4GDMA

Crystal structure of e.coli menh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
SMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gdmA00
1O6GA 2XLBA 1E5TA 4BDTA 4C01A 2I78A 1H23A 3HJUA 3L1HA 5BWCA 4X93A 5AO9A 4L72A 1XROA 1XRLA 4DNOA 4K2AA 3HABA 4FLEA 2WIKA 2X8BA 3AIKA 2QOEA 5JALA 2WUDA 5BV7A 1K6EA 4HXFB 2G63A 4L9AA 5AM4A 4G5XA 1W4LA 3V9AA 3C43A 4NZZA 3WK5A 1EK1A 1X2EA 4AMZA 1TCBA 1D07A 4E46A 4FOLA 3KOOA 4UBNA 1Q0RA 1ODCA 1NU8A 5LZ7A 3HYSA 1Q84A 1HBJA 1XZMA 3ESDA 1EB8A 4Y2VA 2Y1KA 3WL5A 4AO6A 2QZPA 3C45A 5C8ZA 4Y2UA 1ORVA 5K3DA 4C4YA 4INZA 3BIXA 2OQIA 2WU3A 3G9TA 1FFEA 3BWXA 4XJVA 5AI5A 3TEJA 3IUMA 1UWCA 1MAHA 3FLBA 4ZV9A 1HL7A 3JWEA 1N8SA 4DNPA 3PF9A 1E8NA 4KAAA 3WMRA 2QXTA 1LNSA 2FJ0A 4BC0A 1F6WA 3WLAA 3DYIA 3G9UA 3PFCA 1FJ2A 2ZJ7A 4U2GA 5DYTA 2BFNA 2HA0A 2OCIA 3O95A 4JEIA 1VE6A 5JD5A 1XZHA 4GWLA 2XQGA 2XMQA 1XZJA 2WJ3A 3V1NA 1J07A 2GZRA 3D7RA 4C87A 2CZQA 5FRDA 5EIHA 4K6HA 5HK9A 3WYDA 1IUPA 1DWQA 3OG9A 4PSDA 1XZAA 5K3FB 1XZGA 4FNGA 4RPCA 1Y7HA 1ZIXA 1G66A 3DD5A 2HM7A 5I8PA 4G4IA 1JJIA 1EHYA 4E14A 4QDZA 2H7XA 2GBIA 3AIOA 5JAHA 3V1LA 2C4HA 3DLTA 5A71A 5K3AA 1LBSA 3GZJA 1BU8A 5CH5A 4Q3KA 2XMBA 2ZSIA 2YXPX 2OAGA 3EQ8A 4P93A 2BAGA 1LPPA 3QMWA 4W1RA 3E3AA 2Z8ZA 4YK7A 1TAHA 1T2NA 3GBSA 4X6YA 5IVKA 1SC9A 2JF0A 1C7JA 1EA5A 4X95A 1F0NA 2WKWA 4EY5A 5HF6A 1L7AA 4EY4A 6YASA 4FFVA 4Y2SA 2ZJFA 2XMRA 1DT5A 2C7BA 5AJHA 3V1KA 1J1IA 1WOMA 5EGNA 5DWDA 1Q0ZA 2GBCA 1SOMA 1EXWA 1UZAA 3RARA 1VA4A 5CW2A 2ZYRA 4BDSA 3BF7A 2HADA 3X3HA 4Y2PA 3IURA 1ZI6A 4EUSA 4H7KA 1QIKA 5AOCA 1ZJ5A 3QPAA 1P0MA 2CBGA 3FYUC 2PKYX 3WK8A 3VKFA 3AZPA 5AICA 1VOTA 3H2GA 1G4HA 4AO8A 5A7GA 5KBYA 2ORYA 2VEOA 3VXKA 4MEBA 5AKLA 2J3DA 4NS4A 1XZLA 3MVEA 4B0PA 1CEXA 4WCVA 4PSCA 3HSSA 5CT6A 2V96A 3FVRA 1U2EA 3HACA 1YB6A 2BGRA 3D5EA 2IITA 3ICVA 1XZDA 5I7UA 2OCKA 5ALDA 2FX5A 3ZWQA 4BP9A 5KWJA 3WQHA 3E1GA 5JANA 5CT9A 1UKAA 1MTZA 1TCCA 1J06A 5AKIA 4F21A 3W04A 3FCYA 1GKLA 5CRIA 3HI4A 3V1MA 1YSCA 3WK9A 1E8DA 4OB7A 2WIDA 2PSFA 1CRLA 4FBLA 2C0PA 1XZIA 3WIOA 4BP8A 3H04A 3OOSA 3H2IA 5LYYA 3R3ZA 1YS2X 3KD2A 4FLMA 4HXEB 2FUKA 4J0IA 1Y7IA 5SYMA 1WPXA 3C6ZA 2J3QA 5FKJA 4H7HA 5K5EA 4BVLA 1JMYA 1W76A 2BUAA 1AURA 2NW6A 5HF8A 4BYMA 2ZSHA 5HK8A 4L3WA 4KR0A 2AJCA 1JKMA 4OU4A 1FSSA 3QM1A 2HIHA 4J0KA 4N8DA 3MUOA 4X91A 1MJ5A 3IBTA 2BUBA 1DQZA 2WHRA 1RWQA 1TK3A 5CMLA 4Y2XA 3C6XA 5BWBA 4Q34A 2PSJA 5AKEA 4WFJA 3NOXA 1W75A 1FFDA 3F97A 1CUIA 3HZOA 1R4ZA 1XLWA 4U2CA 4NVRA 1LZKA 2WHPA 3STXA 3RLIA 5CH3A 5ALZA 4M0EA 1CUFA 4WFIA 5AK3A 2HA2A 3DEAA 4CG2A 3STWA 3LCRA 4YASA 4XIIA 1KU0A 3CN9A 3AZQA 1ZD3A 4UUQA 