4GBJA

Crystal structure of nad-binding 6-phosphogluconate dehydrogenase from dyadobacter fermentans
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
286
Chain Sequence
MSEKIAFLGLGNLGTPIAEILLEAGYELVVWEPLTKLGATVVENAIDAITPGGIVFSVLADDAAVEELFSMELVEKLGKDGVHVSMSTISPETSRQLAQVHEWYGAHYVGAPIFARPEAVRAKVGNICLSGNAGAKERIKPIVENFVKGVFDFGDDPGAANVIKLAGNFMIACSLEMMGEAFTMAEKNGISRQSIYEMLTSTLFAAPIFQNYGKLVASNTYEPVAFRFPLGLKDINLTLQTASDVNAPMPFADIIRNRFISGLAKGRENLDWGALALGASDDAGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase NAD-binding
publication title Crystal structure of NAD-binding 6-phosphogluconate dehydrogenase from Dyadobacter fermentans
rcsb
source organism Dyadobacter fermentans
molecule tags Oxidoreductase
total genus 97
structure length 286
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gbjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gbjA01
4PLZA 3TNLA 1CJCA 1VSVA 2WE8A 5AVOA 3PQDA 3ITDA 1QV7A 3AI3A 3P2OA 3PYMA 4JCOA 3H8VA 4RQUA 4W7HA 4WNCA 3PI7A 3VKUA 4DQUA 1YB1A 2GERA 3KYDB 2HUNA 3DMYA 1XYGA 1N9GB 4J1QA 3Q11A 4F6CA 2ZTMA 4CM1A 1NQTA 3EVNA 2W2KA 1E5QA 1T2AA 5EJ2A 4AJEA 5JDCA 3ONFA 2NWQA 4J7CA 2X9GA 3E1KA 1W0CA 4WGGA 2B69A 3RJ5A 1Z7EA 2B4RO 1G0NA 3BHJA 3AUSA 2C5AA 1PZHA 3F1LA 3DOCA 3WGYA 2P4HX 2GCGA 1GCUA 4IGEA 5DBIA 2H63A 4EJ0A 2Q1SA 2IDZA 4CLEA 3AY7A 3L6OO 3W8EA 4XKJA 1RPNA 3RROA 4E32A 5JS6A 4OOFA 3DAFA 1B16A 1QYDA 2X23A 3FNHA 1I3NA 4RDHA 3KUXA 4FJ1A 3H5AA 2HSDA 2B4TO 3I3OA 1NM5A 5BQFA 1NBOA 2QW8A 1VM6A 4E3ZA 4MP8A 1G0OA 2WE7A 3GNQA 1H93A 1I3MA 3CZRA 1PU2A 3CTVA 1HXHA 5T64A 3HDJA 4DBZA 4PLWA 1RM3A 2EP5A 5ILOA 3FPCA 1XR3A 1Y8RB 1K89A 4KTTE 1SOVA 1O89A 1JKJA 3DWFA 4RZHA 5L7YA 4RCVA 3U09A 3FSRA 1PS8A 1SBYA 3D0OA 1NPTO 2D0IA 4I1IA 4PLHA 3I1JA 3K8ZA 4HV4A 4CLOA 5JAQA 3H9QA 2Q4EA 3DHNA 1CDOA 3RC1A 1QYCA 1YS4A 2BKAA 5TJ9A 3DZFA 5DZSA 4K6CA 3U4CA 2FR8A 4NI5A 3JV7A 4LW8A 4KUGA 2OL4A 3QWAA 2RBEA 2YFHA 2X6TA 3JYLA 4EEXA 1KERA 5I9NA 5A5FA 1LLQA 2V6BA 2XXBA 4CMEA 2V6GA 4D79A 4H16A 4MVJE 4L4XA 1UJMA 3H9UA 3GC6A 1P33A 4KDFA 2VWGA 3I9KA 1UR5A 3U3XA 4R1TA 3U62A 1B15A 2O50A 1ZXBA 1QLJA 2FZWA 3PHIA 4J2HA 4BO6A 3Q0EA 3ZN2A 2VN8A 2HMVA 2P2SA 3AK4A 3AOGA 1BVRA 1SPXA 2VT3A 1E6WA 4ALMA 5LCXA 3ETEA 2PZLA 5TLSA 3C1TA 4DXHA 5IDXA 3UCXA 2D5AA 3VTZA 3GDOA 1M67A 4YAGA 2CZCA 1H0KA 1Y6JA 4W9NA 4J7UA 3NT4A 2F1KA 3D7LA 4I9UA 2H1SA 5L4LA 4FQ8A 1ZSVA 3QLJA 4RVFA 4J16A 4HWKA 3ORFA 4YWJA 3GVIA 2GF2A 3RWBA 3E18A 2AQ8A 1QRRA 3DAPA 3FNEA 3I6IA 2QRLA 1YOVB 3VZRA 1EZ4A 2P9GA 4PG7A 1QLHA 4KOAA 2EWMA 4J7XA 4C7KA 5IJZA 4FR5A 2X8LA 2I66A 1BDBA 4RVUA 1ZMTA 4JQCA 2O7QA 2Z95A 4CUKA 3DBRA 3PDJA 4DMLA 5BNTA 4NR0A 4PVDA 4YT5A 3PHLA 3VPSA 1MC5A 3N58A 4WECA 4J2OA 4R69A 4J1TA 4CM4B 1T26A 3A4VA 4YCAA 2HCTA 2QYSA 3PQEA 3F6YA 2PGJA 4RF3A 1Z6ZA 4RO0A 3JD1A 1ZH8A 5TNXA 4OO3A 1DLIA 1FXSA 2LDXA 4QUKA 5AYVA 4ALJA 1LNQA 2WD7B 1X15A 3PFFA 1DC3A 2GZ1A 4N5LA 5BR7A 4BGUA 1E92A 2Y99A 2BHLA 2B35A 2RIRA 3HFSA 3G0OA 1UZMA 2VZ9A 1NXQA 4K1LA 3BIOA 3ROKA 5KVQA 1AUPA 1V6AA 4G81A 1I3KA 3UFXA 3EUWA 3PWKA 5L40A 2O4UX 2BELA 2EW8A 2VHXA 4XZ3A 1OZAA 1J0XO 4MINA 3FHLA 5CDUA 4RV9A 3AUTA 5B4UA 4KQWA 4TKLA 3ZV3A 2DTDA 1JQBA 4P8RA 3OIFA 1U4OA 4YXFA 4DYVA 1FDWA 1M66A 1MFPA 4JBHA 1YGYA 4XJSA 1QYVA 2B83A 3VPHA 3ANLA 1I5RA 2VTDA 2Y1EA 1JKFA 2JAPA 3OJLA 3QIVA 1R4NA 4R41A 5JFOA 4B8ZA 4OSOA 4D7AA 4IQ0A 4RPHA 4EITA 3FPLA 5B4TA 1M6HA 1UAGA 3KXDA 5TS3A 3JQAA 2J3JA 4PG6A 1NP3A 2HJRA 3ROMA 5HTOA 1Y7TA 1V8BA 4DPMA 1EVIA 1LQUA 2YFQA 1WMBA 4YJGA 2W2LA 1WP4A 3ASUA 4PLCA 3SLGA 4NIMA 4GMFA 1FDSA 1ZKMA 5CDTA 1OBFO 4FGSA 3IJPA 3O26A 4BNUA 3SEFA 3CUKA 3JQ7A 4GWGA 1R4MA 3WWZA 1EBFA 5IXYA 4NJMA 4XGKA 4BQRA 1E3SA 4A03A 1BDMA 3I9JA 2BI8A 3CXRA 3E48A 2NU9A 3OMLA 4JJGA 5JDIC 2AMFA 2C20A 4CV2A 1HKUA 5BNFA 2C0CA 4I8XA 3L4BA 3DAGA 4PRLA 4D45A 2Y93A 1T25A 1GL3A 1EUCA 1YB5A 3U4IA 3T7EA 1ZW1A 4NK5A 1DC6A 1MB4A 1GYQA 3DEYX 4ZA2A 2DVMA 3WIDA 1NR7A 4ZVVA 1N1EA 4D0SA 3WSWA 2B5VA 2TMDA 2OZPA 1TXGA 4WCDA 3LK7A 4GH5A 1R12A 3ZV5A 4CL8A 2EEZA 1X7HA 3HUDA 4BS9A 3ITKA 1WVGA 2Y1FA 4Q3NA 5AOVA 4AJ1A 3K96A 4TRMA 4W4TA 3CKYA 4QT0A 3HFGA 4Y9DA 3RBZA 3VH3A 1BHSA 1O95A 3RU7A 1FJHA 4BNWA 4BNXA 1KY5A 3IJRA 5JY1A 3GDGA 1GQYA 3LF1A 4NBWA 2GGSA 3TRIA 1JU9A 2AE2A 1ZCJA 1R66A 1WDLA 3TN7A 2GNAA 3V5NA 5B37A 3PJGA 4JNKA 4A0SA 1Y9AA 4RF5A 1ZBQA 4HFJA 4CMAA 4R9SA 4B8WA 2X0IA 2DKNA 2XPCA 3PFWO 4MIYA 2BD0A 2J6IA 2WJPA 3BTSA 1YBVA 1NQOA 3JYQA 4IY1A 3RC9A 2P68A 1HEUA 4X54A 1C1DA 2FRDA 1Y8QA 4BO7A 1DHRA 4FFOA 3ZGYA 2PFGA 5THQA 3E6AA 3ZV4A 3U4DA 3B1KA 1XEAA 1NFFA 1J6UA 3RKUA 2X9VA 5CEFA 1HDYA 4BNHA 1TB4A 5ITVA 4MVJM 2Y0CA 4O1MA 5KJ6A 4KUHA 4JK3A 4GSKA 4PLYA 1N7HA 1YO6A 4FIZA 1BSVA 1PQPA 4Y6RA 4A26A 2ZCUA 1DIAA 1KEUA 3JQ8B 4TRNA 1G1AA 3NDJA 1V0JA 3ENKA 4HUJA 1OFGA 2V7PA 2RH8A 5A02A 3S2EA 4BKPA 3KYCB 4J49A 4INAA 1M2WA 3ZU2A 1DPGA 4IQ8A 4FCCA 5EPOA 3RUHA 5L4NA 1U2GA 2EP7A 1D1TA 4ZQBA 4CMGA 2VYND 4JROA 2IZ1A 1HT0A 3Q9UA 5EESA 4XJTA 1CERA 2DLDA 2C29D 3M2PA 1ISHA 5A4DA 2VTEA 4NMHA 3HN2A 1SZJG 3ABIA 1TT5B 3KHUA 3CTMA 2DM6A 5GZ1A 4E4YA 3BMOA 2Y67A 3VOSA 3VKVA 3FN4A 5JDIA 3GNTA 4XCVA 2UUOA 3D5TA 1P3DA 1WXDA 4EI2A 