4GC5A

Crystal structure of murine tfb1m
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
319
structure length
318
Chain Sequence
FRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase 1, mitochondrial
publication title Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 103
structure length 318
sequence length 319
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gc5A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gc5A01
5G02A 5BXYA 1KP9A 3EVBA 5E1MA 3S68A 1WXXA 1R18A 3CCFA 2PGXA 2G70A 4EVIA 2IH4A 4E70A 4E31A 3FPJA 1M6EX 4HG2A 3UA4A 1XTPA 1G6Q1 5EMJA 3SGLA 4KVZA 1NE2A 1RI5A 5D1NA 5EHGA 2P1DA 3Q87B 4X63A 5FA5A 5H02A 2QRVB 2NYUA 2ZULA 3P9KA 3C3PA 3EVDA 5FADA 4M38A 1ZKDA 4HTFB 4PYMA 5K09A 1G8SA 1SKMA 3VC2A 1FBNA 1WZNA 3EVGA 5F2KA 5K0BA 2GPYA 3UJ8A 3GRYA 1RJGA 5GOZA 5LQNA 4DQ0A 4QTUB 3G2QA 1KPHA 1P1CA 2PV0A 3LGAA 1QAOA 2JHPA 4HGYA 4NECA 2AN5A 4HC4A 9MHTA 1VBFA 4PGHA 2OB2A 4U7TB 5KQRA 2H1RA 1TW3A 2ONYA 3EVCA 5F2NA 3HA3A 3TMAA 2GAFA 1AQJA 3FPEA 1DUSA 3UJ6A 1NW7A 1EQAA 4P7GA 1VLMA 4OBWA 5DXJA 3PB3A 3BWMA 3G2OA 4AZWA 3UJDA 4IV8A 4UOEA 4DKJA 4GOOD 4AZVA 1NW6A 3B3JA 3E8SA 2AVDA 3OCJA 3PX2A 5EMLA 4E30A 3BGIA 4R05A 4EKGA 2PX5A 1VL5A 3GRVA 3CC8A 1EIZA 1ZGJA 3OZSA 4L7VA 2P3OA 5C9ZA 2JHCA 3A4TA 3TKYA 3TFWA 4P7JA 2CMHA 5DWQA 2AOVA 3B3GA 3HVJA 2OO3A 1VP9A 4GUAA 4QQKA 5EQJB 3EVAA 1QANA 4KWCA 4RTRA 5GINE 3TQSA 4OQEA 4PYIA 1O9GA 2HR1A 4E2ZA 2QRVA 3LECA 4YV1A 3BWYA 3AJDA 3P2IA 5CVVA 4OA8A 3P9IA 3B89A 5MHTA 3KQOA 5LQRA 4WXHA 1N2XA 2O0LA 4WVLA 3EEYA 3HVKA 4PYLA 4DA4A 2DPMA 3DXZA 2V7EA 3RODA 2I7CA 3LDGA 5E2BA 3V8VA 1VE3A 1EJ6A 5CVJA 3DMFA 5CVUA 5C0OE 2N47A 5HEKA 1TPYA 4BP3A 3BKWA 5EZQA 1WXWA 1XJ5A 2P3LA 2XVMA 3KQYA 5GM2A 5GP1A 5ICEA 3A26A 3R9XB 3THSA 3X0DA 3M6XA 1RI3A 2YX1A 4RTKA 3KQQA 5K0JA 3MB5A 3OU6A 4PCLA 5FWAA 2ZZKA 4XCXA 3T7SA 3OE4A 10MHA 3SMQA 1M6YA 2ZBRA 3O7WA 1JG3A 1NW3A 1XDUA 5EKUA 4AZTA 4OBXA 2ORED 3NVMB 3L8DA 4GF5A 2P35A 3T7RA 3VSEA 3KPWA 4ISCA 3IYLW 2P8JA 2Y1XA 2YXDA 3I64A 2O57A 4HH4A 5EKXA 3KQPA 3SSOA 5K0LA 2VDVE 3FTCA 3FUUA 4JXJA 1NW5A 2AN3A 5GIOE 2FHPA 3KR1A 5K0EA 3KQTA 1NV9A 2AZTA 1B42A 4GBED 2ZVJA 4HSGA 2VZ9A 5GWXA 2EFJA 3I5UA 4F84A 5EZSA 4E32A 3DMGA 2C7QA 4GC5A 3F4KA 1MJFA 3GJYA 3G2MA 4BP1A 3B3FA 3DOUA 4CKCA 3PFGA 3R24A 1INLA 3G8BA 4PYOA 2C7RA 2H11A 1G55A 4QVKA 5JR3A 5CM2Z 1SQGA 4R8SA 5EOVA 4CKEA 3HTXA 2ZZMA 2XYQA 4LECA 2HWKA 4DZRA 1NKVA 1VP3A 3MGGA 2PKWA 1JG4A 2IDJA 2LD4A 3M6UA 1FPQA 4G56A 1JTEA 4PYQA 3HVIA 2FRXA 1QYRA 1EJ0A 1BKYA 1X19A 3DULA 3G8AA 2YR0A 2FCAA 1I4WA 2FPOA 1TW2A 2QE6A 3EVZA 5DSTA 2PT9A 3AXTA 1VPTA 2GB4A 5DSXA 2Z6QA 1HMYA 1U2ZA 3HA5A 8MHTA 3DXYA 5DLYA 2BZGA 3G88A 2R3SA 4ATNA 2BR3A 4QQNA 4CWAA 4C04A 4EMSA 2B2CA 2CL5A 3ELUA 1FP2A 3KR2A 3BKXA 1R74A 3ELYA 2E5WA 2NXNA 3SVZA 1G38A 2BR4A 5FHRA 3NVKI 2IFTA 5B1SA 1NBIA 2O07A 2B78A 3UZUA 3B7PA 3EGVA 2ZLBA 1KYZA 1SUSA 3PFHA 4FZVA 5LSAA 5CCBA 2ZIGA 3LKZA 2IGTA 2P3QA 2CWWA 1KIAA 1UWVA 3CGGA 4GOND 2JHAA 1KR5A 2PXCA 3C6MA 5EGSA 4BLUA 2ZCJA 3HCDA 3GNLA 2EX4A 3LBFA 3GIWA 3A25A 5KVAA 5E2AA 5HIIA 5C1IA 1AQIA 3T7TA 3PS9A 2V74B 5LQCA 1JTFA 1ZHFA 3AWIA 4R6WA 2XVAA 5FWDA 5EEHA 5HIMA 4C05A 3AY0A 1RJDA 4DCGA 1P1BA 4K6MA 3SR4A 1JSZA 3BWCA 3REOA 3DP7A 3EGEA 3IEIA 4C06A 2ZIFA 4XUCA 1N7JA 2CKDA 5HILA 4E2YA 1NV8A 4YUWA 3LBYA 2QM3A 3A27A 2PY6A 3UA3A 4RTLA 5K0GA 3UJBA 5ICCA 5EHIA 5LQUA 1R8YA 3ME5A 2NP7A 1HNNA 3EVEA 5CVDA 2AOUA 3HNRA 1RJEA 3NW9A 3R0QA 5LQJA 3LHDA 1AF7A 2B25A 5FA8A 3EMBA 5FUBA 1R6AA 2PX4A 1YZ3A 3HEMA 4BLVA 4RX1A 4F85A 2K4MA 2NXEA 4GOMD 4RWZA 2HTEA 3UJAA 3QOWA 1DL5A 3HCBA 4X1OA 3UJ7A 4RTQA 3H2BA 4RVFA 4DMGA 2P7IA 5IKMA 3NDJA 3P2EA 4A6DA 5HOQA 2CMGA 4C4AA 4PIPA 3M6WA 2G1PA 3EGIA 1YFJA 1RI2A 1ORIA 2JJQA 2PWYA 3I58A 2ZBQA 2NXJA 2Z6AA 1XVAA 4A6EA 4CTKA 5K0NA 1VQ1A 4QTTB 4V0RA 2EJUA 3SXJA 3GXOA 5LQAA 1RI4A 5DTRA 3MAGA 3DUWA 2ZSUA 1R8XA 2YVLA 3P9CA 3GWZA 4FP9A 4ER7A 3LX6A 2UZ4A 4KIFA 1YUBA 3G5LA 1FP1D 5LR6A 4RVHA 1IXKA 2P40A 1D2GA 4IWNA 5E1BA 4QPNA 4YV2A 2ZIEA 3LDFA 3P97A 4MTLA 2QYOA 5DTQA 4RYLA 2OKCA 1YFLA 1ZGAA 2ERCA 3RIEA 2IPXA 3O31A 4LG1A 5DRTA 3EMDA 3FZGA 5HZMA 2BR5A 4C03A 2I62A 5FQNA 3Q7EA 1XDZA 2IH2A 3U81A 3P2KA 3KPYA 1JQEA 5K03A 1F3LA 1R00A 2P7HA 3KQWA 2G8NA 4DF3A 2GA9A 4YUVA 4XUEA 4RTPA 3EPPA 5EMKA 1P39A 5DM4A 4FSDA 2ESRA 1I9GA 4H0NA 3OFJA 5FCDA 1L3BA 2O05A 2PBFA 3NJRA 4ER3A 5IH3A 3P71T 4AZSA 3R6TA 5EG5A 3G5TA 3HA7A 3FUVA 4B17A 4KDCA 4ER6A 3GRUA 2PT6A 4O29A 5DM1A 1P91A 3PTAA 4RTNA 4P7FA 5K05A 4MHTA 4KIGA 4C08A 1KHHA 3FYCA 3TM5A 2G71A 1KXZA 2YUIA 2XYRA 3FPFA 5CIYA 3M4XA 5DM0A 3RW9A 5E9JA 2AOTB 4PGGA 5K0CA 3FTDA 3M70A 4MQ4A 3PVCA 4CXMA 5JUWA 3TR6A 3C0KA 4FSXA 3SM3A 4QDJA 3R3HA 4F86A 1YB2A 4RTJA 3KPJA 3BZBA 2AS0A 4ER5A 5K01A 2AVNA 2UYOA 5DT2A 3OU2A 3QOXA 2YXEA 3DH0A 3MHTA 1H1DA 2ZFUA 4PIMA 2IDKA 5EPEA 1D2HA 5DX1A 2ZZNA 5FTWA 4HTFA 3SSNA 3ER8A 1YZHA 2ONZA 3NDIA 3LKDA 2DULA 1M0EA 4PNEA 2FYTA 5EIFA 1DCTA 3DR5A 3ORHA 4M36A 4FT2A 2FK7A 1X1BA 4YMGA 3LDUA 3NWEA 5DXAA 5GIPE 1ZG3A 1XCJA 3VC1A 3B5IA 4PYKA 2PVCA 2NP6A 3LPMA 1Q0TA 2O06A 4C07A 3LCVB 5GM1A 1O9HA 3UJ9A 