 2Z9DA 4DAOA 1HBJA 4UBLA 3QPWA 2CDNA 4B76A 1SUBA 3ET4A 3A3OA 4V2UA 1D2NA 2IU4A 3QE4A 5E1OA 1R8XA 4FLEA 4X6LA 4X66B 1DO0A 3I2HA 1EE2A 2E1RA 4PONA 1DELA 4KX3A 3UK1A 1OXKB 4GU5A 2ES4A 3LLMA 1ZJYA 5BT9A 4AKEA 4BU1A 1TUGA 3L4SO 5FBLB 3O91A 1BC5A 2VIIA 4YNBA 5IAKA 3ZE0B 1OLSB 3RJZA 3O1JC 4RQUA 1HQYE 3CEMA 3R44A 3UG7A 5EHZA 3PYLA 3ZDFA 4Y0NA 2NYRA 3DBRA 1IY8A 4JDPA 4RORA 3MWEB 1T10A 4KRGA 4NBNA 4D74A 2Q62A 1Z4QA 1GDHA 1QHGA 1W48A 4UXJA 3WB9A 1IULA 2PM8A 5E3HA 3RC3A 2HK8A 5CT8A 3EXG2 4J7CA 4YRZA 3KO8A 5AOVA 5D3MB 1BEUB 1PGPA 2P2ZA 4IINA 3ESYA 3NRJA 4YP7A 4BB6A 5K8TA 3GO4A 2BEUA 2FSPA 2H54A 3BMQA 3FKJA 3NM6B 5TQ0A 3BWXA 4AJ9A 3R4VA 5JOQA 3UBTA 3UA4A 1NN1A 4OAQA 4AQYB 3GELA 5JJIA 3DO5A 3ETEA 4XUGB 4YRKA 2GKSA 2H0RA 4J43A 1O96B 4JJIA 4PYMA 3L8HA 1DADA 4Q7KA 5E8JA 3I12A 5C8YA 3TNDA 5HUHA 2QPTA 5EJEA 4B40A 3BSSA 3AO0B 1ENYA 1WHTB 1DRUA 2ZRQA 1U3CA 3KJEA 4K6MA 1IRIA 4LBWA 3I9FA 4URVR 1P60A 4N3NA 4L78A 1YK0A 3SR3A 2IEAA 2QQFA 3ZGVA 1UIRA 5KAMA 3MBOA 4TQ9A 4XQ0A 3O83A 5ENDA 3EZYA 4GEGA 2EVWX 3J7TA 3KQLA 3ZDBA 2XMGA 4NK4A 1QYXA 1SXHA 1S0UA 5JCOC 4HVTA 1CY8A 2UZIR 2EFHB 5DM1A 1JHVA 4BGEA 4JLOA 3HBFA 2Y6UA 4Y2RA 3FSJX 5CCBA 3TFQA 4AMVA 2D6FA 3F6RA 4PGFA 1KMHA 3INGA 4Q05A 4I5GA 5KCMA 2ALJA 2R4UA 5D3MA 6CHYA 5HK9A 5BO5A 2HA7A 1RFGE 4D8WA 4Q1BA 5ISMA 4EA7A 2PJUA 1R0WA 3PJEA 2OG2A 3HMQA 4PO8A 3VR6A 2C88A 1JA9A 3RYIA 4HZIA 2DZDA 1ZHHA 4JHLA 4BLWA 4EBFA 1ZSVA 4XOUA 1W2GA 3RC9A 3NBFA 3C8UA 1W5BA 4V1CB 3RYCB 2OR3A 3QYAA 2HB6A 4DJAA 2WB2A 3E7XA 1ZWKA 1LV7A 2GJSA 4HDRA 4TYQA 2I78A 3EPKA 2XYPA 4J49A 1XLWA 4EEKA 4PX5A 4UVIA 4LRWA 1A8PA 1ACMA 1JIQA 3GA5A 3LQRA 3PPVA 1YMVA 1KEWA 4QD3A 5F1PA 4E07A 4KPYA 1CEXA 1CF9A 4EWLA 4URFA 2F00A 2GN9A 4O8CA 1DG3A 2QA5A 3EODA 3WIBA 1Y1SA 1Q17A 3EVCA 4M8IA 4BNJA 1GDTA 1PJBA 1IQUA 2QLMA 5DI3A 3DNPA 1CUHA 3R9KA 3PQ7A 1SVOA 1NNLA 4H0CA 3HCAA 5MDHA 4AZ0A 2H0AA 1D6NA 1T2DA 4LGVA 4RZHA 1XTKA 2I6FA 4PYIA 3LQFA 3L6OO 1VKOA 1MDBA 1DBSA 1R16A 1JDNA 2C8LA 3I5UA 5EWMB 3T12A 4YPVA 3MGAA 4XVUA 2CVQA 2DUJA 2YOHA 1ILEA 1XHEA 3WYCA 3ZU6A 4KR6A 1VPDA 3DHNA 3AHGA 5T4BA 5DHAA 2CLCX 4ZAYA 4AU1A 3DCYA 4QOFA 5DHFA 4EKYA 3W8DA 3FDXA 4LK2A 5LYJA 4JOCA 4FIDA 2PZMA 1RKBA 2GD2A 5EI5A 1Z34A 2DBRA 4FD3A 1JDZA 3SXJA 4DLBA 4HH3C 2PBZA 4FR2A 5AM2A 3W79A 3HRIA 2Y1KA 4R0VA 4KIJA 4UNNA 4BJHB 4BE7B 1W4AA 1ZK3A 4GX2A 2Q2VA 4U0KA 4WKPA 1FFCA 3WGLA 4UVHA 4B7UA 1YDHA 4Q4AA 2Z3ZA 4HDMA 3FTFA 1X7XA 2VUTA 4ND4A 2ANCA 2C96A 1ZM4A 5KNLA 5LBUA 2C20A 4Z9BA 1TW3A 2H2DA 2OBLA 4XOIA 