1ARZA 2VWPA 4EEZA 3WGTA 4GGOA 2CFCA 1GTMA 2CF6A 3WDSA 2Y1DA 1X0XA 4GX5A 1S7CA 3PLNA 2PV7A 1R15A 4JBGA 4BNJA 1XG5A 1UXHA 1F14A 1ENYA 2GYYA 5KWEA 1PWXA 4PLGA 3VPXA 4Q3BA 2NTJA 3TFQA 4FBGA 4BNFA 1YQXA 2VRBA 1U28A 3WS7A 3H2SA 4ZQFA 1LC0A 1O94A 1NFQA 1DC4A 3TPCA 4CM7A 1WPQA 1YB4A 2AG5A 2NQ8A 1Y5RA 2VYNA 3P19A 3QE3A 3T4XA 3WNQA 3IDSA 4GSLA 1Y9EA 4WCFC 1CWUA 4TSKA 4Y6SA 2JD1A 3UVEA 4CLXA 2ZB4A 1UP7A 5IZ4A 5K0ZA 4I9HA 3MEQA 1Z74A 4WOKA 2HK9A 3ZU3A 1E3IA 2Q2WA 3QWBA 3ZWNA 4ESOA 1U1IA 4CUJA 3H6KA 1VPDA 1C14A 3R6DA 2O3JA 1JWAB 4E31A 4CM9A 5JCXA 1LDEA 1OC2A 1WW8A 2X1HA 1I0ZA 4CM5A 3MJCA 3OF2A 3P2YA 1DHTA 2NVUA 4R16A 4HKTA 4IDEA 1PJBA 5A04A 1M76A 4J4HA 5HM8A 3GPDG 3ADOA 1BWSA 3HN7A 1QYWA 4HNGA 4B4OA 2BFMA 2YV1A 2C82A 2RAFA 3LC1O 4GKVA 1ZZEA 3FBTA 3UXYA 3PEFA 4QECA 5L4SA 2Y1GA 4EJMA 1H9BA 1IPEA 2PKQP 2BGKA 1YBMA 4PG5A 3TZ6A 4B7XA 1FK8A 4GAEA 3C7DB 3Q1LA 1D3AA 2YJZA 2JCXA 2VUUA 5BSHA 1Y8RA 3ZHZA 3AU9A 1V3VA 3DBHB 3R3SA 3RUEA 1B14A 1P1RA 1PZGA 1U8XX 1LJ8A 4Z0TA 4J0FA 4G65A 3UW3A 4UVIA 4BV9A 3S8MA 2PD6A 4CM3A 2UVDA 4DLAA 4BNVA 2VZ0A 1H6CA 2V65A 2VRCD 4AJ4A 1K0UA 1HE4A 5JCJD 4UREA 2PWZA 5AXDA 2VOEA 4JJIA 4XQ9A 2X5OA 2O7SA 4Z9YA 4B4UA 3ZHYA 4EW6A 4AL4A 2AW5A 4CMIB 3GZNA 1JTVA 3OA0A 3GZ4A 2YQ4A 3GHHA 3GUYA 3ZWOA 4EUEA 2DU8A 3BMCA 1C1XB 4R54A 1JVSA 3ZDFA 1YQDA 1XCBA 4DUPA 1MP0A 2GRAA 4NBUA 4Q39A 3TOZA 3E5RA 3NUGA 4B3IA 1N5DA 4B4WA 2NQTA 1IUKA 1N2SA 5L3ZA 2FPIA 2HQ1A 4MVJA 3I83A 1ONOA 1CYDA 2CD9A 3HDQA 1HYGA 1ISGA 1T1SA 4XR9A 2ZTLA 4IIUA 1YH3A 3UICA 1UXGA 1MUUA 2C2XA 1SC6A 1DO8A 3L4BC 3KM0A 2E37A 3PGXA 1HRDA 4IDAA 2ZYGA 2VCYA 1E7WA 1NHGA 1KC3A 4DA9A 5BSGA 3OJFA 1HSOA 2E49A 2A92A 2B0JA 4M86A 4L76A 4TZTA 4XRGA 3UOGA 4DLLA 5HS6A 3JQ6A 9LDBA 2EV9A 3IKTA 1NR1A 2B4QA 2I99A 5IZCC 4U8GA 4P38A 2CUKA 3FR7A 2AXQA 2GN9A 5JY6A 2NADA 3E9QA 4P4GA 4GWKA 1AHIA 1R0LA 3GN2A 4YJHA 1ISMA 1Q0LA 4NZ9A 4M54A 1OAAA 3ZHBA 1Z45A 3C1AA 3M6IA 3TZCA 3MCVA 4A27A 1QG6A 3O8QB 3NEPX 4OSPA 1Y5MA 2HMSA 1H94A 1P1JA 3V1UA 5G0TA 4PGFA 1KVTA 4PZDA 2ZQYA 2X86A 1ADBA 1CF2O 1GUYA 3QV1A 4TZKA 4E5PA 2X4GA 3AM5A 3VPGA 1ADFA 1KY4A 4QSMA 1KVQA 1GV1A 1JKIA 4E33A 3VH4A 1E3EA 3D64A 4L9RA 5COQA 3I9NA 4LCEA 3PYLA 3WBFA 3WYEA 3DZGA 2Q99A 5L7WA 1X1EA 5F3RA 1Q7BA 2JFFA 2HK8A 2VNAA 3DONA 3PWSA 5KVCA 3CE6A 4Z0HO 2JHFA 3TSCA 4N5NA 1H6AA 3GVCA 4J0EA 3HNPA 3QVWA 3ZWWA 3GVXA 5I7SA 3MJTA 4D3SA 1SAYA 3RKRA 2G5CA 5G0SA 2IZZA 4MKZA 1ONPA 2Q2VA 3M1LA 3GOHA 3GQVA 2YHIA 3ZWAA 1MXFA 1K6JA 2IE0A 2VZ8A 4MVJI 2HU2A 3VAZA 3OEYA 3AWDA 1ZSNA 1QKIA 1J49A 3K9QO 3L77A 3GGOA 4ZQGA 1KOLA 1H2BA 1T2EA 1YJQA 1YBAA 2RHCA 4YBZA 2DC1A 5AXBA 1U7TA 1SEPA 1WLYA 5CDSA 3Q2KA 5I7EA 2YY7A 4HFRA 1TT7A 4DREA 2AEJA 4KP7A 2H6EA 1PS0A 1U5CA 3F5QA 2AQIA 1ZFNA 1SOWA 3BMQB 2VHZA 3K2EA 2W4QA 3MWEB 3AUUA 4UVHA 4BNYA 4PZEA 5T8KC 3TZKA 4LMPA 4IS2A 2HK7A 1UH5A 4GX2A 3GRKA 3DFZA 2DBRA 1PGOA 4ZN6A 3W1VA 3HJAA 1ZK2A 1QORA 4GL4A 4UEKA 4WEQA 3V1YA 3ROPA 5ES3A 2X22A 5EERA 1ML3A 3ZNNA 3EGOA 1LLCA 3OIGA 1T1RA 4OXYA 1X0VA 1GEGA 3U4HA 1NWHA 4W6ZA 1EE9A 5F5NA 5G2OA 4TRRA 1E7YA 2J5QA 1U2DA 2CY0A 1EEHA 2OBYA 1IULA 3PIIA 3ICCA 3CSDA 1QXSA 4NJMB 4GGPA 3F1KA 3FTPA 4FFPA 2YHUA 3IAHA 4ZRMA 4F6LA 3TQHA 4XYEA 1E3WA 3PP8A 2NTNA 3DXFA 3E82A 1HSZA 3OECA 3MTJA 3TL3A 3BHMA 1XGKA 3JQFC 2EKLA 3NTRA 2IXAA 4R1UA 3QP9A 2X7HA 4BMVA 3I9LA 3F3SA 3ZW9A 3JSAA 4IMPA 3AOEA 2NLOA 2PLAA 1IZ0A 1LUAA 2O3QA 2YDYA 4OHUA 4NDNE 1HZZA 4KTVE 1OOEA 4ND1A 3WLEA 8LDHA 3GEGA 4MIEA 3KSUA 1NQAO 3H2ZA 2EJWA 3BYZA 3W8DA 1NFRA 1RYDA 1ZK1A 4XGNA 3UUWA 5CEJA 1DOHA 2GUGA 4DIBA 2FPPA 4WLOA 5JMPA 2LDBA 2ZJ1A 5G0VA 2Q50A 3U0BA 1SEVA 2BMAA 4LVUA 3WNVA 2WM3A 5L45A 3OM9A 1YONA 4BNKA 2Q1TA 4OJNA 1KVUA 3I5MA 3QVSA 1YL7A 1E7RA 2VOJA 4A10A 4QO8A 4OM8A 3PHHA 3S1LA 2XOXA 2FR0A 4PLVA 1DIGA 1QSGA 4NBRA 1DAPA 3EAGA 1UXJA 3GAZA 4H15A 5JC1A 4BB5A 4LN1A 2NU6A 1Z82A 4IJUA 2ZTVA 4BNZA 3K30A 1ZK3A 2EGHA 1IOLA 3GA0A 3DDNA 1V3UA 1AE1A 4GI2A 2GPTA 5EQDA 4BGIA 2JJYA 2NM0A 5AXCA 4UVDA 2CVZA 2QG4A 5K6AC 1HF3A 4FFRA 2HMUA 4J1SA 4L4SA 3OA2A 3RU9A 1LRKA 1ZO8A 2YDXA 3ZU4A 5A3JA 5A1TA 5TGDA 4XWYA 4B4VA 2J3HA 1DFIA 3LQFA 2Y1CA 3WQRA 3OHSX 2CF5A 2PY6A 3TOXA 5KTKA 3DBVO 1U7HA 2XF8A 3ZU5A 2G17A 3WICA 1ISJA 3OP4A 3PK0A 4BKQA 1HE3A 2H9IA 3CH6A 3GFGA 5BT9A 2ZB7A 3JQGA 3ZWMA 4AJ2A 3AI1A 4PLFA 4MO2A 2WEKA 2O3RA 1IYZA 3VDRA 1GZ4A 3GEMA 4YB8A 2O3TA 4IPTA 4IDFA 3IP3A 4HY3A 1JLLA 3K5PA 4BB6A 4RZIA 4QQRA 4YJDA 1X1TA 4E30A 1B7GO 3ZZNA 5A9RA 1YL6A 4KWIA 2NVBA 5G0UA 3FNGA 4J90A 4JXKA 2O23A 2D59A 4L73A 3TJRA 4RVDA 2YV3A 1N7GA 2IYPA 3HB5X 2HJSA 4JGBA 5IXSA 1VKNA 5IFLA 3KOUA 3PWZA 4I5FA 5CDYA 4TWRA 1PJ4A 4BMNA 1CIVA 3GG9A 2FHSA 4UUOA 3QWFA 1GPDG 5DNAA 1EE2A 1P45A 2AEMA 5BNIA 3N7UA 4BL5A 1CETA 5JBIA 3JD4A 1HDXA 3LDHA 1KIFA 2BFAA 2RCYA 4I5DA 1KC1A 1PJQA 3L6EA 3PXXA 2HAEA 4M87A 4CR8A 4PN3A 1WNTA 2RHRA 1A7AA 4XD2A 5EL0A 3JQAB 2X0RA 1I32A 3KSDO 4CR7A 2AEFA 1LC3A 3HQ4O 4PLTA 2C7GA 1ISFA 2DAPA 3HB4X 3DBLA 4ZICA 4WLFA 3OQ6A 2JKVA 4OXNA 4LK3A 4ITUA 5JYDA 1H2HA 5JMWA 3C3XA 4I5EA 3MOIA 4Q9NA 2PKRA 2NSDA 1UUFA 3AW9A 3LT0A 1ORRA 1MG0A 1E1NA 4NHEA 4AFNA 1LSSA 4YT8A 1I2CA 4L75A 3ZCXA 2GDZA 4BO9A 4YR9A 4CQLB 4MDHA 