4AQDA 1BEEA 4BCCA 3W05A 2WFLA 5LZ5A 4F60A 1VXRA 1JI3A 1YB7A 2OGZA 3F98A 4AZ3A 5FDFA 4LYEA 4TGLA 4ZRDA 1S8OA 2CJPA 4DMFA 5CH8A 3WIBA 5A6VA 5DTIA 1XZBA 3DNMA 4KAFA 2OCGA 4YX9A 2QRUA 4FMPA 3QZUA 5FXMA 4G8BA 2HA3A 4I4CA 1XKLA 2PL5A 3T52A 4N8EA 1AZWA 4QA9A 2X5XA 4IO0A 4DSAA 3QMMA 3I6MA 3CCCA 4EHBA 3PFBA 5JD6A 4FNMA 2QMQA 3VVMA 2JGFA 4X3CA 4HS9A 3DKRA 1CIJA 3W2TA 3QBJA 7YASA 4CCYB 1LBTA 3ZLUA 1F0PA 4EB0A 1VJ5A 1XZEA 4OYLA 3H2HA 1XLUA 5LKAA 5EIAA 1C4XA 4J3JA 5LZ4A 3A70A 2WSLA 2I03A 4Z49A 2RIPA 2PUJA 3DJYA 4JYPA 3WKBA 2XUDA 3M82A 4W63A 4UBIA 5EHXA 2XMZA 2WFMA 1BCSA 3FLAA 2DFPA 1K5PA 1WCYA 2ZJ6A 4UBLA 1EB9A 4LHEA 4Q1VA 5AH0A 1SFRA 3BJRA 3EQ9A 1CUBA 1VE7A 1CLEA 4ZWNA 5JZ9A 1CVLA 5SYNA 4W1PA 4X6XA 4AZ0A 4MQMA 4LXGA 2PM8A 4AXBA 1O6FA 3ANSA 1ISPA 3K2IA 3SWWA 3BXPA 2XLCA 4OPMA 3KXPA 5HKBA 1MAAA 1MPXA 2YYSA 2HFJA 1EVEA 2GYVA 4Q05A 4P92A 2PX6A 4JYMA 5T4HA 4Y2QA 2CEKA 4X94A 4IH4A 2RHWA 4BZZA 1MX5A 2JEYA 4G4JA 4OD0A 2BJHA 2PBLA 4PSUA 4G9EA 3AFIA 1UK7A 3NWOA 4PV7A 2P8SA 4BZWA 1EDBA 2QM0A 3R3YA 1H2XA 2XMCA 2WQZA 5AKZA 4PQEA 3GFFA 3UUEA 3WL8A 4PNZA 4Y2TA 1QTIA 2XUKA 1R1DA 4A23A 3OM8A 1SCQA 2O2IA 3I2JA 1WB6A 2DQZA 2WIJA 3WKCA 3OPMA 1UKBA 1RYYA 3F96A 5HFAA 4J0JA 3I2FA 3WYNA 2XQIA 4B82A 4B6GA 1NU6A 2ZYSA 4XVCA 5LIPA 2AXEA 2H7YA 1OXMA 5JZBA 1YS1X 2Y6UA 1CUGA 3PE6A 3C8HA 2QUAA 2VATA 5AP9A 4ZXFA 4JH0A 1A88A 1P0PA 4LKOA 3L1IA 3P2MA 2XUQA 1QZ3A 5ALMA 2QXUA 3DCNA 1GQSA 3IUQA 1XRQA 2V97A 1E8MA 4GI1A 2DHEA 2C58A 3D2BA 1ETHA 1QIFA 3IA2A 1Z68A 5HQ3A 5C8VA 4K6GA 1QIHA 4JUIA 3IB3A 1WHTA 5AK5A 3BDVA 1P0IA 2ES4A 5DLPA 1XZKA 2DHCA 2XMDA 5A7HA 4LXIA 5LP1A 4Y2YA 5A2GA 5FP0A 1DX6A 2O7RA 2ZYIA 4DIUA 3R3XA 3R3WA 3HLKA 3R3VA 4WJLA 1CUJA 2WIGA 4W1SA 2CB9A 5LZ2A 4KE8A 3TGLA 2CUTA 5CXUA 2ONCA 5JATA 4AMYA 2JBWA 1ZD5A 2XQKA 5A7FA 4J0DA 4UHDA 1N5RA 5CXXA 2XDWA 2B20A 2VTVA 5J3JA 3ILSA 5CT8A 5DNVA 5EFZA 3H19A 4RGYA 5IVDA 4ZV7A 2QJRA 4QDOA 1ODSA 1FFBA 4P08A 4QDXA 4OYYA 2WFZA 1EX9A 1DWOA 5CT5A 1HLGA 2XUOA 5JARA 4X71A 5LLSA 3JW8A 2XUAA 2I3DA 2QJWA 5K3FA 4QLAA 1EINA 4AN1A 2GBGA 3CCBA 1CUXA 1QIGA 2GBFA 3U1TA 2G5TA 5IVIA 1QIIA 4EBBA 3D2AA 2E3JA 3PUHA 3H1BA 5C81A 1RP1A 4M0MA 3A6ZA 4UHCA 5D3KA 1XQYA 3AIMA 3V48A 3S2ZA 5F4ZA 5CT4A 2YASA 3IIIA 4MXDA 4EY6A 2FJPA 4S0XA 4Y2RA 3H18A 3B12A 4HVTA 2VSQA 1THTA 3U0VA 4EZIA 3E0XA 5EI5A 1HPLA 3KDAA 3A2LA 1MNAA 3FLEA 3I2HA 2HHAA 3D2CA 1H2YA 2QVBA 1HDEA 1ZIYA 4WY5A 3D0KA 4IQ4A 3WKEA 1EVQA 1WM1A 2UZ0A 2Z3WA 3GA7A 3L1JA 1GZ7A 5IVHA 1QLWA 4N5IX 4U2EA 4KJXA 3G0CA 4U2BA 2XMSA 2IX9A 4BE4A 1HQDA 1R3DA 5E4TA 1A8SA 3C70A 1EI9A 4CCWA 1CUVA 2OXEA 3WZLA 5EHZA 2Z8XA 2DR0A 