4BWVA 4WPGA 2VS1A 2A0FA 2XITA 4IDNA 4P31A 5F2NA 2OP1A 1UDXA 1YUMA 2XTNA 3G2PA 4PZDA 1YBMA 1CUVA 3QWHA 1PFKA 1VBMA 2IYOA 5CVCA 5AJUA 3IUJA 5GIOE 5B58T 3BA6A 3TL2A 1PIWA 1C1YA 1V95A 4N7JA 4WHMA 4DVGA 3N2IA 3TOZA 4OQFA 3PTZA 5ARDA 2O2JA 3QVLA 1REQA 1CUWA 3CPEA 3D8HA 3FZQA 3ML1A 3AM3A 2YWBA 1ORDA 4AS1A 2GAOA 3BT7A 2RGDA 2VZLA 1GA6A 3R24A 4ZCMA 5LQMA 2JNWA 3FPJA 5EMJA 1TB4A 2W2LA 1A3CA 3H97A 1UADA 4P5PA 2BFDA 3I6YA 3LLUA 2E49A 1Y5LA 1SVUA 4Q0MA 5K05A 4UDYX 4R1MA 1SCAA 2ODEA 3HLKA 4AZTA 1IM5A 2FW9A 4DMFA 3U40A 5A6VA 3RRJA 1WMFA 4UHBA 4WH0A 4GOKA 4W5TA 4G0VA 2PBFA 1DKMA 2CVOA 3NHJA 3CUTA 5IG2A 1NPTO 3QG1A 4OBXA 4RVCA 2TMGA 3DTNA 1WBJB 5CR9A 1M2OA 3C70A 3MPUA 5E3JA 3PCRB 4B9AA 5J23A 1HNXB 2XDQA 4O25A 4KQ6A 2GAIA 1UEIA 2Q21A 3K6JA 2O2ZA 4HXGA 4DQKA 3Q15C 2PUAA 4R4JA 3M3DA 1WPXA 3OEHA 4TV9B 4AKGA 3F5DA 3WHIA 4TTIA 1UMBA 5HE9A 5JFGA 1U7TA 4IIGA 4LJ7A 1PP4A 1QHSA 3DSRA 3SBOA 2A92A 2OC9A 2YOGA 2ID4A 4BAGA 3BPSA 3QVJA 2XXBA 2PTHA 1R2QA 1RWNA 3W04A 1CDOA 5JNLA 4UAVA 5ALZA 2PUDA 2Y1CA 4TXLA 3L2OB 1D8TA 1OX4B 2B8EA 3MGBA 2NUTB 4ZWNA 3RIXA 3ROKA 3SFTA 5LQNA 3EZ7A 4KXYA 5K03A 1HFEL 3L4BC 3Q3CA 1H4TA 4J6EA 1NDUA 1ZPDA 3V32A 2YFKA 4KE6A 3MTBA 3WYNA 1WULS 2JVIA 3D54D 4WECA 2VAPA 3ROGA 5IHXA 4PAOA 3CRQA 2ARKA 1ZZEA 4HAWA 3ENKA 3IIMA 5FA8A 1AQYA 1NRXA 3CZCA 2WRZA 1N6LA 1M1YE 1WUYA 1Y5IA 1DDOA 2PT9A 4DCVA 2C7PA 3FCAA 4V03A 3NVAA 2ZSKA 1VYUA 2LPMA 3H7IA 4J16C 3ZGLA 3NKVA 1R4MB 5U4XA 3PE3A 4D1YA 2ZRGA 2XCSB 1Z0SA 1TUEA 3EXG1 1T0BA 3U3DA 3C3DA 3ABIA 3U3KA 4OTZA 1C3VA 2PUJA 1P8JA 5GWXA 4N47A 4C6HA 3AVQA 4FILA 3IILA 4MVJG 3WYEA 4OMCA 3W9YA 4JR0A 4IV0A 2VPWA 1A4XA 1NULA 4JB8A 4MW2A 4EKNB 2BFBB 3FHTA 3E03A 5JFTA 1WUJS 4EY5A 4AKSA 5CDSA 1QNLA 2WHQA 2A94A 3SQMA 2WPDD 4MTCA 4XB2A 3VU9B 3WQSB 2Q3FA 5C1PA 2AE1A 1NLFA 1UXIA 1Z28A 3UMYA 1W29A 3VKUA 3OA0A 3ST7A 3TW6A 1G7SA 2ST1A 3DDNA 3V2UA 5AM3A 2YW9A 4J91A 4MVJP 4FEAA 1GKLA 1K7YA 1N8TA 2WMYA 3ZY5A 1I4WA 1WE2A 2HIAA 3R77A 1UBUS 4YACA 4LJYA 4ETIA 5BW5A 5IZCA 4AC9A 1R0RE 2H18A 3EY4A 3JS5A 3ANSA 4HNAB 3HDTA 2XB6A 2IV2X 3EVZA 4F5EA 4Z9XA 4BZXA 1OPXA 2DFKB 2Q9BA 4LN1A 4NFYA 3HUEA 3QBTA 1LWOA 4FQ7A 3ZS8A 2AZ4A 4MICA 4UMVA 3CQ9A 2XVZA 2PZFA 4NC9A 4JGGA 3X1ZA 3CN9A 4Q66C 3BWDD 4U6NA 4IWYA 2XADA 4BWFB 4KR7A 2YXBA 4TWAA 2OGZA 4D6XA 2PA0A 3LK7A 4MUYA 4RHFA 4BP1A 4LXYA 2CFTA 5KAPA 2FMTA 2ZG6A 1AY0A 3I34X 1QM5A 4UU8A 1IDN1 4OKIA 3BE6A 1B8VA 3TXAA 1LFAA 3W7AA 1PUIA 1EQ2A 2JASA 3NXKA 4GG1A 5LOVB 3PUVA 1QYCA 5ALOA 1V3UA 4N5HX 5H68A 3R3WA 3EZLA 