3JD3A 5KKAA 1GR0A 2FMUA 4QXMA 3DZKA 4MOWA 1BRMA 3K73O 5U4QA 3O4RA 4K28A 1NTOA 4E2XA 3OIDA 2DFDA 1I2BA 1PR3A 5ICMA 2QYTA 1DJNA 2VT2A 4JLWA 5DCUA 3C85A 4ZQEA 2IRWA 3OJOA 1HTBA 4KDEA 5T6BA 4BHTA 1Y1PA 3RI3A 1FDVA 4AICA 1SB8A 2AG8A 4B79A 4J3FA 4EBFA 2ZYDA 1F8GA 1T4DA 4ZGWA 3EY4A 3PIDA 1B2LA 2QRKA 2GZ2A 4OGWA 3MZ0A 4E2ZA 5C5IA 4OXKA 1PL8A 2HMTA 3W6ZA 4YQZA 5COBA 5JLAA 2I9PA 4J1NA 3ETGA 3RSHA 3LZ6A 4IZHA 4ALNA 4FOOA 5DOVA 1HYHA 4EGFA 5IF3A 3AU8A 2E6UX 2Y66A 4DIOA 1BW9A 1NWCA 1UP4A 2WTBA 3LT4A 2UAGA 4EDFA 2D8AA 4YAJA 1Y8QB 4K26A 3IUSA 4PG8A 3EW7A 1PS9A 4R5MA 3PJEA 3P5SA 1UXKA 3M2TA 1B8PA 1UDAA 3GGGA 1GQQA 6ADHA 3KETA 1U9JA 1ZVMA 4ZRNA 3OQ1A 2B36A 2I3GA 3H7AA 4H7PA 4DPKA 2VWQA 1QV6A 4XYGA 3S2FA 4R5HA 3WBBA 3V2UA 2DFVA 1LLUA 2WD8A 1LSOA 3TFOA 3WGGA 2EF1A 3W8FA 3WTBA 1P1HA 3AUAA 1L7EA 3DHEA 4FN4A 4XQGA 2Q49A 4L0QA 5CPBA 3TWOA 2EKQA 2Q46A 3H65A 3KEQA 3ZWPA 2UYYA 1PR9A 4BNLA 2QX7A 2SCUA 3EZYA 4JP3A 4F46A 3BHIA 2BFOA 2OMEA 3CINA 4IJKA 4LMRA 3E9NA 4FC7A 4HADA 1DEHA 3HZZA 1ENPA 3H9JA 1DRUA 1Y81A 4D41A 3MJ4A 4TROA 3IQDB 1RJWA 1ISIA 4UUPA 1MLDA 1HETA 2CNBA 4XYBA 1PEDA 3DMTC 5TQVA 5JAMA 1IB6A 1TI7A 5JE8A 2W90A 1T4BA 5T67A 4E2WA 1E7QA 2UUPA 2GO1A 1TLTA 1XA0A 2Q45A 5KNLA 2EGGA 1PX0A 4EUHA 3GPIA 3X2EA 4PG4A 2BGMA 3RC2A 1C0IA 3PZRA 5KJCA 2FP4A 1IHYA 4CL3A 2JCVA 3KYBA 3VH2A 1LSJA 2AQKA 4IZIA 2O48X 4M55A 3A1NA 5FF9A 3NYWA 5JO9A 5TF4A 1B8VA 4Y8VA 1LRJA 1NPDA 4GX1A 4ILKA 2EW2A 2IZ0A 4J43A 4YEDA 1KBZA 2OUIA 1U5AA 3RAJA 4AJLA 4R1NA 4OL9A 3FR8A 1YXMA 3E5MA 2GN6A 2R00C 2I76A 4B7CA 1LRLA 2G1UA 2X5KO 1ZK0A 3TDKA 3LVFO 3RUFA 4B7UA 4G5HA 4YAEA 5KVSA 1E5LA 4RL6A 1XQ1A 2GN8A 4KUEA 1NVGA 2P5YA 4U0JA 4UEOA 4MP3A 3D3WA 5CDGA 3JYPA 2PK3A 1YRLA 2O3SA 3CZMA 4ND4A 3H3JA 4E6PA 4E5KA 1I30A 2Q1WA 4C4OA 1VKOA 3DTTA 3EYWA 1GZ3A 1E7MA 4BVAA 2NV6A 2ET6A 3VH1A 4PZCA 4MIOA 3ST7A 1I3LA 3H9GA 4TVOA 3WGIA 4L74A 2CVOA 4DGSA 4ALIA 3GLQA 3L0DA 3OETA 4R1SA 1A9ZA 4NNJA 3LU1A 5FYDA 4F45A 2BLLA 2I3AA 1A4IA 3UCEA 1MXHA 3WYCA 3BMQA 1LQTA 4RF2A 4FGWA 5ENDA 3A9WA 3Q6IA 1GYPA 3G1UA 5IN4A 1YQGA 4CJXA 3PZBA 4C7JA 2FY8A 4MJLA 1E3LA 1XHLA 4NFHA 3D5QA 3KO8A 3FRJA 4S1VA 4XIJA 3WMXA 1ZJZA 4IDCA 3CIFA 3C8MA 1BXGB 2OORA 5T57A 3RFVA 5A06A 4RVSA 1F17A 1Z75A 4YJFA 5KIAA 2PH3A 4W82A 4PFJA 1LDNA 4LSMA 5KJ1A 5ITWA 1VLLA 4KZPA 1UZNA 4Y67A 2OHXA 2WWRA 4KQXA 3F46A 1A9YA 1WZIA 3SVTA 3F4LA 2XXJA 1ID1A 3IIEA 3MWDB 5A05A 1PWZA 2AQHA 3MJVA 4E12A 4RORA 4CLRA 5MDHA 1VI2A 4DQXA 3X2FA 3VC7A 2WYVA 3RUDA 3VTFA 4CMIA 2EKPA 1R6DA 3C1OA 3C7CB 1YDWA 5DCYA 5CEEA 1MGOA 4XEHA 4H3VA 1PQWA 3NJ8A 1GFSA 4CR6A 3ZNPA 1H6BA 1P1IA 4JN6B 5EN4A 1XSEA 4PLPA 3DB2A 3P7MA 3DQPA 1YL5A 1ZEMA 4LISA 1MC4A 3GUCA 4M1QA 3LLVA 3IP1A 3RCBA 2JCYA 2NACA 3PTZA 5KCZA 4NFYA 3N74A 3SXPA 4OKNA 1EQUA 1GU7A 4OYRA 2D2IA 4UVGA 1MFZA 4W9NC 1K6XA 2ZCVA 3G49A 3WR5A 5JNLA 3CMCO 3Q9NA 4IJVA 4YDRA 3AJRA 3D4NA 1O5IA 3B1JA 4U6SA 2Y1OA 1AN9A 2EG9A 3ZWCA 2OBNA 5DP2A 1L1FA 4R9RA 3GNSA 4CLHA 3WYBA 4OMUA 3NT2A 3BAZA 5AQ1A 3WQQA 3K31A 4WEOA 4AJKA 1JA9A 4CMCA 4YAIA 5C7OO 1EUZA 2EHDA 1BTOA 1LDYA 3EK2A 3JTMA 4Q3EA 1CEQA 3WFJA 2Q2QA 4RQTA 3TZHA 3OH8A 4IUYA 3KYDA 3JQBC 3O38A 5HS4A 1Q0QA 1EBUA 3I9OA 1DRWA 2G82A 5JXWA 4NQZA 3ZWVA 4BNTA 3T4EA 1U4SA 3DOJA 3NTQA 2DUUA 1PGPA 1GZ6A 4MVJH 3Q2IA 3VDQA 3WG9A 1YWGO 2NVWA 4AJJA 1IHXA 4NK4A 5JAIA 2HRZA 1I36A 2JD0A 5CAEA 2QZZA 4HP8A 2BH9A 1H5QA 1DIHA 3IC5A 3ZNOA 1N92A 2HMWA 2AE1A 1NYTA 1U3VA 1EDOA 5IN5A 4O0LA 1QYXA 1VSUA 4L4RA 1R4NB 1NNUA 3WXBA 4R3NA 3VVBA 1DLJA 4AJNA 4J91A 2JFGA 2VQ3A 5F21A 4ND2A 4ZU3A 1B0AA 2Y0EA 3WQSB 5C3MA 1EFLA 3KRTA 4DLBA 1AXGA 3QY9A 3JQEA 3R3JA 3DTYA 4OAQA 4IM7A 4DMMA 4UUMA 4O6VA 2NU7A 3H9EO 5CG2A 2DQ4A 5ENVA 2IEBA 4E5NA 4FB5A 2YHIB 4UEJA 3EMKA 5LDGA 3DZBA 5IG2A 1SO8A 3JQ7B 2PTGA 4RPLA 4IIVA 3OICA 4R3WA 1PGJA 2VRCA 5JCJA 3PLRA 5KJFA 2CMDA 2YZ7A 4MPDA 3O9ZA 3KBOA 3JD0A 1RM0A 3NT5A 4UULA 2B5WA 3KLMX 5FFFA 4GLLA 1KVRA 2ZTUA 2NVUB 4BO0A 1T2FA 3V8BA 1GV0A 3GY0A 4AVYA 2GN4A 3V2GA 2BRUA 3MTGA 5DP1A 1PTJA 2HDHA 3RUAA 4I08A 3ENNA 4BO3A 4ND5A 2JD2A 4Y6PA 1E1KA 4LSWA 3SLKA 1XKQA 1KVSA 4CQMB 1HLPA 3PJFA 3RJ9A 5U9CA 4CMKA 3UAGA 4ALKA 4Q3AA 5TT0A 1O0SA 1I2ZA 4A7PA 3QWIA 3I23A 3HDHA 4EZBA 3ICPA 3GK3A 4RVGA 2DTEA 2Z5LA 1UP6A 3SC4A 1I10A 2WYWA 1CRWG 4DL9A 3NDRA 1F0YA 5GZ3A 4N54A 1LXCA 1ADCA 1EFKA 4CM8A 3DBLB 2DUWA 3LT1A 1P74A 5B12A 4KMSA 4DC1A 3UHAA 1A71A 1ZUD1 1JDJA 3ONDA 4NFSA 3NGLA 5J23A 1PL6A 2QZ9A 3FD8A 5KOIA 1S6YA 5JYEA 4D44A 1P0FA 5DBGA 3S55A 3F4BA 3ONEA 1KYQA 4YA6A 3FCOA 4EJ6A 3L9WA 1EDZA 3KV3O 3GZNB 3GH3A 1C1DB 3K2BA 4YRDA 4O63O 4K9DA 1LLDA 2R2GA 3KZVA 5F5LA 3NX4A 4MVJG 3A06A 3RFTA 4CV0A 3LC2O 3CEAA 3INTA 1HZJA 5TC4A 5I8WA 2J5RA 2EXXA 1C0PA 8ADHA 3LYLA 4TRJA 2JHGA 2C07A 2ZIZA 3BMNB 5C7IO 3H4VA 1IY8A 3QQPA 4EYEA 2Z1MA 4IJWA 4FDAA 3GG2A 1PZEA 3O03A 5I7VA 2JAHA 4Z9XA 3VZSA 1ENZA 3ROQA 3ZWYA 2PZJA 4IDBA 2QRJA 2QHXA 4IXWA 3G3EA 2ILTA 2P9EA 1JW9B 3LC7O 4FW8A 1NQ5A 3VVCA 3UF0A 1K3TA 3DZJA 3QVOA 4OH1A 1HE2A 1YDEA 4QX6A 5A5EA 3DBRB 1QMGA 4LRSB 1AXEA 2QQ5A 3GAFA 4QFCA 3U49A 5A9SB 3KYCA 5FWNA 1VJ0A 5DCWA 3GMSA 5DULA 4TVBA 4XA8A 4CM4A 4ZHSA 1W6UA 3STHA 2HLPA 4FC6A 1UDBA 1WWKA 