1NT2A 2P41A 1PRYA 4QPPA 3IV6A 3KQVA 5DX0A 1O54A 3JWIA 2AN4A 3SSMA 1XCLA 5EEGA 5EVJA 3ERCA 4Z2YA 1QZZA 3LL7A 2OY0A 3QV2A 3OPNA 3FTEA 4PINA 3BWBA 2WA2A 4RVDA 3NTVA 4Y2HA 4KDRA 2JG3A 4FGZA 2G72A 3HM2A 2QY6A 3E7PA 5DRYA 1X1AA 3AXSA 3P9NA 1G60A 3CVOA 3GU3A 2IH5A 2WA1A 4P58A 3ANXA 1KPIA 4BLWA 5KS2A 2WK1A 2IBSA 1L1EA 5DX8A 3NWBA 3MCZA 4E2WA 4QVGA 2UYCA 3EEOA 2HMYB 2A14A 5HIKA 2GH1A 1YF3A 5HFJA 1SUIA 1V39A 1WG8A 2PJDA 5ICFA 3TLJA 4CKBA 4OX9Y 3FRIA 3FPHA 3DLIA 4EKIA 2OB1A 2XYVA 1N7IA 5U4XA 3TOSA 2OPBA 1Y8CA 2PX2A 3EVFA 3HP7A 3MQ2A 4YUYA 1SVUA 3MERA 1WY7A 2OZVA 1UFKA 4V0QA 3DXXA 4HGZA 4X60A 3FUXA 2HNKA 3TKAA 3FUTA 2OXTA 2AR0A 2OBFA 4ER0A 4U7PB 2EJTA 3GCZA 4PCAA 2UYQA 2B3TA 1IM8A 2PLWA 5FHQA 4POOA 5K0FA 3GRRA 2VS1A 3TM4A 4EK9A 2GS9A 3KR0A 4LWOA 3E05A 2ZTHA 3KKZA 4Y30A 4YMHA 3PX3A 4QDKA 3G7UA 3M6VA 5CUQA 3DLCA 5EIWA 1BC5A 1ZQ9A 4GC9A 3BUSA 3ELWA 2KW5A 2YXLA 3BGVA 5FQOA 1ORHA 3CJRA 1L3IA 3HCFA 3HCEA 5FULA 2I6GA 3KPUA 5T67A 1UIRA 2BM9A 2IP2A 4BY9E 5BP7A 4X41A 3K0BA 5T6BA 3CJTA 3I53A 3T0IA 1T43A 1L3CA 2Z6UA 3FYDA 3BXOA 3GO4A 4DM3A 5CCXA 1WS6A 1FJXA 2F8LA 2AOWA 3UWPA 4GQBA 2IIPA 4RVGA 4RTMA 1X1CA 4EQZA 5T64A 4RTOA 3LSTA 1SQFA 2PWPA 1X1DA 3KR9A 1JQ3A 2AOUB 2NXCA 2H00A 3HCCA 4XUDA 4KW7A 2Y1WA 5E1DA 3PT9A 3ID6C 1AV6A 1PJZA 3CJQA 4FR0A 3KQMA 4PYNA 4R8RA 2JH8A 4PYJA 5BW5A 2OYRA 4E33A 2UYHA 1XXLA 3OZTA 4P7KA 3FRHA 2YQZA 4MWZA 3THRA 3NMUF 4M37A 3M33A 4AUKA 4MIKA 2AOTA 1KPGA 5DM2A 2YTZA 3ER9A 4E2XA 2C7OA 3E23A 1BHJA 5EC8A 3I9FA 3BGDA 2VP3A 4IKPA 2ZWVA 3WSTA 2NNWB 2PSSA 1MHTA 5KYGA 1OR8A 2FK8A 3MTEA 1IY9A 2ZW9A 3C6KA 2EG5A 5EMMA 3SX0A 1D2CA 1JSXA 1KYWA 2ADMA 4KRGA 4PWYA 3MCTA 2R6ZA 2I9KA 4LWPA 1JR4A 1SG9A 5E1OA 2PXAA 3ELDA 4M7RA 5E8RA 5E8JA 4AX8A 5LQKA 2HV9A 4YUZA 3HCAA 3OZRA 1G8AA 2AOXA 1JQDA 3JWHA 5ERGB 5K8VA 4R6XA 1EAMA 3HVHA 5E9WA 2PX8A 1RI1A 3DMHA 3IHTA 2ZWAA 2BH2A 3JWJA 4YUXA 4OA5A 1VIDA 3GRZA 4CTJA 2PXXA 5BW4A 3FTFA 3G2PA 3CKKA 4GOLD 1BOOA 2C7PA 3KU1A 2BM8A 3V97A 3FPGA 3LCUA 2Q41A 2B9EA 3MTIA 4PONA 3OFKA 3TPZA 3CBGA 3O4FA 3OE5A 1NW8A 5DTMA 1QAMA 4ZTBA 3JWGA 3FUWA 2IBTA 2XBMA 3G89A 5D1HA 2VDUE 2ZBPA 3DTNA 4X61A 1Z3CA 3K6RA 1I1NA 3OU7A 3A7EA 5DPMA 4DCMA 5ICGA 5CD1A 1EG2A 3KPVA 5KQSA 7MHTA 1L9KA 3TRKA 3GDHA 4FT4A 3UFBA 3C3YA 3BT7A 5CVEA 2GLUA 1F38A 3GGDA 4HRAA 3A7DA 3UJCA 3VYWA 3P8ZA 4YV0A 3KHKA 5HIJA 5F2OA 3D2LA 3KQSA 1JG1A 1Q0SA 2VDWA 1NBHA 3LCCA 4OQDA 4RSRA 4IV0A 4FS8A 1QAQA 1RJFA 5P8WA 4GEKA 5M5BA 3PLAE 2JH9A 5E9QA 4RTSA 1JG2A 3UBTA 1XDSA 4RV9A
chains in the Genus database with same CATH superfamily
3UOWA 1KK3A 2KRKA 2FRDC 2JIOA 4II7A 2BMEA 5EFOA 3TTTA 3HK2A 2D4AA 5FBHA 1C3LA 1OD6A 4ZIRB 3QLUA 1EZ4A 1XTPA 1YAJA 2UVDA 4LIPD 2CLIB 4PZYA 3S2GA 1CUIA 1ELOA 2QPTA 4MS1A 4OL0A 2WV9A 5I51A 4E14A 4WJLA 5H02A 4G4JA 5ECDA 2PKEA 1MB4A 3KCQA 3OQIB 3QU4A 4TMYA 3C3PA 2X77A 5FADA 1OAIA 3F4BA 2V58A 4PYMA 3INTA 4ND8B 5DP2A 3FYUC 1E9BA 3R3WA 1ZM2A 1E3IA 1Y8AA 3C7AA 1W5TA 4XPIB 4ZODA 3LX5A 1TT7A 4HC4A 2QCUA 4AT1A 4OYLA 1HYBA 3RUAA 3GLHB 1T9BA 3CH6A 4C6SA 4Q15A 3TMAA 4AKGA 3GAZA 2GAFA 1US8A 3T95A 1NVMB 4BO1A 1YS1X 4KUHA 1LPSA 1JKJB 1MEEA 3T35A 4K9OA 2HMVA 5J5CA 4HAUA 2A4KA 4HDNA 4D4HA 3VX3A 2OECA 3PA6A 4NBUA 4EGQA 2BP7B 1TYZA 4QPJC 4KR7A 1UAGA 2EZ9A 3MS4A 4IP0A 1XNHA 2DWQA 1AKYA 2AG5A 1ZKMA 2YV5A 1JH8A 1W49A 1W1UA 2XWJI 1TQ8A 2RHTA 1V92A 3DDZX 4P4UA 4N7BA 4YJDA 1XAHA 3TSZA 2P3SA 4L7VA 2LRHA 5IXYA 1EWYA 1V35A 1XYVA 4MV3A 1BIFA 2GXUA 2ECKA 3TFWA 1RTTA 3JRWA 1WDKA 2AOVA 3DMRA 5KDOA 3K8YA 2OO3A 3EAQA 1XCOA 2X3UA 5DOZA 3KOUA 4KIUA 4RY0A 1YE9A 4G3OA 1HTWA 3O4RA 2JCVA 3JAMS 1P3JA 1K4KA 2WZDA 1G2PA 3FMOB 3ORRA 2QRVA 3EG5A 4MHOA 3AESB 3BWYA 3X1YA 1E9SA 2BFPA 3K32A 3B89A 3OE7A 2Z5FA 2YC4C 1LK7A 3S40A 3FNBA 4PYLA 3KXDA 3NB0A 1NM5A 2II6A 1P0QA 3CNOA 5E2BA 4YPOA 3RE8A 1JILA 1OYYA 4BMSA 2GAOA 4D44A 4QA9A 3ZZ0A 1AMOA 1XMXA 1KJ9A 3ZHQA 5ICEA 1CS4C 3GT7A 3KP0E 3KQYA 3BEDA 2XUDA 5BO5A 2QMZA 1VPEA 3PNOA 4WZ6A 5DHPA 1RYFA 3G82C 1ZUWA 2VDOB 3MAAC 1KI7A 3NHWA 4WOBA 3IR6A 1PJRA 3B1WA 2JLQA 3SMQA 1JG3A 1XDUA 4UBIA 2DHRA 3S6JA 1WXFA 4RZXA 4NOLA 4ES6A 1QIJA 4YMLA 4EB8A 1JHPA 3G02A 3I64A 1I32A 3JQ8B 5U4QA 3TLXA 4DWVA 1II8B 1JMVA 4W82A 1TT5B 2X42A 5TQ2A 1MAWA 5GIOE 3Q8XA 4K2AA 1J4AA 1CS0B 4OIFA 4AJJA 1NV9A 1FDSA 5KO3A 4D96A 3S29A 2REQA 1A8QA 3QF7A 3G0BA 3RGSA 3LAWA 5IARA 4BMYA 2GTHA 1CR4A 3DLTA 3DMGA 1MIOA 2FOIA 1WW3A 4HEOA 2XD9A 3TAXA 1HR0M 3A2MA 4F2GA 3E5NA 3P7MA 2JEYA 2DPXA 4H7PA 5FORA 4CKCA 3LHKA 3G8BA 2RKOA 1FX0A 1MN6A 1RABA 4ZPXA 3F2IA 4FDMA 4YI3A 4BUZA 5IDXA 2H08A 2HWUA 1YDWA 2WUVA 5EOVA 3TJMA 2H4XA 5KOHB 2N35A 1ETHA 1N7GA 1VYTA 2ARKA 2B6HA 2HWKA 3AHGA 1N3IA 2DQZA 3KL2A 2IPOA 2O14A 3G85A 3HJAA 3ZI7A 4CNBA 2GEJA 3BD8A 4KN6A 1ZITA 2AJBA 4NK5A 4PPGA 5HFNA 3TXXA 3L5OA 2ID4A 3ZNOA 1X7XA 2WRZA 3USES 2CNOA 1IZ0A 1QK5A 4K3UA 1NR7A 4HDNB 1IL0A 2PSHA 4KVGA 5BMVF 5KJFA 2PT9A 4D7AA 3PWKA 4DDUA 3ZDBA 3SF8B 1WUKS 4YDSA 1J70A 4IJUA 3WA7A 2O5RA 1JPUA 5IM5A 3G2HA 4BJ3A 4G1VA 1TVEA 4IBIA 1CZOA 3QUCA 1V9SA 2I4NA 5E9WA 3O94A 3JWEA 3W5AA 1HDRA 1VCNA 2YINC 1XNRM 3QKRB 4F7DA 1DG1G 2VLIA 4YQEA 