1M83A 1EUDA 1FVFA 1QGUA 2PQ6A 1BX0A 2Y4OA 4QT4A 1AQJA 4JI0B 4NFHA 3DMTA 3LOQA 4GMFA 4LRXA 3HWSA 1ZOPA 5C3MA 3RRBA 3T9BA 4CMJA 2IW1A 1ECGA 2J9FB 2V7BA 1N2CB 3EBPA 5DV9A 1YOVA 3HSYA 5FAXA 4D42A 1YB1A 1VPWA 5E95A 3HKCB 4HSGA 3KL2A 3THWB 1YL6A 4OYLA 4AYTA 4TYNA 3X0DA 4CODB 4PYJA 1WCXA 1HT1E 2O3UA 4U7HA 1BRTA 1L5YA 1XRSB 2CNDA 4BNHA 4ZN6A 3LUJA 4GH5A 2I2BA 3C8HA 3KKEA 3LT4A 4NSNA 4TQGA 2VWGA 5AHOA 1I01A 1KZ6A 2VPTA 2ZOSA 2AEMA 2H9YA 1KIFA 4MI3A 1O87A 4WKNA 2IH5A 5LBTA 3WLNA 5C1IA 4K6KA 3T3MB 4H3KB 4YP5A 3TQTA 3U7GA 1WA5A 1U2QA 2ZBUA 2YOFA 3ZKAA 4IQGA 4JV5B 3ZIAD 1M0EA 4FGWA 2R1VB 3MHTA 4I4IA 1T0JB 3CNEA 3ZCRA 4QVIA 1VQ1A 2CUTA 4YFVA 5FR1A 1D2GA 3I1FA 3RVOA 5FFNA 1QQ5A 1PWEA 3GDOA 1XZGA 3T7JA 2N42A 2RHLA 4A2WA 1RWVA 2W11A 3RVJA 2C07A 3BWCA 4S2UA 5EJAA 4Z0HO 2M32A 1FOEB 1C7EA 5LBIA 4CJXA 3S29A 5HKKD 4QC2A 4W8HA 5I6DA 4PZYA 3Q3HA 4BECA 3EARA 2AN3A 4MQLA 2A3NA 1VZ2A 1MVLA 1COWA 1TLTA 1T4BA 3T99A 5EKDA 1HURA 4MDFA 4KYVA 2UV8A 3BD7A 3F4KA 5TS3A 3WIVA 4LVUA 5CXQA 3KSZO 3K6KA 5AT1A 3SR4A 4JI8B 4ITVA 1JSXA 2TRSB 3OEYA 3P27A 1K97A 2POQX 4P3YA 3U4HA 2ACWA 3HJHA 2OCDA 3PC6A 2R4QA 4DBVO 1MFZA 1UEJA 2VF2A 2WDZA 4HRYA 1XAJA 4MDYA 5HWSA 4WK0B 1IJEA 1Y48E 2ZBRA 1Q0HA 1SHUX 2YFYA 4YAFA 4C87A 4ZYLA 1M7GA 3BCRA 2VDQB 2ZUDA 3M1LA 1MVOA 5LQCA 3ROTA 4TTQA 3NWPA 1KEPA 3I73A 1JEYA 1XZCA 2AFVA 2QLTA 4JN6B 1Q50A 1H1DA 3DCIA 3HZHA 2BGGA 3M5WA 1YDEA 1KAGA 1NYRA 4GHWA 4XARA 1K9VF 4FXOA 4G63A 4NBWA 2OPHA 1XVUA 2PX8A 3K4QA 3QEMB 4EI8A 4RULA 1V47A 2JCVA 3BEOA 1XC7A 3AOGA 4Y1RA 3N0VA 5ALJA 3ZE7A 4M7WA 3P9IA 1YFKA 5KJ1A 4GQIA 4FFNA 1OBHA 3JQ9C 3GRFA 2ZITA 4PS1A 4XD2A 5JZSA 4MUXA 4BUZA 1O2DA 5JDCA 5EFZA 1DT3A 2Z09A 4BFZA 1XCMA 2X8BA 4J0EA 2QOEA 3CF2A 5AKJA 3PLAE 5CCDA 1KDPA 3STUA 2YQ4A 2XKAA 4YP9A 5D01A 4D6PA 1XD2B 4LE0A 4TLDA 2ZB8A 2CWWA 3U4GA 3OJFA 2OL4A 2JIZA 4Q1EA 5H9WA 1GZ5A 5EZ6B 4A6XA 1E18A 5JS6A 1ZN2A 2LZ0A 5ALNA 1Q21A 3OTGA 5EWLB 5H16A 5SICE 2WM9B 3FFBA 4DWJA 1UJ6A 2ZJ3A 2O6LA 5KSZA 1IWOA 3CW9A 3QEKA 5HUJA 1X9IA 1M2GA 2XQKA 2AVDA 5ALKA 4B4KA 3RG2A 2G1JA 1E99A 3K8QA 3N8DA 4MVJA 4Q1DA 1N6NA 3VVMA 3ICVA 5JD3A 1JR2A 1QGAA 4LKRA 3WADA 3ZJTA 3WBJA 2FSUA 4B87A 2C54A 3BMNB 2ZKIA 1FRZA 3LVFO 3HH8A 4KQ9A 2UUBB 4FYHA 3SLRA 2FPRA 2C00A 4CM8B 4ZV9A 5CX1B 1EDEA 2WZCA 3VPFA 5IVPA 3AKEA 1TFUA 4B4DA 3G7SA 3MTQA 4MX8A 4QG7A 4RK0A 4Z54A 3FFTA 4Q7MB 4GPIB 5A5VA 2HX1A 4FE7A 1VFNA 5A4JA 2ENUA 1FLAA 4EX7A 5FQOA 1TVMA 3CKMA 3OHSX 4KE9A 2J0QA 4EUFA 2CV0A 2F64A 2YJGA 3VSCA 4C0LA 4PVCA 3KJFA 1RRVA 