3WGQA 1R0KA 2C7VA 1A5ZA 1X13A 4RDIA 1HDZA 3ULKA 2FN7A 5DF1A 4BKUA 1N9GA 1PJ3A 4II3A 4QTZA 4WPGA 5F1PA 4W7IA 1HWYA 2W2KB 1SCUA 2A9FA 5L51A 5TJHA 3CMMA 4NBVA 3KVOA 3BMOB 1U3TA 4TMFA 1HDOA 1C0LA 1E7SA 1GDHA 4WNIA 4NBTA 3WIEA 5CG1A 4S3MA 1T2DA 2YQ5A 2JL1A 5T8KA 1Q7GA 1RM4A 4WE3A 2X0NA 2ZATA 3JQDA 4I5GA 3WGHA 3B20A 5TX7A 1DAOA 4Z3DA 4RPKA 1W4ZA 3B70A 2O2SA 3WGZA 3OSUA 1P1KA 3WJ7A 4XDZA 3SBOA 1NAIA 4WOJA 3VPFA 5C37A 4R01A 2TMGA 2D1YA 3JQGB 3ASVA 2PR2A 3EHEA 3RUIA 3RQSA 1GY8A 1OC4A 2PZKA 1VL0A 2CSUA 5HWSA 1EVYA 2DBQA 3DHYA 4OKIA 4BUCA 3IKVA 4E5MA 1J4AA 3PHGA 4BO8A 4IBOA 4QEDA 5T5QA 5A3VA 4D0RA 4E2YA 3AY6A 1XQ6A 1OI7A 5ER9A 5L95A 3JQ9A 4Y98A 4BV8A 2E82A 3SJ7A 3QVXA 4HBGA 4HFNA 3DZIA 1GUFA 3FTNA 4N5MA 4BQPA 2ZYAA 1FDUA 4J9UE 1VL6A 2GLXA 3GVHA 3WGOA 5G0WA 4K6FA 5TT1A 1T2CA 2G0TA 1ZNQO 3B1FA 3NGXA 4NG5A 4WLEA 4BOYA 1PGQA 4WCFA 4OOEA 3GHYA 1E6EA 1XDWA 3VZPA 7MDHA 2DBVO 1LDGA 3TL2A 2C5EA 1UAYA 1V35A 1B26A 1P31A 1DJQA 3GEDA 1D8AA 5FI5A 1GADO 1ULUA 1UXIA 1YE3A 2GASA 3L4SO 4GVXA 3ZWXA 3GF4A 2PGDA 2H5LA 1X7GA 1ULSA 3EC7A 2WYUA 4LCJA 1DC5A 1K2WA 3F5SA 1N1GA 1PZFA 3COSA 4NPCA 1BGVA 5IDQA 1K6IA 2NU8A 4DYDA 1NASA 4A5OA 5G4KB 1RWBA 4DIFA 2BI7A 3I4FA 3D3WB 3U9LA 5IAAA 4CQMD 2PH5A 4FFMA 2B37A 3G79A 1VC2A 3JYNA 3FNFA 4JIGA 3D4OA 2PD4A 4P4NA 3DBHA 4XR4A 3QHAA 2DPHA 2R00A 3I52A 4XIYA 1DSSG 2FR1A 1U3WA 4FD3A 1BMDA 2WSBA 3QJ5A 1A7KA 3C24A 1KS9A 2OP0A 5COAA 4YTEA 3JQBA 3RASA 4A2CA 4EUFA 1PL7A 3BMCB 2ZB3A 1VJTA 4RLHA 3FBGA 4FFNA 3GT0A 4WASA 4XRRA 4HX5A 1X7DA 3JYOA 4XYMA 4M89A 4FFLA 1DFHA 1ZJYA 5F1KA 3GVPA 3OFSA 3L07A 1E1LA 3KLPX 1C1XA 1GQ2A 4XDYA 1Q7CA 2EERA 2ZK7A 1EK5A 3SX2A 4OQZA 5L53A 5DT9A 3TF5A 5H81A 3UN1A 4WKGA 2X58A 5KVVA 5GZ6A 2PZMA 3V1TC 4BNNA 4YJFB 4J4BA 4NU5A 1PJ2A 1JAYA 4TKMA 3JQCA 4IDDA 4DPLA 4GBJA 4U0KA 3Q3CA 1O9BA 4YAKA 1EUDA 4B3HA 1O6ZA 4AJHA 3HHPA 3K6JA 4WJZA 4CMHA 5MGBA 1LEHA 1DB3A 3ADPA 4L8VA 3RVDA 3DC2A 4CLRB 1RM5A 2D4AA 1ADGA 1NVMB 1P77A 5GY7A 4URFA 3ZWBA 2A35A 1LA2A 4BO2A 4MVJF 1W73A 2ZQZA 2WD7A 5KJEA 4I9NA 3BTOA 1CQIA 4JX8A 3CPSA 3GN1A 4O5OA 4YT4A 3T7CA 4ALLA 1ZSYA 5EMHA 4U5QA 3ZH2A 5JAZA 3DL2A 1HLDA 2PA3A 2VHWA 4YPOA 5FEUA 2FPGA 3EDMA 2D3TA 4U7WA 5THKA 4YRBA 2AHRA 1IE3A 4F3YA 4YQYA 1E6UA 1NHWA 3GMDA 2EIHA 1G6KA 1IPFA 3PYXA 4XX0A 4DC0A 3FF4A 5CFZA 2A4KA 4P22A 2UDPA 4DTIA 3S2GA 1AGNA 2J3KA 2PNFA 4Z9FA 2ZB8A 3H3FA 2FZEA 1HYEA 4BGVA 1W8DA 1WDMA 1YKFA 2DT5A 2GD1O 3BA1A 3W6UA 3ZV6A 5TIIA 1E0DA 4GLOA 4M8SA 1ZIDA 3WLFA 5DDIP 5EQFA 1KEWA 5DBFA 3PGJA 3NDIA 4YACA 2IEDA 2X0JA 4LGVA 4CV1A 4R68A 3I4CA 1M6WA 4RLSA 3E9MA 2G76A 4JBIA 3UGKA 2EJVA 2VHVA 5TRTA 2W98A 4CV3A 1A27A 2YW9A 3AI2A 2DPGA 3DR3A 1C0KA 4GMGA 1B3RA 1Q1NA 4RPJA 4WLUA 3NV9A 4E0BA 3PPIA 1R4MB 1SMKA 2OOSA 3BTVA 3G1TA 1KEVA 4ID9A 2I67A 2W2LD 4FOSA 1I01A 1PIWA 3L9XA 4BO5A 4CLOB 1SB9A 2GZ3A 4W99A 3DMTA 3DZHA 4YVFA 5ILGA 4CUZA 1F12A 4MP6A 5A9TA 4NU6A 3R1IA 2DTXA 1EVJA 3NKLA 4ONEA 2ZKLA 5L9AA 3D4PA 4KWHA 3RUCA 2YV2A 4FJ2A 3UKOA 2P5UA 3WX0A 3ZHXA 3DOOA 1Z7BA 1R37A 2FSVA 4J9VA 4Z3KA 4CODB 2C2YA 1HL3A 4R51A 1BG6A 3W4KA 2WMDA 1R16A 4BO4A 2NTVA 2VHYA 3H5RA 1KETA 2D5CA 2Q4BA 3KSZO 5IDWA 4IINA 4CM6A 1QR6A 2GR9A 2P91A 4CMJA 3KB6A 3MJEA 5CHEA 1F8FA 1E1MA 4RGBA 4UUNA 2V6MA 3LT2A 2E4AA 3INGA 5JW6A 1FF9A 2C54A 4GVLA 3ON5A 3AOEC 3WSVA 1D1SA 1IL0A 1MX3A 4JP2A 3QSGA 4N18A 4BKRA 2Y05A 5A03A 5IZCA 2IODA 3EZLA 5C7LO 4CM9D 4XQEA 4CQLA 2QIOA 1GEEA 4E13A 3SC6A 1I33A 2PKQO 3GDFA 1P44A 4LVCA 1I8TA 3MJSA 2I6TA 2P4QA 1NX6A 4JJFA 1PJCA 3E8XA 6LDHA 1WDKA 5KKCA 4Q3DA 1MG5A 3UH1A 3KTDA 7ADHA 4PCVA 2OP1A 5IDYA 1T24A 1O8CA 1UZLA 2F00A 1BXGA 1YOVA 2CDCA 1DRVA 1A72A 2E48A 1PJLA 4RF4A 2I65A 3DFUA 4CM8B 4DQVA 9LDTA 1XU9A 4D3DA 3JQ8A 3PQFA 3OQBA 4J6FA 4ZQHA 5JPIA 4II2A 2BF7A 2P9CA 3ZI0A 4TQGA 3EVTA 3IL2A 1LTHR 5B1YA 4D43A 1EMDA 1HE5A 1H6DA 1JVBA 1DFGA 1VJ1A 2Q1UA 4D46A 1P1FA 3U5TA 1BW9B 1CQJA 1KEPA 1ZK4A 5JC8A 5U1PA 3AY3A 2X9NA 4D3FA 3OBBA 5EIOA 3KEOA 3JQAD 1E77A 4GQAA 1F06A 1LDMA 2VUTA 2JFHA 4AG3A 2VYVD 4HNHA 5EINA 2WDZA 1ENOA 3AM3A 3ETDA 1DIBA 4AJIA 5HRUA 2DBZA 5L7TA 4QO7A 1EQ2A 2FWMX 1LSUA 1GD1O 4WUVA 3RBXA 3BXXA 2RH4A 3JD2A 1PGNA 3RIHA 4PIVA 5JSFA 4ND3A 3LLSA 1OMOA 1Q2XA 2I5PO 3NJ4A 3OJ0A 5I7FA 4MKRA 1P0CA 5LC1A 4J4TA 4MKXA 1BVUA 1GYRA 4HXYA 3GR6A 2W8ZA 2HRBA 1D7OA 1NVTA 2XAAA 3D1LA 4A73A 4IDGA 4XGIA 5G4LA 3GFBA 3ZNQA 4MVJD 4DBVO 3INRA 3WTCA 4D42A 1YVEI 4FSHA 1VE9A 1TVEA 3VZQA 1WZEA 3JCZA 4YYZA 1K5HA 1UDCA 2PD3A 4PVCA 4NH4A 5A9SA 4CMEC 2BGLA 1Q0HA 3L6DA 3OJEA 1EK6A 5K9ZA 4IMRA 1PJTA 4RVHA 4XB1A 1RYEA 4ZD6A 3WFIA 1LI4A 4WLNA 4IGFA 1YJ8A 4IS3A 2FOIA 5B4VA 3VHRA 4GKBA 1MA0A 5DN9A 3BZUA 4LRTB 3MOGA 1BXKA 4Z0PA 1GCOA 4YJGB 3TZQA 1JN0A 3WOHA 1WAMA 3FWNA 5CP8A 1H9AA 3HDYA 4MVJP 1HDCA 3JQFA 4GPD1 2OXIA 1HDRA 1QP8A 1PSDA 3OEWA 1RKXA 4BNIA 1DDOA 4XQCA 4YT2A 3R0IA 2R6JA 1PQUA 3I6QA 1FDTA 2OO5A 3A28A 1JAXA 3SJUA 1XWFA 4RJTA 1TEHA 4FJ0A 4UVEA 3S2IA 3IS3A 1GPJA 1C3VA 1DIRA 1X14A 3GRPA 1BXZA 1P9LA 2OGUA 3HWRA 3BTUA 2OFPA 2VUSA 2V6FA 3QA9A 4R4JA 1DBVO 1ZMOA 4Q3CA 4M49A 2A94A 2VYVA 4FS3A 2Z1NA 4OIMA 4P4LA 1U8FO 4WK6A 2C59A 3NRCA 2BFPA 1GUZA 5BSFA 5HBRA 5LDHA 4N7RA 5DOZA 1A4UA 