3T4PA 5FPYA 5FO1A 3IT0A 3EC2A 4LBVA 4MYUA 4ZGWA 1OKKA 2Y77A 2FPGA 3DBHA 4G5OA 5B1SA 1F2UA 1IG0A 3OOEA 2JGDB 3R3ZA 1J8DA 1J2UA 2EFHB 2B78A 1KJNA 2G77B 1NX6A 2JFZA 3IBFA 4HQNA 3R0ZA 4Q7JA 3DZHA 1X80B 4O6VA 5CCBA 1GZ5A 4LRTA 1U3TA 1SVIA 3IP5A 3WE7A 5B1YA 4YH1A 4BUJA 3IEKA 4CEJB 3QYPA 4KACA 4MUNA 1KQFA 1RRVA 1TKCA 3HCDA 3WLRA 1SQ5A 2FGKA 4Y9SA 5AW5A 1VE9A 3LUFA 5J43A 2V55B 3AF6A 2BI8A 3LQ2A 2XRMA 1K63A 1Z6XA 2V74B 3NAGA 3PNBA 3KT8A 3ICCA 2GWRA 3MVEA 4GQAA 5H1YA 3KL4A 2I7VA 2WLSA 4G5YA 4HGNA 2CD9A 3DL2A 4S24A 4EJ2A 3RT9A 2WVGA 2RH8A 4B3DA 1T6BY 1TCBA 1GNQA 2HRQA 4RD0A 1WHTB 3MJEA 2GBPA 3B9QA 3LBYA 1WLSA 3GDWA 1V1MA 3F5FA 4EDHA 4RYDA 3DLAA 3WMXA 1L4BA 1SVKA 5JMPA 3DQQA 3CR3C 4PGFA 4LHSA 4WCDA 2DZOB 1R0SA 5F64A 1LC3A 4LXIA 2QG9A 3QWAA 4JKOA 4HMOA 2NXEA 2DFTA 3NEYA 3D6MA 2WW8A 3A3NA 4H7KA 2QMEA 4HH1A 1JEEA 1PLKA 4MLCA 5AMXA 3FVVA 4ZI3A 1G4UR 2HX1A 2KYRA 2WJJA 3TZ6A 4QEKA 3WWZA 3IS3A 3RC8A 1F2TB 3A4NA 3GN1A 5IVDA 1DJOA 3X3HA 3ABRB 1ZA1A 1W0KA 4NV1A 3SDZA 2RK6A 3GIDA 4O0MA 4RPGA 1C8VB 4LYDA 1IVNA 1V43A 3VYRB 5KWSA 5DZSA 4LDZA 3D6FA 1EJ2A 3SYTA 3U6MA 2J7PD 2Q1UA 5KYTA 1B3BA 4FOTA 2GK7A 2QL6A 3UHOA 3GLFE 3O84A 4KQGA 3L4JA 5JAHA 4Q66C 3VR5A 2CYBA 1QIMA 2J9FB 3DUWA 3DYBA 3L4SO 3FHCB 5LNK6 4R0NA 5ENZA 3D3EA 3HY5A 2RGCA 3FJOA 3QKWA 2W2KB 5IBCA 1TLTA 3E9MA 1PJ2A 1N92A 1NHWA 3B6KA 4YV2A 2WUEA 3DTTA 3DZFA 1UBUS 5AI4A 4ZN6A 2IVFA 1FEZA 2A8YA 1QVRA 1XALA 1YFLA 2QTZA 3D6NB 4JB3A 3C9PA 5EINA 5DRTA 821PA 2EYQA 3FOZA 1Y8ZA 1KOGA 4IBKA 4Z49A 4AP5A 4MVJH 4C03A 1T6OA 4BFXA 2X76A 1I0LA 4QOEA 2YWFA 2Z2JA 4IEFB 1Q1QA 4X84A 2I3AA 4BQNA 1CYEA 1F3LA 1E3QA 1R00A 4IG9A 1T4CA 1U04A 4GBJA 2WTBA 2X6TA 3G2NA 5FCDA 3PA8A 1IXRC 2WD7A 3KLNA 2WSMA 3B7GA 3IQFA 3UPUA 2VG8A 4XEHA 3H16A 5AJVB 1BTOA 3VZRA 3ZBUA 5E7QA 3INYA 3NASA 2V7BA 4JK3A 2H1OA 1QV9A 1HT1E 5C1DA 1M1UA 1P81A 2JLCA 2ZB8A 4O29A 4XQEA 2SICE 3TZHA 1TEZA 5L4LA 2QYTA 3BJMA 4G5SA 4W1PA 1N8SA 4F21A 2OCBA 2JZ1A 1YNOA 2GHIA 2OSBA 3FPFA 3WK9A 2VSYA 4XFKA 3BILA 4JBWA 1YJXA 3ML1A 3F5DA 4MA4A 3ZHRA 3PNVA 4DBLE 4M6WA 2GCOB 3UFXA 5KVCA 3KXEC 2FPGB 2X86A 1D0LA 1QV7A 1KY3A 4IVPA 4QDJA 3MRXA 1Y81A 3KVVA 4IEEA 3ZR4B 4I4TB 3VMMA 2NMVA 4O2BF 3MWLA 4RTJA 3BZBA 4BNUA 3TBFA 5AVTA 4QNNA 4ER5A 4D25A 4AJOA 3BZUA 5HRAA 1T2FA 1N77A 2VT7A 3DVAB 2TYSB 4LJ6A 1M2GA 3DNPA 1GZ3A 4XWKA 3N8KA 4J0EA 1H5UA 4HB2A 2ONZA 2VDBB 1MX3A 4WDQA 3ZU5A 1DCTA 3X1XA 5L51A 3FZNA 3SF8A 5CFMA 2KB0A 4ZALA 1GTVA 4W5RA 1KZHA 5JJLA 3PHHA 1O6ZA 1TK2A 2I4MA 2VZ0A 1WUJS 3RSGA 1M10A 3EGDA 3WLJA 3LY8A 4I9GA 1ZG3A 1ACMA 2FSPA 1ULZA 2GBLC 2TMKA 3CUWA 3OEHD 3O4IA 4IQ8A 3SY8A 2OG1A 3OQ1A 4N0EA 1TM3E 2WVJA 1S4QA 3JD4A 3KQVA 3JWIA 2EP5A 3HMQA 3T61A 1HQYE 3DBHB 1UWCA 3GRCA 3OM1A 3HY3A 1E2PA 3QV2A 4IDNA 1ODIA 4P17A 1Y6RA 1M7BA 3ZXUB 3N9IA 4XIGS 5LUAA 4PZDA 4YNBA 2AG0A 5FL7A 3TW8B 1Z6TA 1J99A 1RXWA 1T2EA 3A98B 1TC1A 2PL5A 3OA0A 3SSAA 2P11A 2W6JD 3DR3A 3GOHA 1I94B 3D31A 1G60A 1RJWA 4BGUA 1I2MA 3ANXA 4LOAA 5HK8A 2GEFA 3PQDA 3R5XA 2PYZA 3GHHA 1V95A 4EYGA 5D51S 2JDIA 1A9XB 4K0RA 5FX2A 1Z06A 3ZIAA 3GGSA 4NOJA 1OI2A 3QVXA 5DNVA 4G0YA 1MF7A 2A14A 5GKNA 2GH1A 2WQZA 3BE6A 4LF4B 4OLBA 4B33A 2PSDA 1JHOA 3FWPA 3RAJA 1T8PA 5U4XA 3UWMA 1XTUA 1U6JA 4O4JB 4YUYA 1L2DA 4WOCA 4U2KA 2AMLA 3MERA 1QFJA 4D02A 4NRDA 1N0UA 4RVSA 1JQJC 2VQSA 1TZCA 4MDEA 3ANYB 1E0AA 1AUPA 3W1EA 1SK9A 1U1DA 5JVDB 5KJ1A 1FRNA 3BRQA 2XNHA 5JY6A 4S1TA 3VKUA 4GPAA 5SZKB 3ZGLA 2W5UA 1PJLA 1AO3A 2E49A 4F2WA 2MSEB 5EZYA 2ZR8A 1T1IA 1BU8A 1U7UA 4DPMA 3J81k 2G4VA 2GNPA 3OCWA 3EPLA 3ELWA 5TGZA 2E0IA 4DA6A 2H07A 3BCHA 1HE2A 2ODWA 4MAAA 3RFXA 3H13A 1ORDA 3MRTA 3JQ7A 5FULA 2I6GA 3Q40A 2Q5LA 3CEHA 4X92A 5IABA 4MQFA 1J9GA 2W8ZA 4HDAA 4BFZA 1Z13A 4YUAA 2REQB 4WD3A 5D00A 2SKCA 3QELA 4OUDB 1ZK4A 1CS0A 4J4TA 4QARA 4DM3A 2F8TA 2OGWA 1NQUA 2O48X 4CGYA 1EUDB 3T3NA 1WEKA 4EQZA 1ILEA 7REQB 5ITVA 1MVOA 4IDDA 4ZQCB 1YRQA 3AHJA 4IGEA 3SC4A 5KYWB 1AZLA 1V47A 1W5FA 3QXHA 4KT0F 2DQSA 2G0AA 2WJGA 3CJQA 5L95A 2QD5A 2Z2XA 1KMMA 1U2TA 2GFIA 3TIVA 1R0ZA 2ACKA 3KEGA 1ZJ5A 2IF0A 2P30A 4QDXA 2X2EA 3E9DA 1A97A 2VCYA 4UZEA 2WIGA 3H8WA 2YWGA 1CZRA 3G79A 4EB0A 1DAKA 4N76A 1OR8A 5JRZA 5EE1A 4L8YA 2JLUA 4QU0A 3EY4A 2I4RA 1U8UA 4DRXB 3GAAA 5F7OA 3COZA 1FLDA 1PVVA 2OWEA 2R6ZA 3T5TA 4DUGA 2FEPA 4C76A 4TGLA 3BDVA 3UT6A 4Q3CA 4JOCA 3VKHA 3IO3A 4YK7A 4NXNB 2CVOA 4NNJA 3M0EA 2L18A 4IIHA 4LNHA 4AXBA 4CT5A 1DKMA 1EFVB 3AYXB 1P4HA 2HNAA 4FZRA 3SC3A 4LJYA 5AVJA 5JQGF 1OXKB 2OBBA 3DUFB 2PMEA 1KYQA 4Q6BA 4DIEA 2RD2A 2HHHB 1PGOA 3UCFA 1XDBA 4GP9A 3Q9NA 4DIDA 4U6SA 2KBEA 4O2RA 1ZS9A 3CWCA 1EGVB 1EUZA 4FDAA 5E7MA 2XUAA 2XFSA 1K0FA 3BA1A 1Q12A 2PUWA 2BM8A 2RAUA 3VR3D 3FPGA 3PL1A 5HE9A 3L6CA 3P2JA 5LC1A 4J3NA 3MTIA 5H16A 2C0CA 4ECEA 1BHSA 1K2VN 2WNIA 1P2VA 1QG4A 2BRUC 2WG2A 1W4RA 2HA2A 4BLCA 1BFDA 4YRRA 3SHWA 2VDUE 2XQVA 2XZLA 4O59O 2Z57A 3UAYA 2LNDA 1NF2A 3FWZA 1P2BA 4TZ6A 1OASA 1E5XA 7YASA 2AGVA 2GO1A 4DRYA 2FUG1 3EUWA 3GEBA 1HWYA 1W35A 3KSZO 4LQLA 1CF2O 1ONSA 3TRKA 3TW4A 2QRKA 5CVEA 4KH0A 2VYNA 2VDLB 2CL0X 1J0XO 1OV6A 1QE5A 5F12A 3WHPA 2DSTA 4YECA 5F23A 1SXJC 1WPGA 