2EZTA 2W2NA 2YWHA 5B37A 4FINA 5CVJA 4ZYXA 5BUQA 3IQHX 1N2JA 3WLJA 3JQGA 3JVDA 5J40A 3CZ5A 1U0LA 3JQ7B 4PIPA 1BH6A 2H5EA 1X0VA 1IEWA 2XMDA 3RV3A 1C7FA 1U8XX 1I7PA 1QZZA 1UAGA 1WG8A 3EGOA 3L6UA 2GEUA 2CDRA 4KAFA 2VHXA 1K3TA 1T0IA 4QXMA 1MHTA 3EC7A 2I6GA 3IDFA 5CDTA 3LUGA 5AW4A 1F2TB 1RYHA 2VJCA 3IAXA 5HXAA 1M73E 1GRNA 1YS2X 2GF0A 4HNTA 4MK4A 2ZUBA 3X1XA 4FFRA 3WISA 3ICPA 4WIAA 4N5LA 4R68A 2QMEA 4TX1A 3K0CC 5HJ7A 1FQOA 1OUMA 5H82A 4FZJA 3T1OA 4CMBA 5D51S 1A9SA 5FPQA 4M7OA 2I2FA 2QW0X 1I6LA 3QOFA 1TJ4A 4DJ5X 5CXSA 1EXNA 1ECLA 1LPPA 1NSYA 1RYBA 2JJYA 2ADMA 2UZAA 2EBWA 2YIDA 3LCUA 4FFPA 4R8VA 2VI5A 3O7MA 1TKAA 1I2CA 1JQLB 1YC2A 4TTAA 5IBCA 3D6HA 2BM8A 3LP8A 3CONA 3AVUA 2XMRA 4MO9A 1KY2A 3BFVA 1RBQA 1V7ZA 2C2ZA 3UO8B 1Z7BA 3U16A 2Y2UA 5F73A 5KQRA 4BNKA 2GHTA 3L49A 4PV7A 1BW9A 4NU0A 2WU4A 5AI9A 3T3NA 2OLEA 3V8QA 3U19A 1AKYA 4EB6A 3A3PA 3O9VA 1XXHB 2OHGA 3VDXA 2UXDB 1QDEA 3HU2A 3N8HA 4N5IX 4RDHA 1YF3A 1IBMB 4WFKA 1KRWA 3RANA 5CT4A 3NYWA 1B43A 4G09A 1SQ5A 4LQLA 3BX1A 2I54A 3H9BA 4NOJA 1OBFO 5THKA 4BFUA 4MULA 4DCJA 1D2MA 1P1IA 1JKIA 1A7UA 4ZRDA 3EVEA 3TX2A 5HRAA 2XVAA 1K7XB 4YCAA 4HDCA 3V8NA 3W6NA 4LHZA 1LW7A 3HR4A 4RCYA 1ZUD1 4WZAA 3R7NA 3ZU4A 1HYGA 1JKJB 2EZ9A 1UJBA 1CW2B 1PV4A 1V25A 5D3QA 4DAEA 5BQOA 1XTTA 3OPYB 1X7ZA 4Q7LA 1UM9B 3MWFA 3GQVA 1PZMA 4M9SA 3ROXA 3VKFA 1YQXA 3B6EA 3IHLA 1W25A 1EXDA 1XZFA 3QKSA 2FN3A 2J6HA 2W6PA 1OCEA 4JAVC 1VKNA 1FJHA 3P8ZA 4X1IA 1A9XA 3M5PA 2DR2A 4EMUA 1RHKA 1G2PA 1OLUB 2AW5A 1AQNA 1IEQA 5AKYA 1Q77A 1VE1A 2V6BA 2FUEA 1SBYA 3L9XA 2F1JA 2IPLA 4KQJA 4DF3A 5I7EA 5K3OA 4OFBA 1TK9A 3GFFA 3LFUA 5DXAA 3I2FA 5H3LA 2C98A 4BTVA 5FHQA 1KJIA 1A8QA 2XB8A 1APBA 4XQEA 1FYFA 4B8ZA 1DSSG 2IYSA 1Z5VA 2DCMA 2W6MA 3MS7A 1Z18A 2VT7A 3RDPA 1TKCA 3ZYCA 3ZWNA 1CUDA 4EDFA 4J9VA 5CJPA 3KB1A 2C29D 3EEYA 3H5LA 4YQYA 1WBBA 3VKHA 3DZBA 3K09A 1NHGA 2NZJA 2RK6A 4JJKA 1GPWB 1F14A 3RVSA 1GLVA 2FPPB 4WXEA 2QBYB 2OCIA 3TNYA 4CDMA 2HQOA 3CF4A 2EAUA 3A04A 4LPKA 1TZMA 1XTRA 4K2AA 2WPNA 5J9FA 4YRGA 1GO2A 1F0KA 1JEOA 1SCJA 1EK0A 1MO6A 2FMKA 1H22A 2ZIAA 3ENWA 3C3XA 2RHDA 3DOJA 4MRSA 5EZYB 5MF6A 2WV7A 1WXDA 3B78A 3DDOA 4RIIA 4B43A 3LP5A 3H3JA 4DDKA 1HKUA 4RH0A 1Z73A 2ZIZA 3SMVA 3PE6A 4WCFB 3ELWA 4EECA 1RJ9A 1HMPA 4ID9A 3JQPA 4WK6A 4KXMA 4Q12A 1WCIA 1OXXK 4QPDA 4TQUS 3PFFA 1R0ZA 5I7WA 3D2LA 2WFLA 2Y1EA 3AI7A 1XVTA 4NYMQ 1EVIA 3NLLA 3JD2A 5AXAA 2G67A 3RAPR 3ROFA 4F06A 4YH1A 3BS4A 2HTFA 4EUSA 2GBCA 4JU8A 1SURA 3P2JA 4N7MA 3DDUA 4P83A 2RJOA 3EGWA 4OK3A 5J2TF 