1ZEJA 4FPXA 3F47A 3K92A 1VL8A 3IOYA 1I24A 1TA4A 4UAGA 5F1OA 1B3BA 3RBVA 3G17A 4BMSA 1HDGO 1NAHA 4BO1A 1DXYA 2CVQA 1LU9A 2O2YA 5BSEA 1IZ9A 3JQ9C 4E5YA 4WCFB 5GMOA 3PHJA 3QWHA 3PVZA 4BGEA 3PDUA 3H5NA 3HADA 1LBEA 1WMAA 1D4FA 1E3WB 3M1AA 4BNMA 4DRYA 5ADHA 4CQMA 1R0SA 2Y0DA 1N8KA 3HSKA 3W4JA 1FMCA 3UCFA 4CLDA 1ONNA 4AJOA 4YRAA 5K6AA 2UV8A 2O4CA 3NAQA 4BIIA 4DVJA 1ZXLA 2IXBA 3WJAA 2YYYA 3D3EA 5AXAA 3ANNA 5G4KA 3PRJA 4WLVA 2AA3A 4U6QA 4XYLA 1AHHA 4AJPA 5HA5A 3IUPA 3QVTA 1XU7A 5I9MA 1LDBA 3B6ZA 1V9LA 1J5PA 3F9IA 3HE3A 5H82A 2YUTA 2VWHA 4IQGA 3QRWA 5H83A 4E21A 2J3IA 1XIVA 3AFNA 2GSDA 4B3JA 3ZW8A 5I9LA 2VNSA 3I9MA 5I8ZA 5ICSA 1LX6A 2J8ZA 3QW2A 1E3JA 4XB2A 3RFXA 5JO0A 3RD5A 4CMBA 3LF2A 3W4IA 2Y68A 4Z6KA 3AM4A 3WMWA 1PJSA 5JDCC 3FWZA 2ZJ0A 5CPFA 2HO5A 2J5KA 2O3UA 4IXTA 4DWVA 4ROSA 3HG7A 3LSYA 1GAEO 4PRKA 1SNYA 3NTOA 2NUAA 3AFMA 2NNLD 2POQX 3GGPA 3WWYA 4ZJUA 4RPGA 5TSDA 4BKOA 2Q3EA 3DO5A 1XLTA 4CPDA 2HKIA 1TT5A 4NJOA 4YJHB 1Z73A 4GX0A 2PGLA 1XELA 3BMNA 1U3UA 1MV8A 4HFMA 3ANMA 3A14A 2CDAA 2X5JO 2IYOA 3E03A 1EVZA 3O8QA 1B8UA 4QFDA 4G2NA 3C7AA 5FI3A 3V2HA 4OQYA 1L7DA 3FI9A 1V3TA 1M75A 3RC7A 2CDBA 3IMFA 3PJDA 1NPYA 5ER6A 1VRWA 1JWBB 3WB9A 2FSSA 4BNGA 4O59O
chains in the Genus database with same CATH superfamily
4CTMA 4PLZA 1E1CA 3BBLA 1BE1A 4JVOA 5HCIA 3DV2A 3L7JA 1P5RA 2FYTA 3B9PA 1CJCA 4RV5A 1P80A 4N12A 3UG6A 1VSVA 2UZ1A 3PQDA 3ITDA 3P2OA 4JCOA 1P3Y1 4JD5A 4K3VA 3PI7A 4ENRA 1DV1A 1V1RB 4AYXA 1K7FB 3MGBA 3VKUA 4D9EA 4EAAA 3FLBA 4DOMA 3F49S 4MR7B 4E46A 1DQPA 1PEKE 2FVXA 1XYGA 3QKUA 3DMNA 4C7VA 1EQAA 1XRMA 1EBBA 1SXJB 3Q11A 4F5ZA 4ENQA 4DSTA 4CM1A 5T4HA 1NQTA 4XD7D 2W2KA 1E5QA 4BVJA 3VPDA 5M34A 5LNK1 4QGAA 5JDCA 3AUFA 3MMSA 2NWQA 1GNVA 5AKHA 5ALYA 5CBPB 4QOIA 1SVIA 5H70A 2L69A 2X9GA 3P2KA 3Q8MA 1LS1A 2WHYA 5AVRA 3RJ5A 3B53X 2B4RO 5C0OE 4KO1S 2VPIA 4RVCA 1KGDA 3WGYA 3DOCA 2H7VA 3FMIA 3X1DA 1WXHA 4EO4A 2REQA 1GPBA 3OZCA 3PGA1 5CGZA 5GM1A 4DSOA 1BS1A 1XDBA 2H63A 4DMKA 2OSBA 1O57A 1AZTA 1PG2A 1QRAA 3AY7A 3L6OO 4RZXA 5DI3B 5ALLA 3W1EA 3W8EA 1ADJA 4BAUA 4E11A 4IIEA 2OC9A 4MCHA 1RI4A 3WHIA 1P5HA 1LCIA 1RADA 1QYDA 1I3NA 1MHPA 2HMYB 4ITRC 4CIWA 3IDZA 1YFLA 1H42A 4PF1A 2W2MA 4KAAA 2QTLA 3ZIDA 4ECEA 5A4MS 3NC0C 5J47A 4E3ZA 3SJBA 4MP8A 5K3FA 3RVBA 3Q9SA 3TQCA 1QR2A 3ZZ0A 2ZULA 4MV8A 5CA1A 3A6HA 3KWJA 1Y4UA 1QB7A 3RE1A 1Q1ZA 4DSUA 3CZRA 1QG2A 5AM5A 3TNYA 1HXHA 1RXUA 2R97A 1CTQA 2HL6A 3IP5A 4BVFA 3MMPA 2ZI7A 4RU1A 1HE8B 1NP6A 1QF7A 4PLWA 4CBVA 5LM3A 3NIGB 5BOSB 1W4BA 3FPKA 5ILOA 1ZISA 1W581 4M1MA 2WUVA 1SOVA 3MJDA 2ODQA 2XVXA 2QUKA 1KDRA 1TA0A 1ZVKA 4E14A 4MJ3A 1RQLA 1GTSA 2X6QA 1RWWA 3O2NA 4LWQA 3SQMA 1JA0A 4BCDA 4EB6A 1JIJA 2VDWB 2ACKA 1AKWA 4QHSA 5AKGA 2PL9A 4MWGA 1XJ0A 2D0IA 3KIPA 3L79A 4I1IA 1O6GA 4JA0A 1USUA 1NTRA 1JEDA 1MORA 2TRSB 3UO8B 4BJ1A 2VP4A 3LTEA 2YL2A 4XXHA 3I2YX 4M46A 4YRJA 3T54A 4HV4A 4G5RA 1DEXA 2PX3A 4CLOA 2GCOB 5JAQA 3RG8A 3H9QA 3TR6A 3VGJA 3FCCA 4PAOA 3EVAA 3RC1A 1U0HC 3HS3A 3HYNA 5TJ9A 4D9JA 1WHSB 1NI4A 4MPPA 4RPCA 2QW0X 3QOFA 4FI3C 3WHLA 4DRZA 4ON9A 5AKZA 3A6DA 5DTEA 2XUJA 3U4CA 4B5LA 1J2TA 4NI5A 1V6CA 3VU9B 4DJDC 4KUGA 3CO0S 3OHMA 1XNQB 2RBEA 2YFHA 2X6TA 3BCUA 3U0VA 3IRUA 4D9IA 2FGKA 4EEXA 4NICA 4BFTA 4CQJA 8ATCA 4UE2A 3ZX5A 3FFAA 3CEMA 2IGTA 3VUEA 2GZRA 5HK9A 4D79A 1W5EA 4R2JA 5A71A 1K97A 2HOQA 3R5FA 4HPWA 1G6Q1 1F0NA 4NWIA 2OUKA 3H9UA 1LPNA 1ULZA 2IKSA 1IWOA 1P9OA 1Q83A 3GC6A 4KDFA 4MW6A 4Q9KA 4B7AA 4B3CA 2HN9A 1UR5A 3CFYA 3F7MA 2QA5A 5CH5A 2KQUA 3UB3A 4CNBA 1B15A 4MKGA 4ZI7A 2DR2A 3NJRA 4YPFA 2FZWA 5JEEA 2CVPA 3T5GA 4J2HA 3UK0A 4L6CA 4BO6A 3WWPA 4DARA 2HBZA 5C32A 2ZPUA 3CCCA 3ZN2A 2VN8A 2P2SA 4OQPA 3BWCA 1BVRA 1UC8A 5EUBA 3PE4A 2JH8A 1YZTA 5HIAA 2V7QA 4C2BA 1V16B 3FSGD 5LCXA 4JHLA 4E1BA 2F3TA 3C1TA 4GP6A 5BN5B 3EPJA 2JAUA 1VPLA 3BCRA 4YFYA 3UCXA 5EJ9A 4QU9A 7GPBA 2R8BA 3KD3A 1JEAA 1FFCA 3EGVA 2XA1A 5DEIA 5F2NA 2I6FA 3PU6A 1G8SA 1M67A 3EQ9A 4OM7A 4E08A 2YS6A 1H0KA 4YAGA 4J7UA 4KQEA 4TM8A 3DEKA 3H5VA 1FFAA 3OO0A 4MKFA 2I3DA 4X85A 4HVLA 4YCJA 4R1OA 3RVMA 2FJ0A 4WGFA 4EG6A 4HS4A 3RC8A 1GZHB 2R7KA 3GVIA 4ND6A 2GF2A 2ATEA 2IYQA 4O4LA 5EYPB 3A37A 3H04A 3RWBA 1W7AA 5HP4A 4H59A 1X19A 3BHNA 3W6NA 4MV0A 2QUHA 2PSEA 4IUCS 4KOAA 4UU7A 3INNA 5IJZA 2AI2A 3L8MA 4PWZA 5FTLA 3ER9A 3G0DA 3BE4A 4BN5A 3EE6A 1GDTA 5HUJA 1I6WA 2Z95A 3DTVB 1QQ7A 4IIDA 4DKXA 4DV4B 2FEOA 4NR0A 1QDEA 2BF4A 3IPAA 3K2IA 3WL7A 1EKXA 2BUBA 1C30B 4J2OA 1FW8A 4J1TA 2IUSA 5DX0A 3ZCUA 1OZHA 4CM4B 2HCTA 3N76A 2MSLA 3PQEA 4RF3A 3A27A 5KEIA 4RD4A 1A77A 1JR4A 2IPXA 5EP4A 1W1WA 2C3UA 3L6BA 1ZH8A 1ZW6A 1ODSA 4M99A 4UOEA 1W1IA 2VJMA 1RJEA 2GD2A 3F90A 2LDXA 4ENWA 5KTMA 5AW3A 4CGZA 4WNAB 3LHDA 1EX6A 1X15A 1Z2NX 1CQIB 2PMDA 3KQMA 1IN5A 4LECA 3TFWA 1E92A 4LJSA 2B35A 1GNRA 2Z08A 6YASA 1U04A 1L4GA 1OXKB 1UZMA 4H6VA 4AKIA 1D4OA 5AVXA 3N8NA 4W5OA 1NXQA 1X74A 3BIOA 4OL0A 4ER7A 1AUPA 2F3QA 4ZI5A 1XRRA 2WHPA 3E8SA 3UFXA 2XCRB 1CW2B 1J70A 1D09A 2BFDB 3BORA 3NEJA 4M7PA 2O4UX 3BUSA 5DW3A 5NULA 1OZAA 1J0XO 3GLTA 1O6FA 4MINA 5JXHA 5CDUA 3V1LA 2NYUA 4DNXA 4YP1A 4BP8A 4TKLA 3OQIB 3OD5A 3LGSA 2RAPA 2WOJA 3GJ5A 1AKRA 3OIFA 2MSKA 4KLCA 2E2WA 4PO3X 