3O9VA 4B80A 1QIMA 3T4UA 5AM0A 2HRRA 3NUZA 2BCEA 2HA6A 2Q0XA 1QOZA 3AZOA 4GDMA 1KEZA 3HEAA 4QWWA 4MEAA 5D6OA 4DMHA 4CIAA 5JAUA 4W9RA 2JGIA 4KACA 1DINA 4HTAA 5AI9A 1CUYA 5ALIA 2QTBA 1TIBA 3F9CA 4EY8A 4K6KA 4Q3LA 3IDAA 4GEGA 5HF5A 4B84A 4BAZA 2VA9A 3BE8A 4UBJA 1JJBA 1IVYA 1ACJA 5YASA 4U2DA 2IIVA 2PVSA 1H2ZA 3ICWA 2AJ8A 5ALLA 3O9MA 2PU7A 1ZJ4A 4UHBA 5ALHA 1B6GA 1MX1A 1QIJA 2DSNA 4OB6A 1GXSA 4IH9A 1XZCA 3G9XA 4FFWA 1CQWA 1IZ7A 4H7JA 3WJ1A 3G0BA 3FYTA 2W22A 1UK6A 4HZGA 2XMGA 3HRHA 3Q0TA 3R41A 1C7IA 4MYDA 4ETWA 4QWMA 1LPAB 5E4JA 1XQWA 2QT9A 4H7EA 3FYUB 4XX1A 2XB6A 3I28A 4G4GA 1AC5A 3ZI7A 5EHNA 3LIPA 5LZ8A 2XI4A 1LGYA 1QE3A 4KRXA 2V9ZA 1XLVA 3WWDA 1EH5A 2WG2A 2RONA 5AOAA 4UFPA 3DOHA 3H2KA 4FTWA 3IUJA 2EDCA 2WM2A 4DSZA 3DYVA 2H7CA 3AINA 1VLQA 4UHHA 2GZSA 4J03A 5AIAA 2B61A 2O7VA 2J4CA 4KE7A 2WUGA 1PJAA 1IMJA 5HFNA 3ANTA 3FVTA 3I1YA 4HRXA 3O4HA 1JJFA 1BEZA 2BUCA 2Z5GA 1TCAA 1TRHA 4DGQA 1OCEA 2VF2A 5K3CA 3HXKA 1MN6A 2I3ZA 4KAJA 1UOOA 2G4LA 1LPBB 3JYHA 1HKHA 4H7DA 5HQ3B 5AKHA 4ITVA 1W1IA 2ACEA 3G0GA 1BCRA 3STTA 4BTVA 3VJLA 2OQVA 3DQZA 1GGVA 1XRRA 5JYCA 5ALPA 1XKTA 4I19A 4DNFA 3A2MA 5ALQA 2DCMA 2PU5A 4ARAA 1ORWA 1R9MA 1W52X 1CUZA 1JMKC 2HA5A 4UHFA 5AKYA 1GT6A 4QDUA 1THGA 3C6YA 5ISMA 3EBLA 4PF1A 3IUNA 1R50A 2JGMA 1AKNA 5K3EA 4QDTA 2WLSA 3OTQA 2PSDA 1CUDA 4G8DA 1LPOA 4N8SA 3QVMA 2HU8A 3H17A 4DM7A 4OCZA 4UHEA 5ALSA 3LIIA 4WDQA 4HRYA 2Z3ZA 2QUBA 1ZD2P 4V2IA 5AHXA 1GPNA 2WHPB 4B81A 4G8CA 3VVLA 3QMVA 1K4YA 2OAEA 3BDIA 5FOQA 2BGNA 3CXUA 3VISA 4BBZA 3STVA 1QO7A 4Y9SA 2GYUA 2WHQA 4DYHA 1UOPA 1FFCA 1NX9A 1AX9A 4G9GA 1AMNA 2JEZA 3RK4A 4BB0A 3I6YA 4QEKA 3ZPXA 5JZSA 3PF8A 5ALWA 3SC2A 2V98A 3AILA 2B9VA 2O2GA 4Y2JA 2PPLA 2LIPA 4KRYA 4BTLA 4C4XA 3EF3A 2OGSA 1CUUA 4DMCA 3FWHA 1YASA 3FOBA 4FDMA 1CUCA 1J2EA 4A16A 4F5ZA 1L7RA 4W1QA 5FPPA 3F8SA 3CN7A 2HU5A 3KWJA 1VZ3A 2WJ6A 5I9IA 1LPMA 3M83A 3D59A 4BAGA 1YAJA 1FFAA 5AM3A 1ZOIA 5ALFA 5FV4A 3HC7A 3DL7A 4AN0A 5AI4A 1AUOA 3N0TA 3O4IA 2Y6VA 4O08A 4AX4A 2ZVDA 1MT3A 1BN7A 3WL6A 4F0JA 1K63A 2G5PA 1EDDA 4UFNA 3I2GA 5AK4A 3QPDA 1XQXA 5FUMA 2BKLA 2VJCA 3VJKA 4X6UA 4B85A 3FCXA 3G0DA 1MU0A 2VAVA 2J4FA 3I2KA 2VT6A 3WJ2A 2R11A 1WB5A 3FSGA 5JASA 1CUAA 4J7AA 2XQJA 3FYUA 1AGYA 1F8UA 4GLBA 5DTJA 2QR5A 1EK2A 1PFQA 4H35A 4CCYA 3R0VA 1LPSA 1XRPA 4U2FA 3LLCA 1ZGCA 1R9NA 1AQLA 4J0CA 5ALXA 4MWTA 4FHZA 4LIPD 4UFOA 1DX4A 4TVKA 5E4YA 2ACKA 4GXNA 1BROA 1N5MA 4QLOA 4H7FA 1GPKA 2VJAA 3C5VA 3EQ7A 1IZ8A 2C5GA 4CIBA 1JU3A 4GBGA 3WZMA 3I6ZA 5HCUA 4KYVA 3PUIA 3W9BA 1XQVA 5AKKA 3WA7A 2AJLI 3H2JA 1H22A 1IUNA 2PSEA 5KREA 5AKXA 1VA5A 4ZGBA 3WK7A 1QIDA 4IH1A 