4BX2A 1KTVA 3IKLA 4L5JA 5FORA 3FJ1A 2JANA 1F2UA 1A88A 2OBXA 2PKCA 5HKAA 4WUVA 3GLGE 1MXHA 2NP6A 5EP2A 4N8EA 4RSRA 1Z63A 1RSZA 3NS7A 1XBTA 4PG6A 4CFSA 1NLUA 2DJIA 3ZXYA 2OXRA 2YICA 1W4CA 2M6SA 2E85A 3I1IA 3OQIA 1O94C 4GMHA 4H27A 2H5JA 1F2UB 3NHAA 5DWVA 3B3JA 5E3IA 1BO6A 1OJ7A 3OQPA 4XVQA 5EIAA 3UMCA 1Z56C 3JYQA 4EMBA 3FDFA 4RTPA 4Q16A 2VPIA 4REOA 1BG6A 5FUMA 2WEKA 3D4PA 3IV9A 1YMUA 4H7KA 4G1FA 4GX1A 2I4OA 4YN3A 1R15A 3RK1A 5BWBA 4N01A 1NI4B 2AMJA 3X1WA 4FR0A 3NAGA 3SM3A 1RPNA 4OYHA 3T06B 3V2IA 1VMAA 3AXTA 3O03A 4XJTA 1R12A 2X2PA 1ADFA 2ZANA 3KKNA 2INGX 3KYCB 5I9TA 1P5JA 2DPLA 4LPSA 4TZ6A 2WQ6A 1T9KA 2R8OA 3G68A 5J63A 1YVDA 3E9QA 2O6HA 1L3IA 5T5QA 3ZH2A 2I4LA 1DC5A 2VOJA 4MI6A 3PWSA 4BEJA 3DEFA 3WMEA 1XTSA 4DTIA 2BHRA 2XCLA 2CLLB 3ZWWA 3G2QA 3BXGA 3DXYA 2C94A 1DAEA 2C4VA 1M1ZA 2F17A 3FYDA 2R79A 1KVTA 2YVKA 3D6NB 4WKOA 3DKPA 3GUYA 2IY8A 3G9TA 4FFDA 1OX5A 2X8JB 3L5KA 3R5SA 4MAFA 4WLFA 4W1PA 5DTMA 4Z3DA 4FC7A 3W5SA 5C18A 2OO3A 2QSJA 3HN2A 2NQ8A 4CIVA 3DLHA 2I8LA 2W8BB 2ZYWX 2P27A 3UAGA 1T9DA 4RSHA 4RESA 3TL6A 4D57A 3DOIA 3ZVKA 2XUKA 3HM2A 4DT1B 4BO2A 3FFWA 3ZNPA 1JLLB 1KJNA 1NMXA 2HDWA 3GCXA 4JCOA 2I4MA 2JZCA 3LA8A 2YQ5A 1YU6A 3GMTA 4UJ3A 4DLLA 4M76B 4UARA 5K8IA 4OMUA 1ZC4A 1K1EA 1NVVR 2QX4A 1NU8A 4LGCA 5DTJA 3RVBA 4B7AA 2FJPA 3AJDA 3BMCB 3VH3A 2J0VA 5BOSA 2ZBEA 4BLRA 2Q0SA 1UAYA 3E9YA 7REQA 3O90A 1XU4A 2VP2A 2VSYA 4F3RA 1GUDA 2PWYA 4V2IA 4YROA 2AOTB 1JVBA 4QU0A 1DIRA 4RLFA 4KFCA 4HAYA 2A1TR 4WZAB 1R0YA 1ZN9A 2LKCA 3H9EO 4G97A 4DC9A 1FPQA 3N39C 4WXRA 5CTJA 3RRZA 4KQEA 4IKPA 1F8FA 3AF0A 3FTCA 2J3HA 2HLNA 2I4IA 4R1NA 1US8A 2FSIA 3AI1A 4X93A 4BTEA 3P0RA 2J0SA 2C7VA 5K20A 3E58A 4GI7A 4X1KA 3KQTA 1MD9A 3G02A 1E60A 3DBHB 1W85A 1Y7HA 1CQIB 2WD7B 3X43A 1YJ5A 1FUKA 4A0QA 1XXHA 1XV5A 3G7NA 4CMAA 1M7HA 2AXPA 5I7RA 1EGHA 2LDBA 4E1VA 1GCGA 5G0UA 1M75A 2BBTA 4OL9A 3OICA 4PZUA 3E22B 1EVKA 1Y4UA 1UZNA 2VYNA 3HR8A 2BHLA 3R41A 4A0HA 3O6VA 1E62A 2BMEA 3L1KA 4E4YA 5BRJA 5JCXA 1QQ7A 4MVYA 4O2BF 5K45A 1BHO1 3JYPA 5H83A 2C7OA 4PIMA 3U6KA 2VTBA 1NZJA 2II6A 1OFHA 5ES3A 4C88A 5DYTA 1E7WA 1D7AA 1Z68A 4DCTA 4ND3A 3WJ2A 1NVTA 3E1KA 2QT1A 3EDMA 3PNLA 4AFNA 1AT1A 2QF7A 2GHQA 3QMVA 4FT2A 3VOBA 3LHKA 5CJJA 1Q83A 3QBEA 3VYTB 3A31A 2EQAA 4C20A 1FC0A 5KOHB 3TI7A 2PUTA 2Q5FA 2R8ZA 2P1DA 3HADA 2V7PA 3CNNA 1ZGBA 2QRVB 3N7TA 4K1XA 4G86A 4LKOA 2BGRA 2CN1A 3H5IA 3G2OA 3TLJA 3WK8A 3EN0A 3UB4A 4TL6A 1ODLA 1M2VA 4GMGA 4MJ3A 4H4EA 1EK2A 1I6KA 3KFXA 4JQCA 5EXTA 1RRMA 2CB0A 3V7NA 2IBSA 2C2HA 