1Q77A 5D3MB 4IVQA 1EHIA 5AP9A 4OHOA 4ZCPA 3WLAA 3RSSA 3S2IA 4K1XA 5B6JA 5K3OA 1TA4A 3DKKA 2PBRA 4L50A 4IV0A 4OP2A 3C97A 4FS8A 5BN3B 2V6IA 2ECPA 3L41A 4JKYA 3J7AS 1K9SA 1YR6A 3NBYC 3IALA 4U7HA 1LJLA 2ZJ0A 2WSSA 4XKJA 4CHGA 4P16A 4FOPA 4R9SA 3W04A 4CQMD 4DV5B 1XU7A 1BD4A 3EVBA 4TKVB 2V6ZM 1IN4A 3DEIA 1MTZA 2AHRA 3NOQA 4QBHA 5FOTA 3RT1A 3LTNC 4GITA 4TMZA 4BP9A 3DHWC 4I5IA 1PAUA 4OQZA 5AO9A 3N0WA 5IVIA 3AERA 4W99A 3TEJA 2Q21A 2L82A 4X63A 4HO1X 4RPJA 1KS2A 2F6RA 5HG0A 1IY1A 1XVVA 1LLDA 3FPBA 2CDRA 1NQTA 1TEXA 1QHIA 3PC6A 1U1GA 4NOKA 3F3MA 1ZKDA 4BIIA 3TXYA 4KQ6A 1FBNA 3EVGA 4U2FA 5K0BA 3S1SA 2K7ZA 4YCCA 4B6SA 1NUSA 1D0VA 3ZDCA 1K7XB 1KERA 4QTZA 3S2FA 3L7IA 4L4SA 1QAOA 1P74A 1V7QA 3GYGA 4L5IA 1TM5E 2XSZD 3DCIA 1LK5A 4RE6A 4KE7A 4R81A 1Q50A 2J9FA 2GESA 3I9KA 4RXTA 4UC0A 3RHFA 3IXLA 4XQCA 4B4WA 1HETA 4JI1B 1U4NA 2PUCA 4I9NA 4IH1A 4DMKA 4GR4A 1DU4A 2AUMA 1FQKA 4CNQA 1DWQA 1WXIA 1CSEE 1ESCA 2H7CA 3DOJA 3H5LA 4QRDA 3C98A 4JC5A 3VKVA 2JZOA 2ZUSA 5K3FA 3LY7A 4X8LA 1N5LA 4OU4A 2ZDGA 4GRDA 1NVFA 2V5AA 1VSTA 1I3OA 1VI2A 1Q19A 3ZWDA 1VL5A 2L2DA 1V8FA 4M21A 4UTNA 1UK6A 3GEGA 3GRVA 3K20A 1ZGJA 2FZEA 4GZ6A 4KK4A 1K5DA 2O8BB 4MM3B 1XKQA 4R54A 4BAUA 3NHRA 4NCXA 3H2ZA 3VR5H 1VLZA 2Y3IA 2YWHA 5BYBA 4W5HA 4FWTA 3TSYA 3ZHOA 1RNLA 4DUYM 3SHGB 3EVAA 4UDOA 3W2GA 2VHXA 4U8HA 3GQBB 2WIFA 2LCIA 4AVYA 3T9CA 5BQOA 3DE7X 2R4JA 1DQZA 1JDUA 1VG0B 2QMOA 4N48A 1CC1S 1NYQA 2F00A 2XBLA 3E3AA 4CHTA 1FP4A 3AJDA 4HWPA 1WR8A 4MB2A 3RROA 5CYGA 1O0SA 3A4LA 2V8BA 3RDPA 3OKPA 2JLVA 4HX5A 4F1WA 2Z8XA 1NBEA 1AXRA 2B0CA 2WYUA 3SVLA 3HVKA 1MFPA 3Q8LA 4X1IB 2BBTA 3MWKA 4KHPB 4DR4M 1CV2A 1FS5A 2B8EA 3HSYA 2O3JA 3OCYA 2H48A 2IHTA 4MUYA 5B4TA 1T9CA 2C83A 3F67A 4LZNA 1GA4A 5I7RA 5KI6A 3EXEB 4CMIB 5C5EA 3HJQA 4OX9M 1GTSA 2JB9A 4J0FA 1SZJG 2R79A 3G9XA 2ZZKA 2D59A 3HKBA 3PJEA 4R1NA 4YV7A 2PX0A 4N41A 2EF0A 2VJCA 3T3HA 3GWGA 2YZGA 3EIUA 1W581 5BR8M 1KEWA 1IUOA 2XD4A 4RVNA 4BPRA 4DMRA 5JCOC 4Q37A 3SICE 4PLGA 4MWSA 2HEGA 3ZX4A 3IYLW 3ZVLA 2NUBA 3RK4A 5BNIA 4L16A 2H06A 4P3NA 4WXYB 4ARZB 2D1TA 2YFQA 4WJKB 2NU8B 1ABBA 4L4UA 1IPHA 3H1AA 3FUUA 4JXJA 3NWLA 2HHAA 4Q9KA 3NAQA 3SYRA 1T2VA 1F7UA 1JBQA 1PJTA 1GZSA 2A58A 3VJKA 1WKCA 3I5UA 3UANA 2V1UA 3I4VA 2GN2A 4E5SA 1H94A 2RJ3A 4HH3C 3R8CA 2IPMA 4XYBA 3D8BA 4ZAGA 5HUHA 4OTZA 3H1GA 4FDTA 4B4UA 1MC4A 5L3SA 1O6FA 1U2PA 3C1AA 4PVDA 5J23A 4RD3A 4R1OA 3K8ZA 4ZVLA 3LT2A 1W4LA 1OI4A 2WT8A 4ZA2A 5JSYA 3HXOA 1OWOA 4CTOA 4M99A 1V3UA 1X0XA 5BSFA 3OIUA 3VR5D 5B7GA 2L6OA 4MLZA 1DKPA 1GPJA 3QVMA 2Y1EA 1QYRA 2CHUA 3C16C 1X19A 3KKPA 5AJWA 2IHNA 2ZYVX 2FCAA 3EY9A 1LDMA 4RK6A 3AVQA 5TJ9A 1L7DA 3HCOA 3LW5F 3T7KA 5LWQA 2PANA 3JQRA 4MUGA 1R5LA 3EIWA 1XZDA 3LFUA 3OBBA 3OH8A 4UCWA 2E7ZA 5G4KB 1UXJA 4R9UC 2WHXA 1QK4A 3L7JA 3MLEA 2V6JA 4NE7A 4CM9A 2JBAA 5G0TA 1BVSA 2ETVA 4M7WA 2DKNA 1NVUQ 1S01A 2GPTA 3BWXA 2QOEA 3A9WA 3U4IA 2NXNA 1DXQA 1QLWA 5LB4A 2QRJA 1NI3A 1ZHOA 3VNVA 5DFAA 1AHNA 3LPAA 3P52A 1TCUA 1Q16A 4BNKA 3D6AA 2QENA 4K9SA 3U1TA 4IICA 2X1MA 1LBSA 2C5BA 3IT1A 3KELA 3KFVA 4GR9A 5EJCA 3PFHA 4R84A 5EP3A 3KB1A 3RC7A 2BFNA 3E2MA 4GLLA 2CB9A 2P9EA 5GV7A 4C4PA 1ITZA 1W87A 4MKHA 4OV6B 3GEHA 2WD9A 4LYFA 4G5XA 3OP1A 3VOTA 4IBFA 1H69A 1VZ3A 1KY2A 2CXOA 2ZSFA 3LOPA 5DBEX 4A3SA 4FLMA 1VKZA 1HQCA 1AQIA 2BMDA 3X1WA 2IL1A 3U0VA 1TAGA 2OV4A 5ELXA 2IHKA 1FF9A 1BXGB 2A94A 4NICA 2APLA 4R6WA 2CLOB 3BGOS 2R8OA 4RMJA 1H0RA 3HB7A 2I71A 4K6MA 1JR3D 2C0QA 3AU9A 3D5QA 3L6BA 4LJKA 3ZY3A 5KPDA 1K5GA 2ZIFA 4IVRA 1C4XA 3M3HA 3OQBA 1VHWA 4E5PA 2FUEA 4NAHA 2O01F 5LQUA 4OXXA 1NXVA 2FW0A 1WWKA 1RM3A 2J32A 5JO9A 1MV8A 2O8EB 1G8PA 4RSMA 1TGYA 3K72B 4NSRA 4WLUA 3E9RA 1LBEA 5BSGA 4IMRA 4UTZA 5ALMA 3MPUA 3T34A 1RE1A 4CFSA 4UAJA 2QSUA 2ZTVA 3ZV3A 4RO0A 5BSWA 2IYSA 1GR0A 4X8HA 3ZCXA 1VE1A 1EUCA 4NJMA 1IONA 2QAIA 4M46A 2GX6A 1Z4JA 4UNIA 4Z8YA 1D9XA 3ZG6A 1QU2A 1SB8A 2QUIA 4IDEA 3QXXA 3RABA 3UJNA 2ZJ2A 1FU4A 3WK5A 1PQYA 2HMSA 1GQSA 2VHYA 4G5RA 1UBOS 3F49S 1PGQA 1M7GA 1CP2A 1U3DA 2AIRA 4FQ7A 3VAAA 2PZBA 1W36C 1GPWB 5DTRA 2HQ1A 3A6JA 3EAFA 4RF3A 3ZWVA 4BKUA 3GWZA 2X58A 4CV0A 5IJ9B 3JQFC 1XB2A 4GGOA 4BKPA 3E4CA 3EG9B 4EABA 1BGWA 3OHSX 4I6JA 5CA0B 1I7QB 2XKBA 3VSCA 5LFAA 4CIXA 1WVGA 2H4HA 3KAQA 5KOJB 4LXUA 1S4MA 3IAEA 5JCOA 2EWVA 3VJRA 2YIDA 1X86B 6NULA 1ZLYA 4II3A 3HP1A 3B1VA 2XMGA 3Q7PA 3OO1A 1EEXB 5DASA 4PHFA 4WUVA 3WLEA 1NN0A 5F5LA 4LI3X 4BBPA 2HIAA 3P5SA 3UPTA 4X54A 3SK0A 1D4FA 2PWBA 3DWFA 1TM1E 2I62A 3GEPA 3JY6A 1IN6A 4HNVA 3E4RA 3EGDB 4HDSA 1JQEA 2X19A 4XWTA 3WKDA 2HJRA 2NVUA 3EH2A 2GA9A 3RVQA 1FRQA 2QZJA 3D4PA 3UENA 2YOFA 4MQLA 1Z0ZA 1W5BA 1IN5A 1FRVA 4RVOA 2WU4A 4HRXA 3OCUA 4PG6A 4V03A 1BRTA 4TSFD 1USGA 5E9AA 4WLVA 2LVPC 4EGFA 1TM4E 1SZDA 3G5TA 4ZOQI 2NZJA 3IHWA 5HKAA 2B92A 1U6IA 2O3RA 3OLCX 4X9XA 5FF9A 4J43A 3OEEA 4ERXA 1XO1A 1JFLA 1XCMA 1IC6A 1X8LA 3DDOA 3FB4A 5LZ5A 3WB1A 2JLYA 3L6UA 1I6LA 2GF9A 4MGKE 2M5ZA 1UINA 2IE8A 3PNQA 4J8PA 3H84A 4RCYA 5DM0A 2PMWB 1A9OA 1D6JA 2PZEA 4GWGA 4JJ4A 1ZVKA 4WLEA 1DFIA 3AERB 2D1QA 1M2KA 2P0EA 2R7KA 1E5TA 1LW6E 2O7QA 2QI9F 3LCJA 4FE4A 3STYA 2JH3A 3W1VA 4ZEMA 1NF8A 