5K3BA 4OUKX 3AUKA 1DQYA 3BIWA 3WWPA 4X97A 2WG0A 4C88A 1U4NA 3DL4A 4QE3A 3YASA 1BRTA 4MJ3A 4GECA 3EIOA 2JIDA 1DT3A 4KEAA 2HL6A 2PUHA 4J0HA 3TRDA 1CPYA 5DYYA 5EHQA 5BOVA 1XZFA 3IVMA 1WB4A 1JU4A 2RI6A 2DQYA 4P9NA 3N2ZB 3R3UA 5JD4A 4DMKA 2D0DA 3BL8A 2WUFA 2H9YA 2XUHA 5KWIA 4L0CA 2XE4A 1YAHA 1CV2A 1CQZA 3GROA 1CFJA 3SK0A 5JAPA 4UBOA 3DDUA 3WL7A 4UBMA 4Y7DA 3R40A 4PW0A 1P0QA 4AB1A 4B7ZA 1JT2A 4CG3A 2VT7A 3AJAA 5CBKA 5AK6A 4YPVA 1W6RA 3FBWA 2R8BA 1OILA 4QNNA 2QS9A 4DNQA 4WY8A 3LS2A 3O4GA 2K2QB 1G5FA 1KU6A 1WHSA 4JNCA 2Y2UA 5ALRA 1BS9A 3C6BA 4E15A 4WDRA 5JAOA 2OG1A 1QFMA 2YH2A 4DLNA 4KE9A 1UFOA 4ZREA 4BVKA 1ODTC 2XUGA 5AM5A 4H18A 4H0CA 1GPLA 2CMFA 5CTAA 2AJBA 3C5WP 4OU5A 4RNCA 4GHWA 5LZ9A 4CI9A 2WILA 1YA4A 1UKCA 2EEPA 3KSRA 1E89A 2XUPA 3GELA 1QONA 2XUIA 4NMWA 1UOQA 3OC0A 3W06A 3LP5A 3FSGD 3NGMA 5ALJA 5T4FA 3G0IA 3ZV7A 2VQ6A 2ROQA 3MGAA 3ZLVA 1EDEA 3D4LA 3Q8WA 5JADA 3PDCA 3C87A 4FBMA 2WFLB 1BE0A 4N5HX 3DKKA 5JIBA 4BC1A 3RKSA 5CURA 3DOIA 1K8QA 1BN6A 4BATA 5DJ5A 4BAUA 1QO9A 1ZI9A 5AM2A 1WPRA 2ZYHA 5DNUA 5AI6A 5ESRA 1USWA 4D9JA 5ALGA 1T4MA 2HA7A 3ESBA 1ZI8A 1CR6A 3ZLTA 3UMJA 2OGTA 2OPHA 1I6WA 3FAKA 2OCLA 3D3NA 5ALEA 4Q3OA 4FKBA 5ALNA 5AKGA 5HKAA 1MO2A 1YCDA 4H7IA 2AJDA 1MNQA 2VJDA 2H1IA 2C0QA 5EIEA 4XWGA 5AI8A 5ALOA 1UK8A 4WFKA 4MWSA 1CUHA 4UBKA 3O4JA 3A2NA 4ROTA 4ARBA 2XUFA 5LKRA 2X76A 1ZGBA 2B4KA 4B9AA 1N1MA 1CUSA 4J0GA 3QYJA 3VDXA 4FLFA 1A7UA 5AKJA 2JGEA 3GUUA 1XRNA 3M81A 3QH4A 4FWBA 4M0FA 2WG1A 3B5EA 3O0DA 3OURA 3E4DA 2RHTA 3G8YA 3I1IA 1LLFA 2HDWA 5A62A 4X90A 4B83A 1VXOA 3STYA 2Y2VA 3ESAA 3K9BA 2WUEA 1VZ2A 1DTEA 1DWPA 4C6HA 4G1FA 4BCBA 4Q82A 2XQFA 5DNWA 1QFSA 1QTRA 1IUOA 3WK6A 2O2HA 1ZD4A 3WWOA 2WIFA 4HAIA 1GKKA 3H0CA 1PV1A 2RGUA 4I3FA 3RM3A 2XUJA 3M3DA 3STUA 1UK9A 5FLKA 4MQLA 5E2IA 4EY7A 3QITA 5D3ZA 1CUEA 5AOBA 1VKHA 2WU4A 1QJ4A 1QIEA 5AM1A 3UUFA 2HRQA 4OB8A 4BVJA 4AO7A 2JGLA 3DS8A 1R88A 5IH7A 1SCIA 5T4BA 3WK4A 4BE9A 1LPNA 1A8QA 2JGJA 4X92A 3K6KA 4MYSA 4RE5A 5ALYA 2WTMA 4BRZA 1B41A 2EDAA 1G42A 5C8XA 1TKRA 1ZICA 2GYWA 1JFRA 3B3QA 1ACLA 1YR2A 1H2WA 3I2IA 4LXHA 3G9ZA 3H1AA 3WKDA 1UXOA 4CFSA 2W6CX 4ZI5A 3PI6A 3WA6A 5H3HA 4QZVA 1L7QA 4X00A 5AI0A 4X85A 1Q83A 1XRMA 1YA8A 4RE6A 4C89A 1SCKA 2ECFA 4E11A 5D7BA 3G02A 3MUNA 4TPKA 2RAUA 5ALUA 1XFDA 4BCDA 2OLEA 3PICA 3VJMA 2VAXA 3WWCA 3ED1A 2WTNA 4H77A 3KWFA 3BF8A 4KE6A 4HXGA 2DHDA 3W9UA 2CKMA 4UPDA 1MX9A 1E3QA 1X2BA 2QKYA 4DTCA 5HF9A 5AIBA 4CG1A 1GQRA 5DYWA 5FPQA 3S8YA 2HFKA 4BRSA 2D5LA 5T4EA 5ALVA 2VJBA 4B9EA 5IKXA 3QPCA 4B0OA 1E66A 2XT0A 3TJMA 2JGKA 4X7BA 3SX4A 4A5SA 2HU7A 4GW3A 4K5QA 1A8UA 3WI7A 2C5FA 3ESCA 2PSHA 5ALKA 4C4ZA 3F67A 1LZLA 3BJMA 1U65A 3FNBA 4IHAA 5C7YA 1QGED 4EA6A 1CUWA 1M33A 4PO3X 1U8EA 1X70A 5ALTA 3IULA 1DU4A 3G7NA 3WWEA 3WKAA 3C8DA 1UT6A 4LYDA 4OSEA 1TQHA 2HA4A 5HZGA 2WJ4A 1Y37A