3MPOA 3IRUA 4JR1A 3S2EA 1FQKA 4Q9IA 1KIAA 1T15A 2CNLA 2H1HA 1NXTA 2D3WA 3CJTA 3TB4A 2HI0A 3UWPA 4WWHA 4XWOA 3COSA 1PR1A 5A2QA 1PT8A 3BYZA 4UATA 1ESCA 2QSUA 4K9PA 4RH3A 3UH1A 1KS2A 1ZK4A 2D7CA 1HUQA 3UJCA 4N40A 3W8EA 1MIHA 4GICA 3SSAA 3LI2A 4DIMA 4DB2A 5DF1A 3DVLA 1Y9JA 5HF6A 4TTJA 2IWRA 3TQSA 4JITA 1T5HX 3U7IA 1B6TA 3L6DA 3PVSA 4F92B 4AKTA 3L9WA 2P0AA 4PINA 1QH8B 1RRKA 2NZVG 4OLAA 1K3UB 2RC5A 5IN5A 3ONWA 5FA6A 2J67A 1G2OA 1NUAA 2O5RA 2OKGA 2PCJA 2XGMA 4L0DA 3WWEA 4AS3A 5C81A 5JH7F 3OEEA 3F6YA 1RM5A 1HKHA 3UJ3X 1LJ8A 4LYYA 2O2XA 2NYVA 2MOKA 2YV4A 1FQWA 4R05A 3VFDA 4ER5A 5C9ZA 2VRCD 1WP4A 3HVKA 2OCBA 4AZ3A 3OJOA 4L6AA 5AUOB 1BVRA 3ABOB 2D00A 1ZWLA 4HB4A 3O74A 4REMA 3TTYA 5EA2A 2Q9AA 5EHQA 3WNZA 1YB7A 1Z5WA 1FMJA 3SZRA 4FKZA 1CQJB 4CF7A 3BF7A 5KYVA 2C5HA 2V55B 2ZYTX 5JNVA 5C31A 1GAXA 2REQA 3RPEA 2DFVA 1PLJA 2ZGVA 4PR0A 4RHXA 4HEA6 3QPCA 5DX8A 3LY9A 3BZUA 4O5AA 3TIIA 4EPVA 1PVOA 4GE0A 3WJ7A 5BQ5A 1HOTA 2G77B 2JLSA 2OCXA 3JAKA 1AGXA 4O2RA 1B73A 3SYNA 2GN4A 2P78A 1YZLA 5FI5A 5KX5A 1XVIA 3TSYA 5AKEA 3WDSA 4WV3A 4EGJA 4GS5A 2V65A 4PC6A 1KEEA 3LQYA 3O8DA 1ZJ4A 3FOEC 2XCQA 2J5XA 4C0AC 1FNBA 1XA3A 2HIMA 4CDRA 2LXNA 3LKVA 3O1LA 3RUCA 1YKFA 5LDDC 2BR5A 4MV9A 3KHUA 1J2UA 3NEJA 4OREX 5EPEA 3TSCA 3CLKA 2E5FA 4OHVA 4WN9A 4UHCA 1EFCA 4WSOA 1DAMA 1ZXBA 1VDMA 3GLGA 2B5OA 1P31A 1D9ZA 5ESWA 1C9EA 1SOUA 2PMDA 1XU7A 1GNQA 5BN3B 3Q7PA 1J7JA 4RK7A 2J1LA 4BZZA 4MZDA 3E70C 5JAZA 1O95D 2GM3A 2XAAA 2X7JA 4M8LA 3WL5A 2XXAB 4DLXA 3R1IA 1NJ6A 2PX0A 3OT4A 4Q4DA 2NM0A 5IC6A 3TOCA 3EHEA 4GEKA 3TWOA 3EUWA 1W19A 2G40A 2VWPA 3D8BA 3ECCA 3I0MA 4Q5IA 5D3ZA 3WLIA 4ENWA 4EFKA 1QNFA 1XCPA 4E5PA 1WSAA 1UDRA 1V16A 4F6CA 5M7EA 3HCPA 4B3FX 1AS2A 4LBVA 1U1IA 5A06A 5B3JA 2IEDA 2W2TA 3PS9A 2RE8A 3QVOA 3GA7A 1DKNA 1Z39A 5G1PA 3R9IA 1UFOA 2CCGA 4Y3UA 3FHCB 1FNNA 1A27A 1PV1A 2C92A 5UKDA 3F6CA 4JUFA 3WGVA 1GEEA 4C3UA 4FMBB 5BYKA 1KY3A 2V8BA 2X4IA 3B1KA 1WB6A 3DEKA 3ZQ6A 4DNFA 3AEKA 1SHJA 4MINA 4HC4A 3V8MA 2QZZA 3E9RA 3UM9A 3ZLTA 1VG0B 3ISJA 2FPWA 3N87A 3OCCA 4OXXA 3ZNQA 1KARA 5DRYA 4B8WA 4EG8A 1DI0A 4ZIRA 1HMYA 3QF4A 3STYA 2GEDA 2YXDA 3LCCA 4DANA 1MB9A 3AI2A 3C45A 1CUFA 1ONPA 3H17A 4RY9A 4B8YA 3QUCA 1X7WA 4MRVA 1IWPB 3ZHUA 4G26A 2UYQA 4J4HA 5AVJA 5AW8A 4J3NA 4Y6PA 2J4FA 1YB2A 2VT3A 3DLTA 3NETA 4NOLA 3UWDA 2J9YB 4BBAA 4R71A 5CYGA 2HHCA 5CRIA 3AM4A 1MO3A 4N54A 2O59A 2HWWA 2CNWA 3I6IA 4MRMB 3SIRA 1Z8NA 3FRHA 3IA7A 4PZPA 4QGSA 1TKBA 2VNHA 3UY4A 3GUVA 1NAHA 4M1KA 2X5NA 5FI3A 2WILA 1Z2DA 4QDTA 1P2VA 