3PUYA 2WJ6A 3OIFA 5A4DA 1THZA 1SOUA 4LC1A 4MX8A 2DPYA 4X6YA 2PR7A 4GI7A 4J16C 1BN7A 4ZREA 5CM8B 3KTDA 3TL3A 5I7VA 1LH0A 3BGWA 1HG1A 4MW6A 5CCDA 1NXXA 1XA3A 2ZZNA 4L85A 3AV3A 3ER9A 3ZKWB 3LCMA 3SG0A 2V65A 3EXHC 2X8LA 3EA5A 4M36A 1EFLA 4FT2A 5DGCA 5LIPA 3O8CA 2GPJA 3MS2A 4E08A 4LJRA 1VMKA 3DV0A 3KVNA 2VSQA 4DXDA 1GZUA 5FP0A 1ONNA 1U7ZA 3KE8A 1A71A 3V2HA 5AW1A 1TVKB 2Q3MA 2H18A 3NIFB 4GPZA 4HJXA 1VI6A 2PDAA 3B1ZA 2OL4A 5TMEA 2PEYA 2ZIAA 4Q1CA 3I9NA 5JC8A 1IWPB 4Z2YA 2CLEB 3EZ7A 4TXMA 2Q5HA 4OLFA 1JZQA 3M5DA 3CONA 3FTEA 1J1IA 1MXHA 1Z12A 3DEKA 4OL9A 5IDQA 4L1KA 3L4EA 4NQZA 4ZQFA 3QUBA 4XXHA 2ENUA 4BEJA 1KAMA 1EK1A 2BMJA 3VYSB 3COYA 3JRXA 1T5HX 1JHDA 2BTOA 3PSAA 4GM0A 2G1UA 1CUCA 1EWRA 4KQMA 4AQDA 5JXWA 1JDBB 1O9BA 3BB4A 5T7BA 1KA9H 2WHEA 1X7XB 1SQSA 3PNKA 4QULA 3V7FA 1P8AA 2GXQA 3H5NA 1UANA 1IE3A 4CQMA 1EUQA 1WETA 2C98A 4NULA 2R1VB 3IOBA 2PJDA 3CB4A 1SBQA 4XQGA 1SCIA 1SBTA 2Y05A 4QPDA 3GY0A 5ITTA 3PCTA 3PTLA 1IVSA 1Y89A 1KJIA 1SVUA 1GAJA 3ILSA 2GFQA 3HKEB 3CZ9A 3KOZA 1E18A 1GEGA 1Z0UA 2OCDA 3VO9A 3L4BA 3PQ2A 3SEQA 1SKUA 1W29A 2C8VA 2RC5A 2VS1A 2OWDA 3ESQA 2GS9A 4MQEB 3RRMA 2UUPA 3SQOA 4DAEA 1HMPA 1SK8A 4H0CA 1F2UB 4Q1BA 1OMOA 4BNZA 3MD0A 2PQ6A 2XUJA 3WBBA 2OLJA 4O2BA 4BEBA 5BW8A 2P9HA 5CRIA 4TROA 1FVFA 4G09A 1P45A 2KW5A 1I2BA 3BGVA 1JG7A 2X4DA 1JHMA 1UDCA 1WB6A 2ZS8A 3LLCA 2FE4A 1JQLB 4LRQA 4OB8A 5FQOA 4BFTA 4YAUA 3OHMA 2VBFA 2IJGX 1ECFA 5T67A 1GQRA 2BM9A 3EW9A 4INOA 3RSZA 5COQA 3QFCA 4F8YA 5L3QB 3MT9A 4C2TA 5T6BA 4BB6A 5JZVA 3M9LA 1Z47A 1GO2A 1JPNA 2G82A 2VRWA 3HVUA 1U5CA 3L8FA 1U2QA 4X3CA 4ZAXA 5GOTA 4LFCB 4EEXA 3THXA 3EODA 4KNYA 3ZZTA 3CG0A 4KKVA 3ZDDA 3PC3A 4J1TC 3WYEA 1XQWA 2I1QA 2NXCA 1W0JA 2NO1A 3ID6C 2VPYA 1G291 1T5BA 5H3LA 1WZCA 5BW5A 2Y4NA 1M6NA 2WUDA 4DB2A 1XXLA 1P0PA 2NTEA 4IVNA 1SU4A 4MOWA 1RZRA 2E2WA 4TRRA 4XJVA 1ZI8A 2L0XA 3A1UA 3FI9A 4HEA6 1Q0QA 1AUAA 5KKCA 2DUWA 1IZ7A 4G0OA 4D8XA 5JAUA 2XNDA 3IXQA 4RFSB 5ALGA 1TQDA 4BO7A 2JZCA 1CDEA 1RBZA 4Z53A 3C5EA 3BWEA 1SPXA 1WABA 1X7YB 3NATA 4J7UA 1VLVA 5E8JA 4OD0A 3A28A 2WI8A 1HH4A 3OZRA 2EZ8A 1KFKB 1QQAA 1LLUA 4FK8A 3GDGA 4P34A 1CNEA 2GYYA 1ECCA 3PYLA 1FX1A 3HVHA 1XKXA 2V7UA 1MO4A 2FLKA 1VJTA 3OT1A 4RENA 2NSYA 2X8JB 3BN3A 4YO7A 1UZUA 1KQPA 5HGXA 2D8MA 4QG3A 3CKKA 2C7PA 4GPD1 3U61A 3GPYA 5TT1A 3GCGA 3M6AA 3GFVA 3FBWA 4F5YA 3E22B 3KJXA 1NF9A 3I6IA 3QPBA 4LX0A 3SI7A 3OFKA 4FE3A 4BOYA 4DSAA 1NQOA 3GUVA 1JAHA 4JI5B 3H83A 3KUCA 3DYIA 1LZKA 3P9PA 1KE2A 1P1JA 1W19A 3AHIA 2F5NA 3NNSA 5CXQA 3T52A 4EF4A 2ZBPA 5B55A 2I6XA 1YS9A 2AZMA 2DCUA 1C9YA 2C7GA 2FSIA 3K6RA 4KZPA 4EPXA 3DF7A 3LOQA 5JSZB 1U1IA 1EZ1A 2GZHA 3H18A 3TBHA 3JATB 4A36A 3KJNA 3H5RA 3PCXA 5CA1B 2ZVDA 3MWYW 1R50A 2QMQA 1H9CA 4YO8A 1GABA 1FSGA 1JJAA 1E8MA 1N75A 1T2CA 4FYXA 4DQUA 1AA6A 2H1LA 2ZETA 4G1FA 3A6GA 3F78A 1NVGA 5LBTA 4XD2A 2GD1O 4W8HA 4ZJUA 1QDRA 1PZFA 5IYZF 1QR2A 2CD7A 2R44A 4OMUA 1KRHA 3ES9A 2HL7A 1XMQM 2I7PA 1RWXA 3AK4A 4ZDKA 4PPQA 5J2TB 5TY0A 1N1DA 1V7CA 2VNSA 3OPMA 3GO8A 3PITA 2UUBM 1W48A 4RV9A 4F2DA 2QHXA 2HIHA 2CLHB 4RHYA 3NFRA 4HMQA 4N39A 5JZSA 4CG3A 2NPIA 1DAHA 1Z36A 2HXSA 5JZBA 2REBA 3IDOA 3VM6A 2OXEA 2BTEA 1UUFA 2OPHA 1E1CB 1L7OA 4C0WA 4XB6B 5FA5A 2EL7A 2FZGA 7ABPA 1GWNA 3LBNA 2GEDA 4R1TA 2DG2A 4DJ5X 1NSYA 5EIEA 1FJHA 3TN7A 1CT9A 1EK5A 3O2QB 4MDYA 2GOYA 2WMDA 4O63O 3C6ZA 5ECGC 1JQ5A 1NVWQ 2XITA 4P2BA 4LY3A 4IL5A 2JHFA 4FGLA 4KG7A 4KVAA 2ATVA 4PGHA 1ZOSA 4U7TB 4DPKA 2FSHA 2ZIVB 1FBTA 2VUUA 4U3JA 1WO8A 5JSQA 5L9AA 1KRXA 2OHGA 3W79A 1WSWA 1BE0A 3G6KA 4H3HB 3D8NA 4RM2A 1QIDA 3BWMA 1HNXM 3RFCA 4FYWA 5A4IS 5IJXA 1Y9EA 5HR5A 1KNQA 1Y6QA 1WUHS 1TTHA 1J22A 1F1JA 1AX9A 2FWJA 5CFPA 1MEJA 3AR3A 421PA 4L5CA 1NOJA 1SU7A 3HRHA 4KE8A 1VPVA 1T6YA 2J5KA 4RK4A 3VDNB 1AY0A 2G07A 2WQ7A 1EX1A 3CC8A 3IAXA 2I87A 2OHFA 2HHCA 2UDPA 1TZJA 4C2UA 1V0JA 3AFOA 1XNJA 2FJPA 2GSDA 3CZ5A 4XDHA 5CX1B 3THWB 4F5EA 2EX0A 1H2RS 3AFIA 4X7PA 4ENUA 5HK9A 4LZZA 1EGMB 3PP8A 1UM9B 1WTAA 4MV9A 5AVWA 4ZPJA 1EXVA 4JLAA 4MUFA 3NH6A 3D1LA 2ZAMA 1Z29A 1YDGA 4LDQA 1PR1A 1LDGA 5DBGA 1B0UA 3SS7X 2RGRA 3P9IA 2J45A 5LQRA 1SUWA 3IURA 4P08A 1GGJA 5KYUA 1J0BA 1XCPA 5A3QA 2ES4A 3PUJA 1HC7A 3DXZA 1H8HD 1ONOA 3A6EA 2P2SA 2PGIA 3AYZB 4TL6A 1DOZA 4IHJA 1GG9A 1NXQA 1QTQA 1EFRD 1GAQA 2N47A 4QQFA 3B1JA 3MJCA 1XCBA 3Q72A 4UHJA 1MORA 1YIDA 1ENYA 1NA5A 1C9EA 3R9XB 1JVNA 2VC2B 2NYAA 4IH4A 5E6SA 3THSA 3EVTA 2CWDA 2IWHA 1Z6GA 2IU0A 1A9PA 5JVDA 5IK2D 3H6GA 5TJHA 1G21B 3TAUA 1E1DA 4R01A 2DLDA 2EBFX 3HJBA 3ZCBB 2AC2A 3MMPA 3QFRA 2DVWB 5AVZA 4NY1A 3T7RA 1ZK1A 3BPSA 4GGMX 2A78A 3VKFA 1TH2A 2YHIA 4Q03A 5J59A 1JHZA 4ZRNA 2P9JA 3T3MB 1ZDMA 1JDVA 1NW5A 3SKXA 5ITZB 2W7TA 4H7HA 4CISA 4QU8A 2QTCA 4WKNA 4BTEA 1RLMA 3NHPA 2ADOA 5C80A 3BWDD 4CGYB 5JECA 4QSMA 3UTCA 4E1BA 2ZBDA 2I29A 3HRIA 3OPQA 3S7TA 1ZESA 4OFBA 2BEVA 2BKLA 2Z95A 4NDAA 1JBKA 1TYAE 4R2LA 2I54A 3ESBA 3X44A 4J16A 3DOUA 4BNDB 5THKA 5BRJA 1QF7A 2PQMA 1INLA 1EWQA 4XVQA 3OAAA 2FSGA 2PZJA 4UQLA 3IVCA 4O4IB 5JR3A 4TT3D 4BFWA 2QORA 4DR7B 2I22A 3EF1A 1P5FA 3JTEA 3FNIA 1NPDA 1GUBA 4M4SA 1DXHA 4UHKA 2A35A 4H1UA 1J39A 2BUCA 