chains in the Genus database with same CATH superfamily
1XDZA 1G291 2XLBA 3OQIB 5BVHB 1SZPA 1E5TA 4N5LA 4DB4A 4KQEA 1DQRA 1VHQA 3ZVRA 2NSYA 1YI8A 4XR9A 2OYCA 3U3RA 4EITA 3CG4A 4DXDA 4ZYTA 2P6RA 2LRHA 4Q5IA 2ICAA 2I78A 3L1HA 1ETUA 5LA6B 2V5UA 3HE3A 2FEKA 4L72A 5DN6A 4C5AA 3CKYA 1XROA 1XRLA 3AUYA 1I3CA 5TV2A 1EFAA 2FZEA 2P8JA 1BH2A 2XB8A 4C0KA 1V5FA 4EI7A 1ESNA 2P9CA 4IG4A 3ZBPA 1GPMA 3HABA 4I9HA 3C15C 3FHJA 3HRKA 4M2LA 4NU8X 4RQUA 5EJAA 1XJQA 1KO4A 1N3BA 2OHJA 1UXJA 1UJMA 3AIKA 2Z2JA 1VJGA 4N82A 4BLSA 3MQ4A 3H5VA 3NM4A 2WV9A 3UFXB 4G0XA 3HG7A 1WZCA 1RWMA 1T9GR 2IZZA 2J9FB 3KLMX 4HXFB 4L07A 4LJAA 1WSBA 4JDPA 5AW5A 2QI9F 3B6JA 3FRHA 2A58A 3WYCA 2DY0A 5LVAA 5JOQA 2HV9A 4ZU1X 1H9AA 3V1TC 4L9AA 2IY7A 4HSGA 5AM4A 5GAJA 2IDMA 1K97A 4GQIA 1DIHA 5HKKD 4NZZA 4YRZA 1BDMA 1M10A 3PX2A 1X2EA 4Q19A 4LRWA 1VSBA 3JASA 1D07A 2C8VA 1V5EA 2UUAB 2I91A 1L2TA 3TTUA 3UWMA 3IQDB 3KOOA 5IEJA 1RPJA 4O1HA 3AR3A 5H5JA 1ODCA 2C4VA 3HYSA 3NRJA 3BK1A 2YUTA 4TQUS 1CS0A 3PKZA 5C35A 3VPAA 2FVYA 5IBPA 5AVXA 3DF9A 1EUYA 4XQEA 4QEZA 4ALNA 2AN1A 2Y1KA 2HC9A 2R6AA 3N1UA 3CHYA 3ZHSA 3JWJA 1XZNA 3CH4B 3R0QA 4FU0A 1JAZA 2ST1A 4ZVLA 1YDHA 1RTTA 1QHHA 4JB2A 2C8KA 3HSKA 4Y2UA 1G8MA 1JG2A 3D0QA 4CT4B 1ONOA 2CHEA 5JWHA 1ARZA 3JWPA 4DBLE 1F20A 2XOKD 2C5LA 1Y6JA 3JQAA 5FIUA 2PVCA 4CM5A 4QU8A 1J2YA 4ABTA 1N8NA 1EHIA 2PXAA 3G9TA 1SKBA 1VL5A 2ZIEA 2FP4B 3M6WA 3TPFA 1RJWA 3DGFC 4PZEA 5K45A 3KUDA 1DIRA 1H6BA 4YJGA 1HY3A 3BWXA 4OHFA 2X41A 3OOWA 3E5NA 2ORIA 5U4QA 5B2ZA 2A57A 3TEJA 4OK6A 1AXEA 2P30A 3HPRA 3FWZA 4NNOA 4WIAA 3ZHUA 1UP4A 2FOIA 3I53A 1MAHA 1SCNE 1JKJA 4M54A 5LC1A 1GCGA 3ZK7A 3FLBA 3RTGA 3BE4A 3OICA 4KRGA 1ELOA 1Q12A 3O8BA 1AKMA 1QNFA 1TW2A 1Y4AE 2QYHA 3JWEA 3AHEA 3ZW9A 1HT0A 4NHOA 3WV4A 4JLNA 1E8NA 1JXAA 1JEEA 4QUGA 4EPVA 3FI9A 2I6XA 4Q3BA 1E1YA 3QTTA 4JBYA 1XLTA 2P90A 2V7BA 4H6PA 4S24A 4GM1A 5D6NA 1OYVA 1UP7A 4C7VA 4G4SP 3MLAA 5DRTA 2PJZA 1UMKA 4G0NA 1F6WA 1SD5A 5BV0A 4C2UA 4OQMA 3Q3IA 3HCBA 1JHOA 1RKQA 2WDZA 4CM9A 4BWFB 2FWAA 1Q16A 1GTZA 2D2IA 3WGGA 4JL8A 4JR0A 3O95A 5JCZA 1VKJA 2ISSD 1GL7A 1VE6A 4KQIA 3T1VA 2H2IA 3GLGE 3K9WA 1K08A 4GWLA 4TKVA 3Q5EA 2XMQA 3EXAA 5IMBA 3VOSA 5IDYA 5DRYA 4I1IA 3V1NA 1VRCA 1ZGGA 3C4JA 3KQSA 4I6EA 4J3FA 2H5EA 4UXIA 5HX7A 3ILXA 4F72A 2GTPA 2GZRA 1NVTA 5EYPA 4CTKA 2O48X 4I9NA 1TM1E 2YYYA 1KZ6A 2VDQB 2FY8A 3R5FA 5EIHA 5HK9A 5B3KA 2GCGA 3WYDA 1IUPA 4ZT6A 