3Q72A 1DIAA 1C2YA 1R9GA 3U4CA 4Y9SA 2JG3A 3I05A 1YA8A 2W6JD 5J4YA 1A7KA 1BMFD 3GMSA 2YWGA 1IG0A 3E7FA 3LHFA 1UKYA 1YAJA 5CIQA 2HA6A 2ZVJA 5TEVA 1GRVA 4QPNA 3GLGB 1AKNA 2HCRA 3K9HA 4JJ6A 4HNHA 2VTDA 4P36A 1WXEA 3GCZA 3ICWA 1II0A 4WY5A 4Y6QA 2B82A 2VSNA 3FGOA 2XAUA 4WMLA 5DASA 3ZUPA 4W5HA 3SHOA 1Z7WA 4AUMA 2UXCB 3KR0A 4F1JA 1Z2OX 1DJOA 4Q18A 3V4FA 1AQLA 1SIBE 3OY7A 2PMEA 4IFTA 2Z5FA 4ENTA 5FA5A 2B3TA 3CV3A 5T57A 2NUPA 1VE6A 1C7JA 3I42A 2OA0A 2C5BA 5JS7A 3BFPA 3AEXA 1WMDA 5DPMA 3TECE 4BQRA 5EPOA 1EVZA 1U4SA 5FEUA 2Z4TA 2IIVA 2RARA 4JI6B 3RLFA 2LD4A 3WGIA 3I5AA 4YO7A 3L1UA 2XQJA 3N8KA 2QX7A 2JJMA 3H1GA 4NZMA 2DPMA 1N5OX 5TXGA 3G2MA 3NZEA 5BSMA 2GT1A 1MABB 2CFIA 5IVDA 2BBWA 1BA3A 3KZMA 3L1VA 3A1FA 3DMPA 3GEBA 3PC8A 5DJ5A 5C8DA 2F8MA 3KAQA 1IL0A 4XWKA 4UPDA 2B20A 3HJUA 3ZI7A 1L4HA 2XQGA 1MF7A 2Z6VA 3T5AA 4EL5A 3C97A 3HZZA 2ZR7A 4EUEA 5CG1A 5LWHA 2IJGX 4NBRA 1S8AA 4NZYA 4M9QA 1TCUA 4MP6A 4U0JA 1SVKA 2JGJA 3BKXA 3W1WA 2DOKA 1B8UA 2C1XA 3EIQA 3JQ8B 1FDWA 4M0UA 3B9PA 2JK1A 4UQOA 4F4HA 1K6MA 3D9QX 1EIWA 2YV5A 5DCUA 5F9MA 3RTBA 1OLXA 3H99A 2FZ5A 1RIIA 1IH8A 4Z7JA 4EPYA 1HT3A 1A4RA 4IQ4A 3QFSA 4CT5A 1RLUA 5BVGA 2EU8A 2CKDA 3QWAA 2WJIA 5EKXA 2G9QA 3CR8A 3TCXB 2QN2A 2XYHA 4HO1X 1CR6A 1Y33E 2PQMA 5FPHA 3ZYZA 2JHAA 3PR3A 5LXTF 3W9UA 4BO3A 5JI3E 3GC6A 3HB1A 4U7JA 5LQDA 1X8LA 4NZOA 1JHRA 2GFHA 1ESDA 3HVHA 3NI2A 4ZQBA 2PT5A 5BORA 3STWA 4EX6A 2PAFA 3U7FB 2GBIA 3K09C 2JLVA 1SCBA 2QR2A 3AF6A 3A9UA 4X1YA 4DL9A 3U60B 5KSPA 3OFVA 3DOHA 4IVPA 5DNCA 1FX0A 1E32A 4Q3BA 3GEHA 1EM6A 4I99A 4DM4A 2EWMA 1SXIA 2KW5A 1D2HA 1ORRA 2WC1A 2FQXA 1DBIA 3I6QA 3TCKA 2QVLA 1FU7A 4Z86A 1T8SA 1ZH2A 4D3ZA 2XTAA 1YRQA 4INJA 4C06A 1VL0A 1SCNE 2C2KA 2ATIA 4Q15A 4JI1B 1UXOA 2A3RA 4UHDA 1PEAA 4HNSA 5JTUA 3IURA 3UUFA 5HQ3A 4OP3A 1R3UA 4CKZA 5JYBA 4W63A 1XNGA 3RQSA 1PFWA 2MMCA 4TV9A 1RQNA 1FIUA 4WT7A 2IYFA 3GJ8A 3QUBA 5BSTA 5I7SA 3AR4A 2GYWA 3ZGXA 1Z62A 3VKGA 3CSDA 2PUWA 1LW6E 3JQAA 3C8MA 2HRQA 4CEHB 1SG9A 2YHBA 3HB4X 4BBJA 1SELA 2B83A 1JDJA 5JRJA 3LLCA 3QV1A 3MXOA 4NMXB 4EG4A 4HB2A 1HG0A 3R7BA 4I19A 5AW0A 5KB3A 1CZKA 1S02A 2R48A 4L2IA 4B84A 1H69A 3MCTA 5GJWC 3UG6A 1JHQA 3KVYA 1R5JA 3P4YA 4YCJA 3BH7A 1WPGA 3JSAA 3CNOA 3QM1A 2W83A 2QQ5A 3HJBA 4HZUA 4UDNA 5EQJB 4HNUA 4OX9Y 3TNJA 1JDTA 1CX9B 4PPQA 2BY4A 4BUJA 1WV1A 1SCUA 4BXOB 2HCFA 4Z1MA 2JI9A 1BYUA 5LXTB 4I81A 2F9LA 1CVIA 4HR7A 3BK2A 4ME6A 4MJLA 4UAJA 4TXHA 2ZSJA 1SCQA 2OCPA 4FGLA 1YHNA 4YQZA 4RGVA 2WJWA 2Z3VA 5AO9A 2NU8B 1JHYA 4XQCA 3JY6A 