2GTIA 3EFOB 1WP4A 3FF1A 1JTEA 4WNAB 3ZD7A 2VJQA 1U80A 4HXFB 1DIRA 1GO5A 1P2GA 2W4QA 3M4NA 3NVDA 4K9PA 4WNCA 4QHTA 1CQXA 4UU7A 4QLBA 2R0QC 1W46A 3U1BA 5D86A 3ECAA 1RJ9B 2ZUBA 4RV5A 1VPTA 4I4LA 1Z38A 3AEKB 3T3DA 4RHUA 4EF5A 2Z6QA 4TYQA 1ZH4A 5AOCA 3FPAA 2QTAA 2JJ2D 4KN8A 5ARCA 5BVGA 1VBMA 4ZV9A 4EY7A 5F9MA 4H0FA 1VFPA 1UXIA 1Y98A 1CHDA 1SVNA 1UK9A 3LPNA 2CL6X 3I1FA 1KQNA 1QRUA 3GPIA 1X77A 3LVFO 3G2IA 1E6EA 3U6LA 2GZSA 2X41A 3BXGA 3ILYA 2HWWA 4L0QA 1ESZA 4LHEA 3E48A 4PG4A 5FHRA 4KDEA 2IRWA 1NBIA 3NBXX 3HHEA 1ZH2A 2GLTA 5ITQA 1FRFS 2UYYA 4EUEA 2RI1A 4O2BB 3DF9A 3QLTA 3I34X 3L1HA 4H35A 3WLNA 4LXHA 1K68A 2JJYA 2X9GA 3LZCA 3RU3A 3RYFB 5IASA 3RS8A 3CW2A 1D3AA 4YLGA 1UWVA 2WU0A 3OOYA 4BCCA 1XIVA 1ZXXA 2KI5A 1E1NA 1GZ4A 4LZWA 5GONB 2K0BX 3QXJA 3WGYA 5AK5A 4YP9A 3ZZMA 1AF4A 4IOLA 5IC4A 2RGWA 5EVCA 3CZ4A 5FWDA 4LFAB 1XFAA 4ZAFA 3ROXA 1ABEA 3UCXA 4F12A 4KEAA 3H5VA 3HJGA 2BMVA 1NOIA 4OHXA 3WQRA 5BQ5A 3ENQA 5KAPA 3P9YA 3S70A 1OXBB 1CUVA 2O3UA 3IEIA 4DNQA 3KJIA 3HEBA 5HILA 1G64A 5FSWA 1T36B 1MABB 3A31A 3RQIA 2JIDA 3R40A 4B09A 1JPJA 3BB3A 2IHZA 3VDRA 4RK5A 3R7DA 2IEAA 1AT1A 1XKTA 4CF5A 3RIHA 1N34M 1NDHA 4PO3X 2ZE5A 3HDTA 4KWEA 1WZUA 2CXRA 1OJLA 2HTEA 3GFFA 3LIIA 1Q0LA 4KE9A 2KX7A 3QWBA 5ITXE 4QELA 1RLIA 2P79A 1KEKA 1TTPB 1PR6A 4HWTA 4IXDA 5G41A 4C87A 4E5KA 5AW9A 2UAGA 4CMCA 4PBRA 4MR9A 1IMJA 2JP7A 2UV8A 1QO7A 4G4RA 2JJQA 3H2SA 1E3SA 1SVWA 2RGXA 1B43A 4MEBA 4A5SA 4B83A 4CKEB 4UATA 2M6LA 4BWGA 1PJIA 7GPBA 1RBYA 3BE5A 1EFRA 2VKTA 4R2MA 4PAWA 5F2EA 3QEKA 3S5UA 1U8FO 3RYIA 8ATCA 2RGAA 1KZ7B 3D3WA 4RQBA 4BWYA 2EKLA 2J7KA 3A9VA 3OOSA 4B3TB 4JYPA 4LE2A 1CR6A 1SVOA 3A10A 2OUKA 1N6RA 3FTQA 2FHSA 1YUBA 4HAVA 1E94E 2IPNA 2NT3A 3BH7A 2GFHA 3N0TA 1C1DA 2PT5A 3DFKA 3VV2A 5EMHA 5JCJA 1KFEB 4QPNA 4RDHA 4YEDA 2Y20A 1GGVA 1Z18A 3URMA 2PUEA 3FLEA 3FW1A 2PJZA 4LSGA 4XRGA 4HVTA 4X1IA 2Y1OA 4FDUA 4BZPA 2IPXA 1JR2A 2EFDB 3GG2A 3HADA 4LG1A 4PWZA 2P9CA 2H8GA 4H1TA 5HZMA 1BWRA 4G41A 1CZUA 2O5EA 1C3OB 1M8KA 4EAQA 2WKSA 4N8EA 3Q7EA 3AETB 4OI2A 3W6OA 2GBCA 1L5HA 1JKIA 1IBRA 1H8ED 2P7HA 4EKNB 2BC9A 4RKEA 3IQIX 1AA9A 1HFKA 5ILGA 4F97A 4FSDA 2ESRA 3H99A 1U2DA 3U4QA 2ZS9A 2R5FA 4ILKA 5DHAA 1X7GA 2QPOA 2W2MA 3P71T 4M83A 1ES9A 5EG5A 4W8GA 1FVOA 1F1BA 3D0OA 3P9RA 3KKNA 3WLQA 3DXFA 4FIZA 2D5BA 5DU2A 3C3KA 5CB4F 2CXTA 2X6RA 3PFFA 4MGIE 1YAHA 4DA9A 2WIDA 3P96A 2ZRDA 1Y1PA 1KXZA 3KYDA 3PEWA 3KP1A 4QFDA 1LTHR 1S3FA 4LGMA 1ZH6A 3EDCA 3UK7A 3KP1E 1Y0BA 4G65A 1L4FA 2H16A 3VH2A 4D4KA 2VF8A 3LT0A 3TR6A 5IFKA 1A0OA 1WHSA 3QI7A 3SM3A 4Z54A 3IIKA 3S81A 3IHPA 1WBJB 3SHTA 2J1LA 4BVGA 4Y67A 3RG8A 1SXPA 3EN0A 3CLSD 4GOXA 1JAIA 1OJ7A 4FQ8A 4JXXA 2E1PA 3ONDA 1FRZA 4JELA 4R31A 5K6RA 1H1DA 2JI8A 4JUAA 3QFSA 1Z7YA 4D9IA 5FTWA 3ZH2A 2XRZA 4CEIB 3JRNA 3DE6X 3B51X 4CF7A 5EIFA 3EMVA 4HLUA 2WFAA 3DP9A 3A8TA 5JQGB 3OD5A 3G0IA 4AG6A 2FK7A 4L2IB 4BFSA 5ICSA 4Z9XA 1L1ZA 4B44A 3IBYA 1A9YA 3PC2A 4WCFC 1XCJA 4CZ2A 3ENNA 2JFNA 1TECE 1P61B 2NG1A 1PFYA 4K6FA 4M0CA 4P1ZA 4CR7A 5ALQA 5K20A 4CM8A 5C3UA 3Q7TA 4UU1A 4P3OA 2GJKA 2HF9A 1T36A 2AN4A 2QQGA 2F4VM 2VQDA 3PNMA 5EEGA 4TKVA 4IXMA 2V3CC 1YOVB 4LF6M 2JZ0A 1B8UA 3M1AA 1UKAA 1CUGA 2YZMA 4M9QA 4NU5A 4BBAA 3FF4A 3HABA 3MC1A 3LE8A 3HGIA 1VKRA 1C7YA 4L76A 1PJJA 2CVPA 2C20A 1MB2A 3FDZB 3G7NA 2QDXA 4ENWA 5TT0A 2BSAA 521PA 3I92A 2Y8EA 2B1GA 3VPXA 1PIWA 3NI2A 2B2XA 4BC0A 1JW9B 5LMUB 4UQOA 4D9MA 1B6GA 4KYUA 2I76A 3BHIA 4EY4A 1Y5NA 1AE1A 3BXFA 3SIXA 1QHNA 1DFGA 3JQFA 4G5QA 4YROA 3EEOA 2QR2A 4DMUB 4KOEC 4D82A 1VIMA 2JFVA 3NWJA 2XPCA 4R5MA 2XTAA 1G2QA 2OQVA 5B6IA 2ZYDA 3Q41A 3T41A 1SZCA 4BN5A 4EFLA 4B80A 1E6CA 2G1AA 2FMIA 2OCYC 1Y7TA 1OLXB 2XI4A 5LMUM 3IOEA 5LYJB 2B30A 2FTKE 1U6KA 1YIAA 2BEVB 3I2KA 5LMNB 5CFOA 5LSAA 3FKQA 4OB7A 5DTJA 2HCBA 2PZKA 1BXRB 2OV6A 2XCQA 5EMNA 2VEDA 3PD7A 2EQAA 4WHMA 4MJLA 4UQPA 4A16A 3AGPA 3LSYA 4Y6GB 6PFKA 1HE5A 3GEEA 4XE5A 2QD1A 2A9OA 3I73A 5TMPA 3ONVA 3BUSA 1XZHA 1HM5A 4KWTA 2ANBA 2CDAA 3ANMA 2JJ2A 2YFKA 4IO1A 4CR8A 4ZYVA 2YOGA 2GKGA 1XRRA 1HRKA 3ZE6A 3CBQA 3GVHA 5ALKA 4MUBA 2JBAB 1ZD8A 4GRIA 1HFJA 2Q0HA 3PK0A 4H3VA 5K0SA 4S1NA 1G42A 4PSDA 1UPFA 1YZUA 2B99A 1YBFA 4O1HA 3ESDA 5LA6B 4U00A 4O2LA 5NLLA 4JLUA 4GQBA 5KQMA 4RTMA 1TM2A 3N7AA 1E6KA 2I1LA 3E7XA 3V8QA 1WCV1 4ZI7B 2HPVA 1X1DA 4TXJA 3ZI4A 2O59A 2H00A 3TLGA 1D0SA 5CLGA 2R1VA 3VHXB 2JK1A 2H4JA 4CKXA 4ZDJA 4DR2B 3HXQA 5FTKA 5JMOA 5CT6A 2Y2VA 1T8WA 1K9VF 4E33A 1U7WA 2B8TA 1RRFA 1QMGA 3NHAA 1G8HA 1FJ2A 2XCIA 2CHQA 4FONA 1VIYA 1H5QA 2GEUA 2YWRA 3VU9A 3LBAA 1C9NA 2YHIB 3AF2A 3R4CA 4N9WA 3I9FA 4HNUA 4TTTS 1RS0A 3RASA 1JGTA 1U02A 2LVOC 2F1IA 4YT4A 4OXYA 1TUGA 3B6JA 4MWTA 3ZJ4A 4LY9A 5CJJA 5EMMA 4CCYA 2XX3A 3E1GA 3X2EA 1ZIYA 3P27A 2FKNA 1VHDA 2OQ4A 2O5VA 3R7NA 1T4GA 4QDUA 5DN6A 3ELDA 3ER6A 3BXPA 2B0JA 2IYZA 3JQEA 5T8KC 3ZU3A 3CEPB 3L7DA 5EJ9A 3JQQA 5MGBA 2Z8YM 1ZP6A 1J09A 1MOZA 1HPLA 2E1RA 3JVDA 3OHPA 1A5SB 4US1R 1SXGA 2UXBB 3ZHUA 3ENWA 5JD3A 2BGKA 2YYYA 3E27A 1M2HA 3KSRA 1KEPA 3DFZA 4HMPA 1G8GA 3O9MA 1YMVA 4LZAA 4BGVA 3QENA 1DDGA 2GN6A 5DNDA 4YUXA 5BW4A 2PX6A 4CUJA 5THXA 2H6EA 1C5KA 4C3OB 4MA0A 