4PSDA 4M89A 3GLHA 1BGWA 1I4LD 1ZGAA 2R7MA 2PTHA 1PQYA 3LC0A 3TD6A 1RM3A 3KL2A 2I80A 1SG6A 2WU8A 2C1EA 1T8YA 1S7GA 1OREA 1XZGA 3KZOA 5H02A 3SYNA 4WEQA 3ISJA 4TM8A 1RI4A 4X6LA 2PR7A 5T3UA 3SBDA 4AJHA 4D0RA 1G21B 3UPTA 3WQRA 3P1JA 1ZN2A 2HM7A 3PDIB 1RQLA 4OHKA 4G4IA 1Z3IX 2HYIC 1EBFA 3D6FA 3B7GA 4JBWA 2C5BA 5IYZF 1S3FA 2O06A 1O95D 2EKDA 3KLBA 2HIGA 4ATNA 2AG8A 4F6LA 5LPNA 5DBFA 2WPNA 1ZL0A 2IU0A 3FPKA 4F1JA 4DANA 1A96A 1BDBA 5FR1A 4XCVA 3OI7A 1DO8A 5SY9A 4PYMA 5JAHA 2R5WA 3ONDA 5LP6A 5CLIA 4TXHA 3WYAA 1TECE 4MICA 3GZJA 1N4AA 4CLRA 2BEWA 2GK7A 3NHMA 4PS0A 5IAAA 4K9DA 5AW0A 3B1ZA 4Q3KA 1NBAA 4TWZA 4EW1A 1YT5A 2YXPX 1FRQA 2I1WA 2H65A 1DWUA 3ASYA 2N9UA 2V55B 1TF2A 3RJ9A 4PPGA 2BAGA 2H6EA 4YK7A 3ICPA 1T2NA 2QUKA 3BYZA 3GBSA 4V38A 1L1FA 4DV2B 1N6IA 1PZEA 4WZZA 4ZO9A 1TIKA 1C7JA 4YUZA 4W5OA 1XFAA 1EA5A 3HADA 3QENA 4X95A 2QTRA 2GXUA 3GVXA 1OLUB 2DFLA 3BCUA 1F0NA 4HADA 1NJ1A 3PNBA 1L9KA 4B45A 1R5NA 4FQ5A 1ZA1A 4H6XA 1SPBS 3COPA 5HF6A 4YJGB 5HIIA 2P91A 3MFYA 2GETA 1G59A 5BWOA 4KN5A 3T06B 2K6GA 1LX6A 2Z4TA 3MAAC 3RTCA 2WU0A 2XMRA 4XVHA 4P32A 5DX8A 2PUCA 3A31A 2G3YA 5CGZA 4N54A 5IYZA 2IUSA 5CIYA 2BGJA 1A71A 1NVFA 1HG0A 1ZQ9A 2P79A 1U04A 1Q0ZA 3EXEB 3F6SA 4LGVA 2I2WA 1M7HA 3JAKA 4KPUA 4KWEA 1L7NA 3E7WA 1L5NA 4JX9A 3SJ7A 5IFKA 1SOMA 2UUCB 3DVSX 5BR1A 1EXWA 4DUYB 1XMOB 2GRUA 1UDBA 1U28A 2I65A 4EZBA 4PQGA 5DHAA 5BW5A 3N58A 2P7HA 5AVOA 5HFJA 1Y7TA 3RYHB 1XRSB 2RGNA 1CQJA 4BDSA 5BN5A 2REBA 3NC4A 5KQGA 1FUKA 1LLQA 2YJ4A 3AU8A 4RUKA 4Y2PA 2VHEA 4LQDA 4QULA 1NMZA 1NT4A 1AMOA 1NI5A 1L0BA 4RKEA 3AF6A 1UPUA 1Z74A 1ZI6A 1N0HA 1WDTA 2Q1TA 1SB8A 1T13A 2L82A 3IT1A 4OUDB 3K0SA 2CEAA 5DP2A 5K4HA 2IXFA 4LJ7A 3CLTC 1ZJ5A 3VX3A 1T5BA 1QPGA 3KVRA 2B4RO 3W6OA 4QOSA 1P0MA 5KVVA 2A0XA 3ZWWA 1R18A 3ZV3A 2MYNA 3VNQA 1UPAA 2RAPA 3EXIA 1ZHOA 2J33A 3B53X 3WK8A 3EVCA 2H1CA 4D5EA 1XDUA 3KOYA 4C0BA 2VYND 3VKFA 2V6JA 1HK7A 5AQ1A 5LMNB 1JV2B 4TUYB 3WV5A 1D09A 3HNRA 5EP4A 1ZPDA 1VKRA 3I32A 5IKPA 1NVVR 1RYZA 1LUAA 2LDXA 3KPJA 4ZFNA 2W6ID 2ORYA 2QW8A 4FINA 3H9GA 4JI7B 1Y81A 5B7QA 4FS3A 3SEAA 1CF9A 3ECSA 2V7GA 4MEBA 1NNLA 2CWWA 9ATCA 3BDAA 3MGKA 3FRIA 3GAMA 2P75A 2J3DA 4NS4A 2LBPA 2XX3A 3ZV4A 1GGFA 1FU8A 3R9XA 5AJYA 4GE3A 4WKCA 2P3LA 2W6PA 4J8PA 2IYYA 3ZH9B 1N4DA 5KVSA 4LXXA 2WJPA 3R5KA 1M2EA 4XIGS 1GA1A 5CDHA 1IZ9A 3RVBA 1EGMB 4RAQA 3D6NB 1EUDA 4DLKA 2G77B 4QXMA 3PEVA 4PSCA 1DRJA 1RVV1 5ITZB 1LJLA 1Y3CE 2V96A 3W8EA 3CLSD 4K6FA 5AUOB 1VE3A 5E6RA 1A2KC 1L3BA 2WC1A 3HACA 4G24A 4Q21A 4ZMBA 1VB3A 3CXRA 2IITA 3ICVA 4CZ2A 4E1BA 1YR1A 4UU1A 2ZYAA 3GLQA 1WW3A 1T2DA 2BF4A 5TEWA 4RIEA 4BP9A 4EF4A 