4U2BA 1M66A 4XJSA 1WB9A 3B13B 1XAGA 2WAMA 4QEZA 1I5RA 2Y1EA 2IHKA 2JAPA 2ZTSA 4UUBA 4HHEA 2YN0A 1W44A 3QIVA 4P3XA 2EL7A 2RC5A 4R41A 4H7IA 4A6DA 1LFAA 2HV8A 3VA7A 4ZT7A 1WV0A 3EGDA 1OASA 1PTKA 2OYRA 3W05A 3ZZTA 1M6HA 5CM2Z 4EITA 3V6MA 1HFWA 1JU3A 1VLMA 3D3KA 3GJRA 4JWTA 1KI9A 1EGMB 2J3JA 1M7BA 4PG6A 4YJ2B 3KHSA 4DEYA 1Y7TA 1UBNA 3ISJA 4DPMA 1EVIA 1WMBA 2W2LA 4D96A 2IKQA 5TS2A 3ASUA 3B51X 4EX7A 1GFWA 2YNMD 2JLYA 4PLCA 1Y8CA 2ZRAA 3AH8A 3OT1A 5IAJA 4GMFA 1FDSA 1H1DA 3I30X 4BEJA 2DCMA 5F12A 1NRWA 3S44A 2P2GA 4NVRA 5FFNA 1YJXA 1EBFA 3K32A 5B57C 4NJMA 1YDFA 4DNOA 3L0SA 2IUEA 3IIMA 1Z83A 4I4TF 3C0KA 4YLGA 1EGAA 1OJLA 1XJQA 2ZUFA 3OOYA 1CS0A 2WF5A 3I9JA 2HV9A 4YO7A 1ETHA 3E48A 4G67A 3GLGB 5JDIC 2AMFA 2C20A 2BEVA 4CV2A 4N0QA 3QXCA 3R3YA 1L5OA 4P3PA 2ZT7A 4BB9A 2PA0A 3W8FA 5KWSA 2J41A 4PRLA 4I1PA 1Y3IA 1T25A 1KQGA 4IRXA 4AQYB 1JHOA 3MTDA 1NI3A 4ZA2A 4MVXA 5HK8A 5DPMA 1NY5A 1X9IA 5HZHA 2ZROA 3GIDA 3I61A 1SVKA 5CJPA 3U7FB 1YE8A 4L5BA 3QHQA 4ENTA 3MT0A 4KU4A 4REQA 2J48A 3MWJA 3WSWA 5FPTA 4EO7A 3ZV5A 4CL8A 3IESA 1SQFA 1PVVA 3HUDA 3MAGA 4BS9A 1RWVA 2DB3A 1DXHA 4X1KA 4W4TA 2F6RA 2XOKD 3TE7A 3HFGA 5ALZA 3RBZA 3STUA 3SZRA 4RLFA 5KB3A 4BNWA 3OTWA 1QIDA 3EVBA 1KY5A 2BMDA 1WEKA 2H0RA 1GQYA 1GFZA 2QV7A 3RSSA 8ABPA 2GGSA 2OBXA 4LHEA 3TRIA 3OO1A 1WDLA 3D8BA 1U3GA 3V5NA 3TRFA 3LY5A 1Y9AA 2X7JA 4CMAA 1J24A 1W94A 2D3WA 3IMCA 3NVAA 4JDPA 4R9SA 2C3OA 1U31A 4MIYA 4WKNA 5IKEA 1B93A 1EJ0A 3L04A 2VHEA 3BTSA 1NQOA 4GNRA 4X5OA 1VL1A 5TQ2A 2P68A 3AINA 4ND8B 1C3JA 2DKFA 4MEAA 3RC9A 3WK6A 5JPCA 2W6QA 2NMVA 1Y4DE 2FRDA 1Y8QA 4TWAA 2UVPA 3ZGYA 1O4VA 2QG6A 5THQA 2AN4A 5DI9A 3U4DA 1JDBB 1XEAA 2GXQA 3AHCA 3C45A 3RKUA 2ZBPA 3HLYA 3G8CA 4BEVA 2KW5A 2A0UA 1PKEA 4EKIA 2FU5C 4BNHA 3L7LA 1V26A 4MVJM 5KJ6A 4KUHA 2B1JA 3D0QA 4JK3A 5HIKA 1PUIA 3RK0A 5EJMA 4JV5B 1F2TB 2ONYA 5CGQB 1JFLA 4E1AA 3TLGA 1L4UA 1PQPA 4Y6RA 3QFFA 4A26A 5ALVA 1N6NA 3T5MA 5G1NA 4BLTA 2IH4A 2AOTB 1M34E 3AKZA 1V0JA 3ENKA 3RYIB 3TDMA 1OFGA 2HDNB 2X0EA 3GLFB 1DAEA 2GTIA 3L0ZA 2RH8A 5HSGA 3W5BA 4EA7A 3THXA 4FS8A 2HSEA 2Y2VA 3KU4A 2QP9X 4BKPA 3QF4A 3CVOA 2WJ6A 2ORIA 1DX4A 4IHQA 3B52X 3L05A 2B3TA 4R3UC 3DMFA 3QI7A 3WL6A 5L4NA 2EP7A 4CMGA 2VYND 4JROA 1UBTS 3M1YA 3Q9UA 2JFOA 2UYQA 1CERA 4JQOA 2HT1A 2C2BA 2F3RA 4R7GA 3I62A 3MN1A 1NMSA 2ENWA 3IEPA 3M2PA 4PQRA 4Q1DA 2A7QA 4Z1OA 4G41A 1CPYA 2XGSA 2GQ0A 4JLJA 2H00A 3CTMA 3RYHA 5GZ1A 1R18A 4MUFA 3T5BA 1U5BB 4E4YA 3VOSA 2IYEA 2AOXA 3P32A 5JDIA 4XCVA 5TARA 5F9MA 2YC2C 2VZLA 3G9UA 2B7LA 1FRQA 4RNDB 3WGTA 2Q2OA 4ZO8A 3A6EA 3OU2A 3GA7A 1R0XA 5KQLA 1IJKA 2XE8A 3BPSA 4M9UA 3EWSA 5HCUA 3RV3A 2VPYA 2Y1DA 1IK6A 1S7CA 3BD6A 2IWHA 2ZYWX 3UV3A 1D0SA 1Z36A 2PLNA 2DULA 4PZUA 4JBGA 5CW2A 4BNJA 3L7AA 2X8AA 1KL7A 1CUZA 1PWXA 3FCAA 3QE4A 3VPXA 2GD0A 4Q3BA 4N7BA 3WADA 1QBKC 4FMCF 2AOUA 4FBGA 4FK8A 1EXVA 1FX0B 1YQXA 1U28A 4DBLE 1ZCBA 3TBKA 1CT9A 3H2SA 3QLVA 4M9XA 2QTHA 1CR6A 2XYRA 3ZDYB 4WFQA 5LQAA 4F8JA 3FYCA 4CZ2A 4XLLA 1YB4A 2AG5A 2NQ8A 1Y5RA 3ZDEA 1QO0A 2ZR7A 5F51A 3E70C 1W6RA 3D8UA 4GSLA 3SHTA 5B1EA 4LOKA 1CWUA 5LQCA 3BCSA 1SOUA 2X2EA 2ZJ7A 3BVPA 1KYIA 2PT6A 4LJYA 2P9BA 1CE8B 4I7EA 3UVEA 1ZZGA 2IY8A 3R7NA 1G8HA 3G23A 4L07A 1UP7A 4MHOA 1Q0PA 4M6WB 1NQXA 1U3FA 3MEQA 1UWKA 1SIOA 1Z74A 2HK9A 1E3IA 3NC1C 4GICA 1QQ5A 2BTQB 1CB7A 1O58A 4EQ6A 1U1IA 4CUJA 5JI3E 3H6KA 1RI1A 2AIRA 2C95A 3PKJA 3R6DA 2I54A 1Z28A 2O3JA 3HO6A 1JWAB 3I64A 4OU5A 2JLXA 3B8EA 1LDEA 1OC2A 4A4DA 4H7FA 2BIFA 4JJEA 1U0SY 2G36A 4X8OA 5IU6A 1CJMA 2V97A 4YYEA 4KO3S 1IOZA 1T1EA 1M8JA 4FT4A 1YR1A 1DHTA 2MT9A 4K86A 1K7EB 5HUQA 2AFIA 3HYRA 4IDEA 1CY4A 1EFAA 1PJBA 5AKLA 2AV6A 2DUMA 3QPAA 3D6AA 5K45A 4J4HA 5KOYA 2C9ZA 1IB0A 4FONA 3ADOA 1AA9A 1YZFA 4KMMA 4B35A 4B4OA 1RAGA 1QVRA 1UIMA 2C82A 1X2BA 1Y3BE 4NOJA 4YMWA 4NZNA 2FW6A 1OCEA 2Y1GA 3DG9A 4ERXA 3DHWC 1RLOA 2I2AA 3AF0A 2R5NA 4FFSA 4Y9TA 2Y8EA 1CB0A 1YBMA 5FTMA 1KYXA 1FK8A 4TT3D 4B3MB 3UUGA 4GAEA 1UBEA 3OKCA 2JCXA 2VUUA 4BECA 1Y8RA 3ZHZA 5BSHA 2QZSA 1V3VA 2Y1WA 1KTVA 5CR9A 4S12A 5E9QA 2VRNA 4DR6B 4E22A 4FDLA 3OZWA 1I2MA 1L9XA 1PZGA 4KIUA 5ARCA 4QBGB 3HU3A 1LJ8A 1FJGB 3W3ZB 4G65A 1P2FA 2IT1A 3CRRA 3VDXA 3S8MA 2E87A 2H2AA 2RH5A 4PRZA 4CM3A 4DV3B 1P29A 4BNVA 3J81k 4QICA 3LKVA 3GFSA 5JJIA 2V65A 2VRCD 2BBTA 4FX5A 1HE4A 4QPDA 4XB6B 3EEOA 1JHUA 1TJ4A 4IYRA 5IMSA 4HT3B 1JGTA 2F7SA 2YXDA 2B25A 3PPXA 5IBRA 2O7SA 2I8CA 3LH5A 1UC4B 3P4YA 1L4BA 3ZHYA 4I8DA 4AL4A 1F7UA 1JHPA 2QSUA 2BGWA 3VJRA 2EFGA 3MUFA 1H23A 1YFZA 2YJTD 3GZ4A 1H22A 3ZWOA 4EUEA 3BMCA 4ZEMA 4NECA 1XJCA 2QN6A 3KZMA 4FDVA 3VOAA 4BB0A 2MDTA 3A3YA 2GRAA 4ZAXA 1B76A 1V9SA 3NP9A 4O1IA 4B3IA 1L5HB 1Q77A 2ODAA 2QUAA 4B4WA 2QLNA 4EMUA 3FTDA 4G37A 2VDLB 4RV4A 2FMFA 1IUKA 4BQFA 1N2SA 3I04M 4BX2A 5JFGA 4DV0B 2AN9A 3BD9A 1CYDA 1E6CA 2CD9A 3P0RA 5HJ7A 1ISGA 2ZTLA 5KOJB 2GZAA 2J4CA 4N0MA 2C2XA 3DULA 2E37A 4EF4A 3ZBPA 4WJKB 4QOSA 1JDTA 1WR8A 2CJWA 2JBAA 1DQRA 5ALDA 5CITA 3IEIA 2IIQA 2I8LA 2P1ZA 2YXEA 3FYUA 1W4CA 3N8GA 3CLUD 1NHGA 5BSGA 5JCOC 5TPWA 4N6NA 4Q9IA 3MK31 2B0JA 1LPPA 4PU0A 3EA0A 4M86A 4U2KA 4ZALA 3UOGA 4XRGA 2IU3A 4YJKA 3CEHA 4B2LA 3CUWA 2EV9A 4KMOA 2ZSUA 4LJ5A 1TRHA 1U7DA 