4D3DA 4BNFA 4DRZA 3BBLA 3U40A 4A0QA 1X6VA 3KKKA 5FD8A 1FK8A 1PFVA 4TTJA 3U26A 3EFBA 2DETA 2VF2A 3NBIA 2OGUA 4O3FA 5IDWA 3GLTA 1T8RA 4FOSA 4X1YA 1N2OA 2EXXA 1FMJA 3R3XA 1R5BA 4U0JA 5EJ2A 4B7GA 3OIGA 1OZ0A 3L2AA 3J7BA 3THOA 5I9IA 1JR6A 4BO9A 2JVKA 3EDRA 2PYIA 3E1KA 1TK3A 2J9ZB 3JAKB 2EGUA 7MHTA 1AUQA 1QDUA 1M54A 2HCRA 3OEWA 4R9RA 2I8AA 4UEWA 4B6GA 4DLRA 4D9FA 1RPZA 2VSFA 4JT4A 2A0UA 3HHPA 4NONA 5JZMA 5ALRA 1IWOA 3GGDA 3ZJ5A 3DQZA 5CPBA 1DHRA 4GKKB 5IT0A 1IXSB 1KTIA 1H3EA 3ROPA 3PHBE 2HDWA 2DFDA 1UOPA 3OZ7A 5D7BA 1L4NA 1BW9A 1L8AA 2HRDA 2ZRPA 4B71A 3ZC3A 4OQDA 2I4LA 3HUTA 3L26A 1GJSA 2L69A 2RJOA 2XOKD 4MVWA 2APJA 3OKAA 4N7JA 4N1AA 3MT7A 2CJWB 2OHJA 4MIOA 2J6CA 5HF8A 2B8NA 3VOAA 2A84A 2XCRB 1UBEA 1P8JA 1HNWM 3ED5A 2AHOA 5ESXA 3MWEB 5ADUS 1NI5A 1HLFA 1E62A 3NBUA 3HCNA 4MTCA 3Q5DA 4PAMA 2XUFA 5KBYA 4QYXA 3IDZA 4MVJA 2ZRGA 2PMKA 3CU5A 4N5HX 1NE2A 1M34B 2CLFB 2HDHA 3IR7A 4S1VA 2BTQA 4BX2A 3NGLA 3N2NA 3V1KA 5DM70 1Z2PX 4WY2A 3RIXA 2DQKA 3OZFA 4U5QA 1XK7A 1W5SA 2R8ZA 4S1OA 2L7IA 1KAOA 3CZQA 3OF2A 3T1OA 4B3TM 3BL8A 3BMQA 3CS3A 5JAQA 3RSQA 2AQIA 4F4DA 3D0KA 2P9TA 1M8FA 1CUJA 3EOBI 4DXHA 4LK3A 1AK9A 4RZQA 1IHXA 2QUHA 3NXKA 5B57C 1V71A 1DRWA 1WUTA 1RDFA 5FNVB 2GF0A 3O3CA 1X7DA 2X1HA 5J3JA 5IT9A 3WWOA 4KSYA 2W2KA 3E03A 4DV1M 3IQWA 4MLPA 2HGZA 1Z8FA 1SUFA 3OIYA 2B35A 1AU9A 1LFAA 1RKBA 3PQ3A 5KEIA 1SXJB 3CRRA 1FS4A 1MX1A 1TJ3A 3TCKA 4OJKA 1YS4A 3PUXA 1D0IA 4GPEA 3ESAA 4Y2JA 1CERA 5DI9A 4E30A 4OAOA 2I2XB 4R3WA 2IOQA 4IUBS 3KJFA 1YGPA 4RA6A 3GFRA 3PNPA 4QL3A 2ZRMA 1H22A 4QJ4A 4Z6YA 5D3ZA 2BKEA 5KQ8A 1VTKA 1JLLB 1QJ4A 2IT1A 4WKBA 2Y93A 1E9RA 5EJGA 2Q0SA 3TKYA 2BM1A 4KODA 1RWMA 4GUAA 5J40A 1Y3AA 2PU5A 3FXAA 4K46A 3JD2A 2HL6A 1VKJA 4NE9A 3V1MA 3FAKA 2H54A 3CT6A 2YHAA 4OXKA 5EJ7A 1CZLA 1G0NA 2EC5A 4DSUA 2WHRA 3IJPA 2B4QA 2YWDA 4CODB 2W83A 5J58A 1M2FA 2WUGA 3DM5A 1YMUA 2OILA 4KRFA 3EISA 4HYYA 2QP3A 1GUYA 4DV0M 1GU7A 1QG2A 2GNAA 2W93A 3V8VA 2LIPA 3EA0A 3ENKA 1P72A 2WJWA 2ZBVA 4MPPA 4OGGA 5JISA 2JS7A 3VR1A 3WLKX 3K9OA 5EZQA 2VYVD 2XVMA 3N2ZB 4UULA 1DMSA 3PDUA 4HLQA 5GM2A 2P2CA 4NS4A 3X0DA 2BONA 4ZZ0A 3OJ0A 4OKNA 3MB5A 4I4TF 5A3JA 2H5XA 4L57A 4QD3A 3WNZA 5HKOA 3EYWA 3UGJA 3AKZA 2D1YA 5DWDA 3RI3A 3U3ZA 4C6TB 1B23P 2NVUB 4EWLA 5DOVA 2XGMA 5TRTA 4LVUA 1N2JA 2XA2A 2NUTA 3ABOB 2YXDA 5IBRA 2AQ8A 2A3RA 2D7CA 5EKXA 3U6BA 1IG3A 4DV3B 3NHZA 4CQLB 1F4PA 3PUKA 4WTOA 2VDVE 2XNDD 1CUFA 1M2WA 1RHJA 3OZXA 1R1DA 2PX3A 2JXNA 2DPGA 3KQTA 1DV2A 4TLMB 1K3TA 3U17A 4N7MA 3UIEA 4DREA 1I14A 1E32A 1B42A 4HSGA 4RH1A 1X87A 5LMZA 5KVVA 2JI6A 2QROA 1DTWB 4GC5A 1Z25A 3CX6A 4R98A 3PGLA 4TV8B 5EWLA 4CEJA 2Q7DA 2EUCA 5FEMA 4GIPA 2DAGA 3OMXA 3TSAA 4RNCA 2Q3JA 1G21E 5L8VA 5KCZA 4UUBA 2C7RA 2OE2A 4GM1A 1L8XA 5EJ4A 3PX7A 4K6GA 1HDCA 2Q7OE 2VTVA 4I4IA 2QTVA 4NH4A 1LVUA 2C5AA 4DGQA 1XKLA 1Q74A 1EQ2A 1UR5A 4IIJB 3RR2A 2QY9A 1FPQA 1LPOA 3K2IA 3WQSB 4EHJA 2C04A 3HVIA 1Y1QA 5JWOA 3EIEA 2RE8A 5AUPB 2X6QA 4KR3A 2OBXA 2H7YA 2YR0A 4TVOA 4W7HA 1HJPA 4I55A 3Q6NA 1TMOA 3NKLA 4L3OA 1U7OA 2QM7A 2O52A 4TLBA 3LQ1A 8MHTA 2XB8A 3ACCA 3O0DA 4RFSA 5CDUA 4FDVA 5G3ZA 3BHNA 1U9CA 3OLZA 2CUKA 5EP2A 4ATNA 4BKQA 1EINA 1JU9A 1ZXBA 2PAAA 1S6YA 1FP2A 1FFXB 4I14A 5EE3A 3E9ZA 1NMYA 4ME6A 1MPTA 2GD2A 4U7DA 5FOVA 2P9BA 2Z30A 1RXIA 4H7EA 4CT4B 2OOAA 1W9HA 2WSIA 2TMGA 2HADA 2Q6KA 1VJDA 1K7CA 4G8DA 4JL6A 1YBHA 2XEDA 2ZKLA 3M9WA 3M1LA 2DBZA 1BS9A 4NG5A 4GKBA 2IHUA 1ISPA 2CWWA 4N6OA 4EW3A 2JHAA 3I9V1 3TL2A 1SUEA 1V45E 3TQTA 4QOFA 2MMGA 4EA8A 3GIWA 3QFTA 3MBOA 4XM0A 4IIWA 1F0NA 1R3DA 4N3AA 3T7TA 4EB6B 1KR2A 3V4RA 5H3HA 1I3MA 4JI2B 5EEHA 4MAFA 4C05A 2JY8A 2E4VA 2QU8A 4EFNA 3SQMA 5J4HA 5ALNA 3QJGA 4G1EB 5DKFA 4ZZ3A 4BP8A 1BCSA 2P65A 5JH7B 1JLSA 3DBRB 3UMGA 1QZUA 4Z6KA 2AZ4A 1UPXA 4OBBA 5IPFA 1NATA 3I28A 4XEUA 2VOJA 3GPXA 5AKIA 3LVBA 3V33A 5K0GA 1YZTA 5U9CA 3WYNA 1RRGA 2FFBA 1R8YA 3NUQA 3NTLA 1J20A 2XWSA 3DEZA 5ICCA 2V7QA 3ZGXA 4U4AA 3MT8A 2C2XA 4G67A 4L5AA 2EG9A 3UC5A 5M29A 3ESCA 1SXJD 1KVSA 4I46A 3GLHA 3NJ8A 3WI7A 1HYGA 1YVRA 4NIMA 1XZ8A 2Z1MA 2WNHA 1RWVA 3VTKA 3G13A 3UTDA 1RXYA 2JRLA 4YRIA 3LK7A 2C3UA 2CMGA 4TKUA 1FFWA 1KI9A 4QBGB 3IRUA 4GNRA 4AKHA 2A0WA 4DV0B 1PSWA 3B53X 3NBZC 5GTDA 4X66B 1L2BA 1ZUIA 3KT6A 3RUCA 1R8JA 2RCNA 4EO7A 4M89A 1B6TA 8CATA 2Z5GA 1BOFA 3B7WA 1A4RA 4DJEC 4M86A 4F96A 3BIFA 4N6GA 1PWHA 4FMPA 1ZR4A 1R8XA 3P9CA 2JIRA 2Q46A 4FP9A 3LX6A 2R8BA 3UMCA 4CI9A 5IAOA 2JWSA 3SHFA 3W6UA 4D9CA 1KH3A 3FLAA 1GLVA 1S8FA 1PL8A 4JJGA 2H1FA 1C9MA 4IFTA 4L9SA 5JXIA 4YMIA 3GFOA 2CV1A 3FM9A 4J0CA 4ZT2A 4UMFA 3K0FA 4J07A 2BY4A 3U7RA 1A7KA 5IJ0B 3RIEA 4L9RA 2BGNA 3AFHA 1CUSA 3O31A 3F7NA 2QXUA 4Y6RA 5GJVC 4YY3B 3SHVA 2FUKA 2DJIA 3CRQA 3VNQA 4ZT7A 4KDFA 3UG6A 1QQTA 1KOLA 4LFBB 4RTPA 1XG5A 2EL9A 2XOXA 1FXUA 3OTOB 4B3JA 3T12A 2V9PA 3D5TA 2EHDA 3EZ2A 4K1LA 3E9SA 4QO7A 1TDZA 4MPRA 2VPIA 5BT8A 2D8AA 5AW2A 2V7TA 4PQGA 2AMVA 2XCUA 3G68A 3R6TA 2GBLA 2VBGA 2Y1DA 4DLBA 2R6R1 3U6DA 2ZJZA 1XCGB 2BN4A 4NV0A 4RZ3A 4YCJA 4YAWA 4F56A 3CLTC 1JIQA 4F8EA 2CJWA 1RC0A 5E6UA 3HB5X 2MYPA 3FWYA 1GCOA 1A8IA 4YCNA 4MHTA 3L79A 1ENOA 1EKXA 1EFCA 1SKAA 