2D59A 4PRZA 1JPVA 1PR6A 3ZHYA 2FW1A 4XQ9A 1Y8QB 2GN1A 5CT9A 3IMFA 1QHIA 3GWZA 1UKAA 2FSVC 3ADOA 2AIRA 5IARA 1TCCA 1G5TA 3LY8A 4LHYA 4M1WA 2WE8A 3O8OB 1V4NA 3TL3A 5F3WB 2NUBA 5EJ6A 2IL1A 3COZA 4E2WA 5C32A 3QY9A 2ZYWX 1NY5A 3OJFA 1NLYA 1N6NA 1ZP6A 4LC0A 5K1ZA 4O02B 3LD9A 2B8NA 1UBMS 1DG9A 4F1KA 3UJHA 3HI4A 4FFRA 5F73A 4KMMA 1YRQA 2FK7A 5I7RA 3ZVMA 1C1YA 1E8DA 1KVRA 3E23A 2PSFA 1CRLA 1NULA 1R66A 1YZVA 4K3VA 4RYLA 4YBZA 4Z51A 3P52A 4Q9LA 1TEHA 3MELA 2HT1A 1OF1A 2K87A 4KX3A 2ZIFA 3QX7A 4D4HA 1JZQA 4FLMA 1TQ6A 2FRDA 4LS3A 2QP4A 4CW7A 1SCUB 2X42A 1Y7IA 1VSTA 1U0JA 3W5BA 5IP5A 3H4MA 1WPXA 3DC2A 3HBAA 1ZOPA 3PR1A 4FVTA 5B1HA 4HUTA 3RSZA 1DIGA 4TSRA 1PU2A 3BWYA 5KAPA 2FK8A 5K5EA 1PYGA 4OP2A 2P9FA 2JFHA 2YUIA 2VYVA 3H86A 4BVLA 2FSGA 1SBNE 4UMVA 3A36A 4OK5A 4YMIA 1XL1A 4WK4B 1RJFA 3CNNA 3M4ZA 3VR2D 4ZYLA 2NZYA 1SN7A 2CLLB 1YD7A 3DB2A 4OGFA 1XPUA 3PXBA 3KEQA 4BYMA 1EM8B 3PHHA 1ADYA 4WXYB 2OXRA 2Q4DA 4KR0A 4FR0A 3ZOZA 2EGHA 3GMDA 1L6IA 2JLYA 3HYLA 1SOVA 4L22A 4OU4A 1J9ZA 4HDNA 4C04A 2VHXA 1Z29A 2Z2IA 4S04A 1B3BA 1KJWA 2WPDD 1X77A 1DQPA 5A0VA 1LBIA 3QXXA 3HJCA 2SCUB 3U56A 5U1PA 3W5DA 5EMHA 5EXDA 3E35A 5CG1A 4KNYA 4E5SA 1B16A 4TL8A 2ZRBA 4FGJA 1FP6A 1V9LA 2XCLA 2M6LA 1RWOA 3E9ZA 4MGZR 1FSZA 1T0IA 5KYTA 3PYXA 4AQ7A 2WRZA 4GX5A 3U44B 3AR6A 3LO5A 1EQ2A 2A0WA 1P0CA 2IW3A 2VSOA 2VHCA 3PXCX 4DL9A 1RQ2A 2CDRA 3IX7A 3SN6A 4D4LA 1AZLA 3EISA 1Z06A 1UJNA 1ZAKA 3SU8A 1S2IA 4Y2XA 5G02A 3SEQA 2H1HA 2X6RA 3RG2A 5I47A 2IK8A 3KQWA 3MPUA 3F0TA 1PKXA 3TBHA 4Q34A 2R9VA 5BWBA 5K8TA 1HYQA 3BSSA 3CLUD 4ZYZA 2J0QA 1FXUA 3QUAA 4X84A 5DHPA 2PSJA 4RY0A 3VA7A 3USCS 4DDWA 5T41A 2P0EA 6REQA 4MR7A 1H66A 3D6JA 4PPYA 5H3CA 5A3SA 3DR3A 3A6EA 3F97A 1U9CA 4BFCA 1B2RA 4DIDA 4JLPA 2I6FA 4L4RA 4L2IA 4DUGD 3P45A 4U2CA 2BFBA 3G2QA 3VPFA 4CMHA 2DF8A 4GKBA 3H6KA 4HZIA 4X63A 4YWJA 1IDN1 5JD3A 3RLIA 1OZFA 2GD6A 4G5RA 3NW9A 2GKSA 4HOYA 4NYMR 4EZEA 3KJXA 2FPUA 1CUFA 4WFIA 1P1CA 1WZEA 3LRXA 3MS4A 4RLQA 4WXHA 3VR6A 4BNIA 2YHIB 5KJFA 3A25A 3FPSA 4AC9A 1OH7A 1WV0A 3WYBA 1NVBA 3LCRA 4ZZIA 3O2SB 1EJBA 2DJIA 1EDZA 1KU0A 3CN9A 4LMRA 3UFBA 4DMGA 1KDOA 1BC5A 1P0FA 4OJKA 1W4ZA 1BW9B 3THXB 4AQDA 1BG6A 2JLCA 4BV2A 1V4BA 3OLZA 3WO1A 3DKIA 4MH0R 2PX3A 3A9RA 4QXOA 4RV9A 3NHLA 5G40A 4FEGA 1THMA 5FDFA 1VXRA 1YB7A 2GA8A 5AJWA 2OCDA 1OUMA 3QVKA 4F93B 4MARA 2X8AA 3NHKA 5JYEA 2ZVPX 1NJSA 1BMQA 3LA6A 3RC7A 2QMHA 3VPXA 4EVRA 4KQ9A 3HBFA 1R7RA 4WT7A 4RXMA 4D6PA 4EJ2A 4HF7A 1TQ8A 1DNPA 2AEEA 3MRTA 1PZGA 3PYLA 2PZBA 2XAAA 1X80B 4LBWA 8AT1A 3PXAA 3FKQA 2HTEA 1ZUIA 3WIBA 2JCVA 2V4ZA 1MT0A 4ZVVA 3HGTA 3QFFA 3PFNA 3HU5A 3L0BA 