1ZOSA 1U0BB 2YOFA 5C5CA 4UHBA 1AH2A 4HZGA 1VJCA 3LP5A 1N9ZA 5FV7A 1N33B 1ESDA 1GPWB 2AXQA 5EE3A 2WWYA 3EDYA 8OHMA 3WB2A 4EKGA 1FQOA 1DJLA 3E9QA 3HZOA 1T1IA 2PBFA 4LYJA 4P4GA 2CYCA 3QU9A 1AHIA 1XZHA 4TYMA 3HNRA 3FOFC 3DKIA 1KY2A 2HXYA 1Q0LA 4NZ9A 1NMYA 3OCVA 1OAAA 1J99A 3A04A 5AM0A 5D7BA 1AKEA 2CXUA 1TU3A 4WADA 2Q5HA 1Y6QA 2BEUB 3V1UA 1P1JA 2C98A 2OD2A 5CLIA 3JQQA 1GXSA 4PZDA 3RRBA 2ZQYA 2QRVB 3VSAA 4GKKB 2F48A 1GL7A 3DE7X 3N6VA 3O9MA 2GHIA 1CF2O 1GUYA 3QV1A 1NXSA 5JEDA 1KY4A 2BGIA 3ZLVA 5DTIA 1M1XB 3IO3A 5ADHA 2QI9C 1JKIA 1B6RA 2FSUA 4B7UA 4L72A 3VH4A 3ZC3A 4R8MA 4ZHQA 1M0TA 1LW7A 2WF9A 4JJ4A 5COQA 1G64A 1Q20A 2OWDA 3FDXA 4JEMA 4Y9RA 1UL1X 2NV0A 2O2GA 4Y2RA 3SF8A 1Z5NA 4C21A 4ZV4A 1Z35A 1L5SA 5I5GA 5KNDD 1GSOA 5FPSA 4F2WA 2WWFA 4DSZA 5L7WA 1OLXB 3MQ2A 4WESA 1UOEA 2NO6A 3DONA 3PWSA 2F2TA 5IP5A 2WYIA 2W6OA 2LE0A 4Z0HO 4BQNA 3PUZA 3KTFA 3TSCA 1JA1A 3G2KA 1LW6E 2GBLA 2F9MA 2JATA 4LZJA 3UV7A 4PN7A 3ZWWA 4HGQA 3IUNA 5I7SA 2FW9A 3HXPA 3NHBA 1CX9B 3NETA 5HIIA 4RGQA 2IH5A 1CQPA 3V46A 4MKZA 5I7UA 1UF9A 5HQ3A 2HXGA 3GOHA 2VP0A 3M1LA 3B6JA 3GQVA 2YHIA 4V2UA 3ZPXA 4IFEA 4RXTA 4U5XA 4D4HA 3AWIA 2VZ8A 5J5VA 5KQSA 3U4QB 3AWDA 2O0MA 5DGDA 5HIJA 1VL5A 1P3JA 1W2WB 3PA8A 2BHTA 4HLUC 2XMPA 5FHRA 5CCBA 2FEXA 2YJNA 3EPKA 1ZA1A 5F9FA 4JP5A 1T0IA 1T2EA 3C4JA 1YBAA 4YBZA 1X77A 3GRAA 1Y98A 2WSMA 3Q2OA 1BDHA 2Q1XA 3B9RA 5SZHB 1OXMA 4XDHA 1TT7A 3KP1A 2AEJA 1QHHA 5JECA 3WK4A 3FOAA 4YV7A 2V9PA 1XNJA 1M1NB 3F5QA 1QANA 4MR8B 3U56A 4KFRA 3JY6A 1W49A 4I3GA 4LNUA 1CY2A 3EBOA 1GTG1 6ABPA 4F9FA 2ISCA 4TM7A 4DZRA 2C5SA 2HWWA 4GYKA 4IDPA 1E2KA 3RQIA 4WJLA 1P9WA 3U1VA 2ZJFA 4O4HA 4XFJA 1QG0A 5FT9A 1X3SA 3ND8A 1RYMA 2PZEA 2RHOA 3WKDA 4ZN6A 2IX3A 2QGZA 3HJAA 5F1YA 4WEQA 1ANKA 3CZCA 1CDZA 3OY2A 2HEIA 1HLGA 4JKOA 4L50A 4UHJA 3MWYW 3UENA 4DA7A 1EK2A 4FYXA 2MSCB 2BTOA 4BBPA 3RIYA 2LBPA 1X0VA 3HGMA 4W6ZA 1JFVA 4Y2QA 2OV2A 2PE5A 4JB0A 1Q15A 2QD1A 3W9UA 5B3KA 1RVV1 1HRKA 1HC7A 1RPTA 2HA5A 1U2DA 1ZRMA 2JJ2D 1MA3A 1FNMA 2PHZA 1N0VC 1SUSA 3VZCA 4EELA 3DOIA 5AD1A 4ZAFA 1IH8A 1JJAA 1LVUA 3K15A 3BDAA 5C8YB 1MPXA 4BKMA 4KPFC 4KDCA 2WWVD 4EFDA 1Y4ZA 2BM9A 2QUBA 1HSZA 3CRZA 3DXFA 3OECA 4IXDA 3TL3A 1XO1A 1B1CA 4I1VA 1UC5B 1PNOA 2DPLA 1G98A 2EKLA 4R1UA 1Y7LA 3QP9A 2X13A 2RGNA 3EFOA 3F3SA 3ZW9A 3I9LA 3NBYC 3TLEA 3JSAA 4IDQA 4CKWB 4ZDIA 3AOEA 4PCAA 2REBA 1RC0A 5CK4A 4RA9A 2BMFA 3B1XA 2NNWB 1K27A 2O3QA 4RFSA 4G0QA 3RLIA 4ZJPA 1G55A 3URMA 1WCXA 5B64A 1HZZA 4KTVE 4ND1A 4RD3A 1HYQA 1K1EA 1XZCA 2Q3JA 3GEGA 4H4EA 4OQMA 4ZMSA 2FRXA 1JHQA 1NQAO 1X7WA 3KZOA 4A91A 2EJWA 2IE8A 3BYZA 3W8DA 4BYGA 5JSYA 3H18A 1UT8A 3K0EA 1W46A 2N47A 2P7HA 1IG0A 3B5EA 4WLOA 3EG5A 5F33A 2Q50A 4L4YA 3ETLA 3M5DA 2MMGA 3EA4A 4LVUA 2MTBA 4DRXB 4LF7B 1WETA 1H5NA 3ZVNA 4BNKA 1G2QA 3QXJA 1KVUA 1YL7A 2I1LA 3RTAA 3DE1X 1XRNA 2J09A 2ZP1A 3O3OB 4AB1A 4XVCA 5B1DA 4OM8A 3PHHA 1D03A 1EFHA 3S1LA 2XOXA 1XVAA 3EBPA 4RTLA 3IBGA 1JIUA 1JG3A 1RAFA 1VBKA 2FZ4A 2ZSAA 3PEUA 3EAGA 1AMNA 2WT4A 3UOWA 4A0FA 1UCFA 2H51A 3RDPA 4P0TA 2NU6A 2PRYA 5LMUB 4MR9B 3A11A 4HPXB 4YBRA 5FIUA 2FN9A 3DDNA 4BGDA 3THYB 5IVPA 2GPTA 2ECQA 2L0XA 4PR3A 4BGIA 1ZL0A 3ZEIA 5F23A 3T6KA 2CVZA 3OCCA 1HF3A 2HJVA 1RWKA 4ZOBA 3VHLB 2FR8C 1NZDA 3NBUA 1Z38A 4FDUA 4HK4A 5DWDA 1UPCA 4A8JA 3O7MA 1HMYA 1OXUA 2WU0A 3HKCA 2IS1A 2XMGA 3KD2A 1V4NA 4BRUA 5DYYA 1HH4A 3VTKA 2J3HA 5FCDA 5JALA 3EMBA 1Z0UA 2GILA 3NEYA 5FADA 5ARBA 3FVVA 1JEOA 1T0HB 1G5IA 2CF5A 1E2BA 3TOXA 4HB2A 2ZREA 3FJYA 3TUZC 4BXOB 4OHWA 3ZU5A 2EZ9A 2JBHA 2JEOA 1S3SA 3OP4A 1D6SA 1SD2A 1UMCA 3CH6A 2Q4TA 3EZ2A 3IQGX 3MD9A 3OLWA 3P1JA 3F71A 3LCMA 4DWWA 1THTA 4XWOA 4G23A 3CRW1 2GBIA 2WAXA 3UOAB 3BKWA 2HSGA 1RRVA 1XZFA 4X71A 3WBJA 2WEKA 5J4HA 3KXKA 4FHCA 1IYZA 3MSCA 3VDRA 4JOSA 1GZ4A 3GI1A 4YB8A 1NNEA 2P5TB 5PGMA 4LZLA 2XE7A 3IP3A 1MGPA 4FILA 4Q9LA 1XF9A 1Q92A 1R8SA 4BB6A 2G4CA 1JKMA 3NBAA 1X1TA 5L3RA 2JHCA 1HQDA 4EO9A 1QHFA 2VAMA 3ZZNA 3ZV7A 1PTJC 4MGKR 4HJRA 2NVBA 2CFTA 1XQYA 2YMQA 3I6YA 3DZDA 4FGUA 3JZFA 2O23A 4NYIR 5G0UA 1M2GA 4MLPA 3TRJA 4LY0A 3ONWA 4RVDA 2H07A 2CHEA 2XQVA 1N7GA 2XITA 1QE0A 3F7TA 3DYBA 3QPVA 1VKNA 2PIAA 5IFLA 3TR0A 1W4AA 3PWZA 5A3SA 4TWRA 1XXHA 1PJ4A 4JR1A 1CIVA 4KR7A 2D2VA 3GG9A 1FSSA 2FHSA 3FVTA 4UUOA 3ELWA 1PFGA 1ULAA 3G8BA 5AK6A 3BB4A 2ZB2A 2DJIA 4WW0A 3VMMA 5C5DA 2DFPA 4IEFB 1EE2A 4BL5A 4Y2TA 3JD4A 3LDHA 2GPYA 5TEWA 1SH7A 4F5WA 1KC1A 3A9RA 3KOMA 3PICA 4L8WB 4RAQA 4S24A 2WSLA 4PN3A 3CC8A 4IIJA 1CF9A 3E1SA 2RHRA 4PZLA 1A7AA 5HTKA 3ZCSA 1NVFA 5SZIA 3SY8A 3A6PC 3FROA 4U3JA 4KFTA 1J0DA 1I14A 4GLBA 1OH5A 4KBGA 2V5AA 1RWXA 4KIWA 1JJBA 4FGZA 2Q9AA 3JAKB 2J0UA 1JJVA 2X8WA 4J0HA 1LX7A 3AT1A 3HA5A 3HB4X 3Q98A 4NXNB 2BEJA 3N7AA 1U98A 1UQRA 4UMVA 3VX3A 4KW7A 4ZICA 2WW8A 4LDPA 1IZ7A 1IWPB 4QATA 4EB0A 4MLDA 1EM6A 2BR4A 3C1UA 5KMGA 4B75A 3TRHA 3L49A 5EMLA 3R7DA 1H2HA 2AFHA 3O1IC 4G8CA 3S2UA 2BHNA 3C3XA 4I5EA 1BCRA 1SY7A 4F84A 2PKRA 3H2BA 3ZXUB 1UUFA 1IXRC 3LT0A 1ORRA 2TSYB 4NHEA 1E1NA 4CN8A 4OHXA 1LSSA 1WLSA 4G84A 5FNVF 4ZREA 4AZ0A 4YT8A 4LZPA 3VU8A 7ABPA 4YCBA 3BSFA 5SZJA 1RLUA 1Q7EA 3REFA 2P6PA 5EZYF 2C4WA 1DADA 1RJ9A 4JASB 3JTEA 4N8DA 5KKAA 2EATA 2NO0A 