2OOSA 3OIDA 4LY3A 5EUMA 2XY4A 3E2PA 4HNVA 4Y2PA 1LDMA 3CX4A 3G0GA 3JARB 4MKHA 1RI4A 2RMKA 4DDHA 1II9A 1XG5A 2SNIE 3FGZA 2AGVA 3TAUA 4ZC8A 2XDAA 1LDYA 1H65A 1EXVA 3P19A 4KYIB 3I5YA 4RE6A 2R751 2EGHA 2EFDB 1P6UA 2AK3A 4D79A 4NX2A 3GQBA 4P32A 2BEJA 1K0FA 1YR2A 2GRJA 2OEPA 2ZB7A 1F8XA 1FS6A 3I9OA 4GD3Q 1IZ9A 4KYUA 4LNHA 5HBRA 3WZ2A 1ICIA 7AT1A 4DG8A 5EEHA 1W75A 3UC9A 1E9FA 3VISA 3OIYA 4QOHA 4GXTA 1X14A 4GDMA 3X1DA 4P34A 1AJEA 4C6TA 1DEAA 2OGWA 5G0WA 4RSGA 3TK1A 2XMBA 3GJ3A 5IXJA 3JVVA 3AF5A 3K0EA 3PPXA 5FUXA 2GRAA 4D9KA 4CL2A 1AS0A 4DQUA 4PFSA 2GZ3A 2FNAA 3WV5A 4EZBA 3ADOA 4KLCA 1Y9DA 1MRSA 2QX6A 3MYYA 5LU9A 1V3TA 1GEGA 1WW8A 1CV2A 1VA5A 1KZ1A 2CXHA 1D2EA 3QOWA 2WSBA 1QVWA 3P9QA 2DH6A 4RZIA 5HIIA 1PJZA 2FF7A 4XD7A 3T8YA 4E11A 3HA3A 2C9CA 5C5CA 3T9AA 5FO1A 3KTDA 5E7IA 4J4BA 1DB3A 2X8AA 1N8KA 3R3SA 4B3TB 5K8VA 3BGDA 2OO5C 3DAFA 5FWDA 2HC9A 4N5MA 4EG6A 3BFXA 3U13A 2CVFA 1JBEA 4JLKA 1UBLS 1KBZA 1U7PA 2B4AA 3Q3VA 3I2GA 2VJQA 4QGBA 4D8TA 5A9SB 4IHJB 3AKYA 3P9RA 1DEKA 1NW4A 3IRVA 4DA7A 3RF7A 3LDHA 4FZ3A 3KSMA 4AP5A 3KVNA 4KQGA 2UYHA 3QYJA 2WVAA 4CKBA 1QFSA 1S7CA 2CBZA 1NUHA 4BFCA 4MW4A 2IPXA 4X1OA 4AY5A 2WU0A 1Z36A 1GGNA 2J3MA 4CQMA 2JLAA 3LD9A 2QJOA 1E5LA 1SUCA 4YJ2A 2ABWA 4NARA 2FI1A 3AGPA 1CQXA 2WE7A 1GLNA 1TIBA 2WHXA 4JGIA 1L7NA 1RU3A 3FOFC 3LT1A 1B8OA 4CQNA 2R60A 3PD7A 1RMQA 2YWEA 1YIOA 4XQGA 1R8SA 1AN9A 3D64A 3FUTA 3U37A 2XVYA 1IK6A 2D3TA 3CR3C 4GWKA 4XSGA 4YRIA 1TXGA 5JBIA 4MV3A 2GEKA 1BCSB 2OG1A 3AR9A 1K63A 1P1FA 2G1AA 3F90A 3QX8A 3P9XA 4L8WB 4UREA 4NDAA 1UJMA 4KEAA 1ZMOA 2X15A 5CCEA 5GMOA 2IHKA 2V9CA 4OA8A 4RQTA 4ZI2A 2ACEA 1NYQA 2ZRFA 4G84A 5DBHX 1WHTA 1RJ9B 1NBMA 3TW0A 4Q3LA 1WBDA 4V0ME 1ML4A 3VV3A 3GLIE 5IASA 4RQAA 1N9KA 5I48A 1P81A 3QLVC 1G4AE 5K3FA 5BNTA 2ID8A 1XWIA 3FNHA 4K9QA 4RWEA 2RGNC 1CY1A 2ZJ5A 4I4CA 3H8SA 5BW6B 5IDYA 1JZQA 3UVEA 3RHSA 1Y34E 1JEEA 2PNJA 3VZBA 3HSKA 2E4WA 1IBKB 4LE2A 2R6ZA 1T5TA 3QFTA 4QNMA 4QTZA 2FUCA 3UPUA 3GU3A 2AMYA 2OGUA 2VJOA 3CLSD 4BDSA 3JQ6A 3WG9A 1GXSA 4EB8A 3VHXB 2BFPA 4HB0A 1U11A 4KIGA 5JCZA 4BFLA 3F9RA 3H6GA 2RSLA 2XNHA 4QVGA 3WK9A 1RKVA 3CKKA 1JH9A 1PWZA 2FEAA 4ZZ1A 3BN3A 2W93A 3PUJA 1YRLA 5EJ9A 3IP6A 3CZRA 3RTAA 4ARZB 3DMRA 3HFGA 3ZHZA 4LQCA 4MR9A 3WICA 2GZDA 2OB2A 1JIVA 1TU3A 2I2DA 2GCGA 1BDBA 1G20E 1ZZGA 2FU5C 4J3JA 4M0LA 3G0OA 1S3IA 5F4ZA 3RBZA 3PA8A 1LK5A 4E4TA 2CFCA 1J8MF 3WQBA 2BSAA 4C6SA 3UV3A 4RZ3A 4ZKEA 4I3GA 1F12A 3KUCA 2Z3WA 4HAUA 4YJGB 2QTMA 3DKRA 3ROZA 4NFSA 3TVYA 4X85A 4U7DA 1SEPA 5E9JA