1CIPA 1XC7A 2AN1A 1XD9A 4F3CA 3D3JA 5TDHA 1FNMA 2D3WA 3T1VA 3U80A 1G7TA 1VL2A 4I0WB 2BL4A 2CVFA 4M22A 4C7XA 1MB9A 5CW1A 4HAYA 2CHEA 4C20A 5AKXA 2XOEA 1KEVA 4ROSA 5B3AA 2UXDB 1N0VC 4HQKA 2AS0A 3GQ3A 4DTIA 4EB3A 2YXEA 4OLJA 4FWIB 2NZ2A 1WBBA 1GIAA 3F8SA 1Z4KA 5A7FA 3QTBA 1DMRA 4S1PA 1ZWKA 4FW9A 3E5MA 2YIVX 3IIJA 1GGKA 1WD5A 2OO7A 5T4EA 3ORHA 4ANFA 1ETUA 3H9EO 1ZRMA 1UK8A 4J0GA 1XNQM 3UBMA 1TK9A 2LVBA 1L5WA 2YDXA 3L8MA 4YCAA 4PQEA 1A5BB 1YR9A 2ST1A 4QUHA 3STVA 3QEJA 3LPMA 1MRZA 3FPSA 3EBOA 5DYWA 2JZNA 1GLNA 3QEMA 2FSVC 3U3DA 1O54A 2W58A 5D6NA 3GRAA 4I50F 5IXSA 5T5QA 3SXPA 1SIBE 3AEQA 3EXIA 1XF9A 3N70A 4R1LA 4Y18A 1C14A 2OK8A 4WN9B 3EPRA 4O2AB 4ALKA 1KMIY 4ENQA 3W9UA 5FPKA 1U9JA 2FGJA 5JADA 3N2KA 3WV4A 2ZYRA 3LVVA 2Y1KA 1AB6A 2BW0A 3HNPA 4GXNA 4DOMA 3PFIA 2ODTX 5ELMA 3BVPA 2EV9A 1X1AA 1EDOA 3NJ4A 4F2LA 2V8OA 4O4HA 1JR3A 2E4AA 4KXWA 4KFRA 1MIHA 4O4JF 4P3XA 3BREA 4P58A 3WTBA 4UVDA 4MV7A 4MYHA 2WK1A 5JAIA 2OG2A 1EXNA 1T1EA 3N0VA 4LWQA 1KIMA 2UYCA 2ZQYA 3GNQA 1NYRA 4F72A 1T3TA 1V8OA 2RB5A 2JFWA 1Y1TA 4MKIA 3REQA 3DGEC 5JH7A 2CSXA 4WK6A 4JB2A 2I3ZA 5I5GA 1PWZA 4ZKEA 3RIYA 1ZAKA 2IYUA 3F98A 5ER9A 3TLEA 4EKIA 4P2GA 3VPAA 3IBGA 4DMCA 3DXXA 4M0PA 3CF6R 3PXDA 4ZYLA 2EJTA 3AEUB 2UYQA 3QAUA 1F20A 4MH0E 3GVIA 4QSHA 4XWAA 1DUIA 2Q50A 1M6VA 2CB0A 1QXSA 3L7LA 4TUWA 2H0AA 4WCVA 3HJHA 4LRTB 3W06A 5CA1A 4Z7QB 4BLQA 4Y30A 2DQYA 4BVKA 4XTCS 3C43A 4EGAA 3VK8A 4DR2M 4UBNA 3RYHB 4JJFA 3GGOA 5BNZA 3R3SA 4PX9A 2HWXA 4EECA 2FWRA 4G0UA 1H66A 1O2DA 4YP0A 3V2UA 1U0HC 1UZLA 4Q7QA 3S27A 4AN0A 1QPZA 1Z39A 2GQ0A 4GEGA 3G9TA 3DOEA 4QJIA 2CBZA 3ORFA 3SQNA 3T3IA 3MOSA 1EIWA 3PNLA 3JQCA 2WJAA 3V3KA 3S5JA 2CVZA 3EGOA 1MX9A 5CCXA 3ZIDA 2H1CA 4LYHA 1KMHA 1QRDA 1XE3A 4PAOA 1WGNA 1ISFA 5IT4A 2PGNA 2AOUB 2JA1A 4R1QA 4XUDA 3FG9A 3QGMA 1YACA 2I34A 4D56A 2ZU6A 2AXQA 4MGYR 4ZOCA 2CVHA 3ND7A 2JH8A 1N3BA 3DZBA 3QJ5A 3K4PA 1FJGB 5TF4A 4IIJA 4P83A 4WESA 5CYFA 3N53A 3ZY6A 3QLUC 4A9AA 2OP0A 2CJPA 1VDDA 2JCBA 4MIKA 1ODSA 3GCXA 1XTRA 3VO8A 2WM8A 3E23A 3KQNA 2KMLA 4RSHA 1J2YA 2ZJ5A 5TARA 2O1XA 2FKAA 3CPSA 1P62B 3WLOA 2ZT6A 2VPWA 3OTGA 2WWHA 4GYKA 2EG5A 4KQKA 3WYBA 4B6RA 2JFUA 3KSAC 2BFOA 5KOYA 5EZ5A 5D85A 5TE9A 1TU4A 5E1OA 5HVNA 1UFOA 1JE1A 5A6SA 3HJTA 5LQKA 3JYPA 1MZPA 1EWVA 1ZD5A 1JDBC 1YUMA 3HXKA 1GL3A 1R9MA 3QU7A 3PC8A 3RAGA 3BD7A 3K0EA 1QHEA 2F1KA 4N5NA 1V2GA 1J0AA 2JAHA 2TS1A 4CU2A 4R1UA 1T2DA 1PT5A 4OXRA 5C53B 4CG0A 5JW6A 2QTHA 1YD7A 1NRXA 1Z8DA 4FCCA 1NTRA 3FTFA 3NYRA 1QVAA 4LTMA 4LXQA 4PG7A 4XGNA 4B3IA 1JIIA 4KWIA 3RADC 1N2SA 3ABSB 3I04A 2EWMA 2VRBA 1GZ7A 2VK8A 4LTNA 3U7JA 1JR3E 3LCUA 3C45A 5FYQA 1YQQA 2RIRA 3TPZA 4V0NA 4COKA 1VMEA 1NW8A 2FVYA 3E58A 4OQNA 2Y27A 1R2YA 1RMQA 1GAXA 2DOKA 1Z4LA 3AUTA 1JB0F 1U81A 3G89A 5A4KA 1EK0A 5E0OA 4KTTE 1EFPB 1W1WA 1SY7A 1YI8A 3IH5A 4LCJA 1DDIA 4C0SA 1CY6A 3AKEA 5I01A 3NRCA 5CD1A 1RM0A 3FDIA 1M2VA 1QO0D 1CLEA 2Q4BA 4IPTA 4XZ3A 4CM4A 4NENA 2P0YA 3KU4A 4LCBA 4QUDA 2PUVA 1E98A 3C3YA 5KKAA 1AC5A 5I3ZA 4EL5A 2QX9A 2P1ZA 3ICVA 2DH5A 4PBSA 3TKLA 4W9RA 3VYWA 4D9KA 2VF5X 2GA8A 4YJ3F 4NVRA 3WJAA 4B7XA 1FOEB 4CQMB 4DSOA 5BUCA 5BVHA 4F4CA 5EP4A 4DV2B 5H9WA 2J0EA 2QPLA 3CV3A 3GCDA 3OZCA 4XM1A 3UO8B 4RSRA 4BNDA 4MVJM 5P8WA 1GL6A 3PJRA 2JH9A 2EIXA 1Z33A 4HX2A 4R7ZA 4Y9TA 3RVOA 4QBFA 1T29A 2C3PA 3UHPA 5G02A 3ZK7A 5HJ5A 2AW5A 4FWGA 3OAAD 1GRQA 1PWEA 2J6IA 4LZLA 1N25A 2NUPB 3QIAA 4N3BA 2JNHA 3P0RA 1RXVA 1RLOA 3VVLA 3WGGA 3UA4A 3ZY4A 1ESEA 2G7ZA 4DC1A 4TVBA 1F8GA 3M5PA 5HDBB 5EHGA 5C8VA 1C0LA 1PYDA 3QXSA 4QBKA 2P69A 4C3ZA 5CLIA 3VU3A 2ZYSA 3OQNA 2VXBA 1UBKS 2QN8A 4G1BA 4E5NA 2WG1A 5DIFA 5A9SA 1MO6A 5KU1A 1PZMA 3GZNA 3ZHSA 3FLMA 4KAXA 2IEDA 1E4YA 2N3ZA 2ZAOA 1L4YA 5LN1A 3AQ4A 4DQ0A 3Q85A 3RVJA 4DR5M 1KPHA 1P1CA 1QS0B 2PV0A 3LGAA 3AVYA 4OLAA 4D98A 1X38A 1SOVA 4FYYA 2AMFA 2UU9M 4JI8M 4HXEB 2G1KA 3QKIA 1VBFA 3DDSA 4R16A 5HS6A 5GGYA 5JXHA 1A72A 4IG4A 4E13A 3NHLA 5L3RA 5IK2A 1NW7A 3JZFA 3L92A 1VLMA 3BMCB 4YVFA 3W5IA 1G3UA 5K6AA 3P4XA 1T3LA 4DUYB 5B53A 4KXLA 3BSYA 5HJ2A 4TYYA 1P4RA 1OBOA 3H0CA 3KKMA 4YJ2B 3DL7A 1UBTS 3W8RA 3UWDA 5L7WA 4QM7A 1EGQA 4ZYUA 2J0VA 3EPJA 2VLBA 3VI3B 2BGLA 1ZI6A 4HLDA 4ITUA 4P93A 2CYAA 4OP1A 3ZKAA 5AK3A 1KYYA 2XH9A 3IB3A 3ITEA 4MVJG 3B3GA 3HFJA 3MB8A 3RD5A 3BG5A 4DVGA 3MCVA 3JALB 1EVYA 3PPWA 1D2NA 4KHPM 2E21A 3B3AA 1EE9A 4OLHA 4RIHA 1LS6A 1T5IA 2BISA 3IIMA 4JGBA 2FEXA 3MTBA 3P94A 2JNWA 4YDRA 1FFAA 4H6VA 1N5MA 5IWAB 3V9PA 1UC8A 1JMKC 2EZTA 1W8IA 2ZQZA 3MELA 4B3RB 3HV0A 1ONPA 4D26A 3IJEB 5CVVA 3ADOA 1SXJE 4D9BA 4KFUA 5CVCA 4D42A 3IBSA 2WU1A 3DV0B 1RYZA 2EQBA 2W2LA 2NTVA 2V7EA 3DS8A 3FBTA 4OMFG 4A2WA 3EZNA 4DR1M 3AQIA 1EJ6A 5CVJA 4D57A 2J7PA 4MRMA 2H4ZA 3RTAA 3QWLA 5EQTA 5J4LA 2F4VB 2QWXA 1EX9A 4N8DA 3LCRA 1IHPA 4F4HA 1ANKA 1FA9A 2GERA 2Q3FA 1W0KD 2WG0A 4LQ4A 1NVBA 4F60A 1NUQA 4XB1A 2E4UA 2BFEB 3HWSA 2I2FA 4RGBA 5SYMA 5C7OO 4QXMA 1Z7WA 2ZBRA 4EZIA 2IXFA 4EUSA 2PKQP 2C4NA 5BRAA 2G1JA 4NCJA 3VHLB 4KO1S 5CXUA 2XMZA 1KBQA 3ASVA 4JBNA 4PF1A 4Q4LA 3WV5A 4C4ZA 2WYIA 3ZU2A 1AGRA 1FQWA 2G5GX 5BOVA 2RHCA 3VZBA 4JLWA 4MMXB 3ZDYB 2GVNA 1CR2A <