4QDKA 1EFPB 3C48A 5E1OA 5FUMA 3N6XA 4KKVA 1KPIA 2B21A 2B34A 4K28A 2DFDA 5LA6F 2QMUA 3L93A 3SKVA 3ESDA 4BZWA 3FFWA 1XK6A 6CHYA 5ICMA 3U13A 4CCSA 5KPDA 2BMWA 4G0MA 3IV9A 2G72A 3QLVC 4BHTA 1OLUA 3HDVA 1FDVA 3M83A 4D9BA 1EDDA 1SB8A 1XTZA 2GD6A 4B79A 5JQWA 3ASYA 4URXR 4TXNA 2ZYDA 3JZMA 1F8GA 1GGJA 2CB0A 3FPHA 3QMWA 1T4DA 1Y6RA 5CU7A 3V4PB 4EPVA 1BXRA 5REQA 1S8FA 4OGWA 4AAYA 4CF3A 1ZD9A 3O73A 3CH5A 4LVOA 5C5IA 1B73A 5ES4B 2FX3A 3IV6A 4YAWA 5JVDB 1AM4D 2RMKA 3LHSA 4TT3A 4WERA 3RSHA 1UK9A 2W6JA 4ALNA 1YGPA 5IF3A 1K9SA 2QZPA 2NUAB 2PUDA 2CE7A 4QGFA 3GCDA 3SFTA 1X7YA 3WDLA 1U1EA 1US8B 4KE8A 1N6LA 4R8SA 3NEAA 4QXQA 3SKXA 1F2UB 3A9TA 2QJTA 4QOGA 2JGIA 3QU2A 4D97A 1QP7A 1MRSA 2FWNA 2RGEA 3PSHA 4CEJB 2EJBA 1PLLA 1DWUA 1I7LA 3HGQA 3PJEA 1UXKA 4IX1A 4TYWA 2XMQA 1M7GA 5E6RA 1JEQB 3M2TA 4LDAA 3GGGA 2IHNA 1YMUA 1GQQA 1R1DA 3SG0A 3TEFA 1U9JA 3M9LA 3AEUA 1ZVMA 1DAKA 2RK6A 4GR9A 3ZWKA 5FUWA 2IXDA 1MAWA 1EG7A 3OQ1A 3QUBA 4J76A 4L0DA 1ZUWA 2C9YA 4QEKA 4TTQA 4E4TA 2ZR9A 2B36A 1YZQA 2I3GA 3H87A 4MMXB 4ARZA 4EQZA 4OJTA 1B6TA 4XYGA 5A5DA 2AB0A 3TFOA 2WD8A 1LSOA 3COVA 2WP0A 4R81A 3WGGA 4QUDA 3UQYS 4H7KA 4Y2GA 4B40A 2FOLA 3M6WA 3DHEA 2O8CB 2Q49A 1KZ7B 1P75A 3MRTA 5CFPA 1MCZA 2ZITA 3ACDA 3Q85A 1AQNA 1PR9A 2CXRA 1V5WA 1DKQA 4BNLA 2FK8A 3EZYA 1LFDB 3OX3A 4MW2A 1IXYA 1JR3A 3T1TA 1J97A 1O9HA 3RHSA 2P69A 3UYLA 2EVWX 2ATCA 2AX4A 3DTNA 4LMRA 3QG5A 2GEDA 2I4TA 1J9EA 2ZWPA 1KDPA 1FUIA 1V1JA 3ENZA 1JXAA 3M82A 3OUTA 4UCFA 3TQQA 3WKAA 1A5SB 1RSZA 1ZD2P 3ZGNA 1N5OX 5A1JA 3HZZA 4DQKA 1TMOA 2AZXA 1ZNWA 3H9JA 1F3OA 3K5HA 4D41A 2NZUG 3MJ4A 1EFCA 5ELMA 1QF6A 5CJ2A 3EIFA 1U0GA 3ZVLA 3ENQA 1YUNA 5HKLA 2YJ3A 2V0NA 4HRYA 1PEDA 4QXOA 3DMTC 5TQVA 5AW8A 1V8FA 2CL6X 1XPRA 1TI7A 2CLSA 4OQQA 3PNLA 1T4BA 3VNQA 2GZSA 2AG0A 3ECCA 1N2CB 3TIVA 5JU6A 2REQB 4FLFA 4CXMA 3NOVA 1IQRA 5C1PA 1XA0A 5AK3A 2ZLBA 3MINB 5HFNA 1PX0A 1I1QB 2GPBA 3A9CA 3AVPA 1Q1EA 1O97C 3UATA 2PV0A 5B7PA 3TD9A 3TKAA 3ND6A 1T91A 5CFNA 2ZS9A 2HRCA 2MYUA 3VH2A 4F4IA 2G09A 4HGZA 4JYBA 3WV4A 3ZIAA 4FHEA 5DSZA 5DTJA 4C05A 3S5UA 3T5PA 1O95C 1Z4NA 2Z8ZA 4XAQA 4XCQA 5D6OA 4WY5A 4GX1A 2RBKA 2VDJA 2EW2A 1L7XA 4QNNA 4G4IA 3PG5A 4RJIA 2A0KA 1U5AA 3RAJA 3TZLA 4AJLA 4OAOA 4AY3A 2F8MA 1N25A 4OL9A 2H3EA 2RB5A 3FR8A 3KJQA 3KYIB 3E5MA 2GN6A 3F6SA 4CEIA 4B7CA 4BNDB 3F5DA 3WY9A 4I81A 2VAXA 2O1SA 1DUVG 1U3CA 2QBYA 1M34A 3L8CA 4G5HA 4QTTB 4YAEA 2XHZA 3ZGVA 1BWRA 4AZ3A 1PW5A 4MUHA 4DIMA 4RL6A 4ZZIA 3GFOA 3ET5A 2P5YA 5IUNC 3HCWA 2VAPA 2P2DA 5LLSA 3D3WA 1YRLA 4OMDA 4WKPA 3SXUA 1SU7A 5ESWA 5BVGA 2HQSA 4GXTA 1TW3A 1ZRNA 2EFDB 2V7QD 3D81A 3WAJA 1TTTA 2P9TA 4HUQA 4C4OA 2BHSA 4V0ME 3U2QA 4DF3A 2BISA 5J2TF 1N0IA 5GADl 3TYXA 3K09A 2Q1YA 4BVAA 5KX5A 2NV6A 1JXMA 2ET6A 1DINA 3FSGA 4MZDA 3J81A 3FHTA 1M1YE 4PZCA 2GCOA 4W6QA 3RS8A 2VKQA 5CVEA 3RJMA 3KR9A 4DLYA 2CVOA 1WY7A 4PFSA 2IYUA 3L0DA 3OETA 4LDJA 4LQ4A 4RHXA 4YI5A 5FYDA 1UEJA 4L02A 4F45A 5A4AA 1PBTA 3UCEA 4OHPA 3N5CA 1SWVA 4YRIA 5CIQA 1KK1A 1EP3B 2ZXEA 3NPMA 2F43B 4PYMA 2R6HA 2P3QA 3K0SA 3Q6IA 1GYPA 3R9XB 4DSNA 5IN4A 4RK5A 2OBMA 1O96B 3FB4A 3TEMA 3TLBA 4Q9AA 4C7JA 2FY8A 3QVJA 4D57A 3NOQA 4NFHA 3MGCA 2FHPA 3V7NA 1VBFA 1CFJA 3KO8A 2L82A 4S1VA 1ILWA 3CVJA 4PICA 3OOEA 3AFHA 2DETA 4PSAA 3BX1A 4IDCA 5JS7A 1BYIA 5JV5A 1RI3A 5T57A 3RFVA 4PYRA 1ODCA 2R86A 4AS2A 5LIPA 4DVGA 2PJZA 4QD3A 1JKXA 5LUBA 4W82A 4PFJA 4ZDJA 1L4FA 4X8HA 1MQSA 1UZNA 4I1SA 5F76A 4KIFA 3K16A 3Q3GE 2J4DA 1X1BA 3W79A 1NBAA 4ZJYA 1JP7A 1Q16A 3NUZA 3F46A 4WBNA 1A9YA 2NX2A 4P9NA 2QT9A 1R50A 4GYJA 2GEKA 4L16A 5A05A 3FCSB 3BERA 5MDHA 5CT5A 1OXVA 1XNGA 1PFWA 2OORC 2RAVA 2VDNB 2WYVA 3RUDA 1M6VB 2H1LA 3AEZA 4Z0NA 3C3MA 2OBBA 5CA1F 4K9OA 2GOYA 1T9GR 4MLZA 4LZWA 1LV7A 1OQAA 4BMXA 4YMGA 1QIMA 4Y6QA 1MGOA 1C3OA 1PQWA 4LQLA 1I4OA 4ICIA 3KJXA 4Q1VA 1GFSA 4P7GA 4CR6A 1P1IA 4M1YA 5J9FA 2XZOA 2C4MA 1JE0A 1JDZA 1AXRA 4PLPA 3FOCA 4WZZA 1WULS 4JI7B 4UM5A 1ZEMA 4LISA 1TYAE 1FUEA 5DXFA 2IBTA 2ONKA 1XDZA 4QULA 3IP1A 5DGCA 1Q2UA 2NACA 2QYOA 4OATA 3O6VA 3CUEF 1QVVA 1EQUA 2H85A 4OYRA 2D2IA 5LYJB 3DDOA 1K6XA 2WV9A 2ZCVA 3G49A 1GAJA 5AJYA 5JNLA 1HT2E 1KEEB 2QL7A 4Z3OA 4E07A 2BMJA 2GMWA 3JR7A 3QBDA 3IDAA 4HQ6A 4TL7A 2IPMA 5F78A 4DJFC 3R5HA 2OBNA 2ZJ8A 5DP2A 5LD2C 4TV8A 4HO1X 4HX2A 1AK2A 1SOMA 4PXYA 3R41A 5AQ1A 1KQ3A 1G2OA 4P7JA 4LXUA 1JSLA 1WPGA 4CKXA 2BGRA 2P9HA 4YRNA 1TIPA 2R62A 4WNAA 5IW8A 4Z1MD 2EX0A 1RZRA 3JTMA 3MNFA 4ZCLA 2OCDA 3BGSA 4CT4B 1JAIA 3O8BA 1CEQA 2JLRA 2Q2QA 1ZD3A 5NLLA 1J42A 3GV0A 3NYQA 5AMXA 3W3AD 3JQBC 2O59A 5TXGA 2ODPA 1EBUA 2PPVA 1DRWA 1SXQA 2ISQA 5BN1A 3A1SA 1QONA 4AMBA 2F9LA 2QTVA 4NQZA 4R2LA 3ZWVA 3T4EA 4BNTA 1S3IA 2ZBRA 2A3RA 3UKDA 2CLLB 3H9BA 2JGMA 2HZ7A 1GZ6A 2GI4A 2R8RA 1W9HA 3Q2IA 1YWGO 4X1IA 2GCNA 1IHXA 3S7ZA 1BKSB 1LS6A 1SWWA 1TYZA 3H11A 3R23A 5HOQA 1QX3A 2XRZA 1TE2A 4B2PA 3IBTA 2XDAA 4YMLA 4ZOEA 2O8BA 1QMPA 2PL1A 1P6XA 2OO7A 1FMLA 4V38A 1EXDA 3IC5A 3QUQA 4G0XA 1N92A 4Y7CA 3ZNOA 1QRSA 3SD7A 3T9BA 3V2IA 5I45A 1R10A 2C8JA 1OPRA 1GLVA 4O0LA 2F1HA 5E7JA 5IN5A 2ZXFA 1VSQA 4R83A 4ZYYA 5TPZA 5IAOA 3QEAZ 1N0WA 1NNUA 2L2QA 4WXEA 1OYYA 4RL4A 5B2ZA 4HMQA 3NCTA 1WXWA 3Q15C 1GL9B 4Q4AB 5LPNA 1