2AI2A 3OA0A 4RZ3A 3AEQB 4WZAE 3T7DA 3ZDYB 1KBQA 4GZLA 4RKRA 4F2GA 2CVZA 1ZVKA 2PTGA 4HDKA 4QYWA 1Z0DA 1SKQA 3TCXB 1O1YA 1P9WA 1Q1QA 3CISA 5HMLA 4YAUA 3WFIA 3JYLA 1KAHA 1ZS9A 3FIUA 5JMPA 3TZHA 4B8WA 2XUZA 1XKLA 3RV3A 1W2HA 1XTRA 1XTVA 5ADWA 2OBBA 4JA0A 3R1IA 4RVNA 5L3QA 4RL4A 2KLBA 3UHOA 5EKSA 2HWWA 3IEMA 4HEA6 2PFKA 2C4UA 1Z2PX 4Z2YA 2B8EA 3CRQA 4P4UA 3HL0A 3OIYA 1E2IA 4OHOA 2EZ8A 1E5LA 2Z57A 4ZIRA 5I7AA 3U16A 1SM4A 3GUZA 3GNTA 4FGWA 4Q01A 4FNMA 2QMQA 4JQZA 5JD6A 1TCUA 3R6GA 1DDOA 5FWYA 4UUBA 1DXHA 3TQSA 2EARA 1QZUA 2PWAA 5DM4A 3E81A 3IPAA 5C53B 2IYVA 3L0OA 4AFNA 4FFOA 4JLAA 4MS4B 5HIMA 3AKCA 4O2BB 4D0GA 4G84A 3R8XA 4EM6A 1G3IA 1Y8RA 1ULSA 2ZBUA 1PFYA 2RJNA 4HGQA 2AT1A 1LBTA 3E5HA 3QPUA 4V3CA 4ACAA 1VJ5A 2HT6A 5JUWA 2IHNA 3CCFA 3H4VA 5J5VA 5I4KA 3KQKA 2BWJA 4RWEA 1XLUA 4CL3A 5EIAA 3QWHA 4B3IA 2PA3A 3LYHA 1U28C 4J3JA 5LZ4A 4DV0B 2FZ5A 4BFLA 1YJAA 2RARA 3IERA 3PP8A 3IHLA 3M1IA 2Q3FA 4HYEA 3U3JA 3ZD9A 4Z49A 3T1YB 1H0SA 3W2GA 5B58C 5EP1A 2PH7A 1F38A 3SF8B 1NBIA 3R8CA 4JYPA 2BSAA 1GZHB 1ZMXA 2JAQA 2XUDA 3WKBA 1KRXA 1T10A 4W63A 2XSZD 4JBIA 1V8OA 2H5JA 4JLSA 1QKIA 1V9CA 2Q6KA 4J3NA 1Z4MA 1GL3A 1XHFA 3EK2A 5EHXA 2FE1A 1T4CA 1GN9A 2XMZA 4RLHA 3A1FA 5L4NA 4F56A 1CZNA 3RVQA 5H9WA 2IGBA 4HC4A 5L95A 3RNLA 1N1DA 2DTEA 3K15A 4BMVA 1IBSA 1WCYA 3BHMA 3DEHA 4JJKA 4EVQA 2R6ZA 2FZVA 3ZHXA 1UDXA 4MPTA 4GI2A 4TUYA 3DBOB 2NGRA 4M4SA 4UZEA 4ZOAA 2Q7XA 1P6QA 1SFRA 4UTPA 3N2EA 1QAQA 2B4QA 3BJRA 4PNHA 1T2EA 3LP6A 1OB5A 4PO9A 2H0QA 1Y89A 4ISCA 2IVFA 2LCIA 1CHNA 1SUPA 2VBIA 5G2OA 5A6SA 3RT1A 4LY6A 4JXKA 3B1WA 1CLEA 4HN2A 3ZIAD 1SBHA 2VC2B 1XTBA 4MRMB 4P22A 2PRIA 3L6OO 4HDMB 4EBFA 3KIPA 2O8EA 1AKRA 4ZDIA 3WLNA 3RBAA 3DHYA 2FKAA 1A5BB 1OGJA 4W5TA 1IHYA 1U9JA 4O3FA 4X64B 2PM8A 4QELA 1O6FA 1U8FO 2BEVA 3L1VA 1P4AA 3K2IA 2P11A 3JYOA 3RJTA 3SFZA 1MIOB 2FPLA 1N2ZA 2P78A 1R5BA 1KH1A 1D2CA 1NSFA 4HEJA 3O5AA 4OPMA 3T6KA 4LCEA 3T5MA 4IY1A 3IQIX 3KXPA 4RS3A 2JPDA 2O14A 4G8JA 4Z8XA 1MPXA 1BCRB 3PCXA 2NZ2A 2ZJBA 1QH1B 1O6CA 1RCFA 3GLUA 4NNJA 4F4FA 2N1MA 2EC5A 2ILTA 4CTMA 2AJTA 2CNNA 2O54A 2LZ0A 2JRLA 4RHYA 4NDAA 4BE7B 4UAJA 4RTNA 4KDFA 2WVGA 4EG7A 2PIDA 4RM3A 2H0AA 2DU8A 3CVOA 4IQ8A 1YVUA 4IH4A 5FOXA 4X1YA 1B26A 4AF6A 1XQ9A 2C88A 5E4FA 4NI5A 3MWGA 1U8XX 2VJMA 1PDVA 4I99A 1WTAA 1U8TA 3VVCA 2BJHA 3O8QB 4XQ0A 2NXWA 4PSUA 4G9EA 3OX1A 5JPDA 1Y1PA 5IG2A 4P33A 3TLZA 1OYWA 3UANA 2P8SA 3H5TA 5JG7A 3DOFA 2CFRA 2MSWA 2X2PA 2O2DA 3D7MA 4ZICA 2QM0A 2YJNA 3L5KA 4LUCA 3RDPA 1U80A 2FF7A 4OXKA 2EJUA 2C9ZA 3FTPA 4K87A 5BURA 1KY2A 5KWEA 2VHWA 4PG8A 1EFRA 3GLTA 4UJ5A 5HTKA 2A6PA 4PQEA 2O23A 5AKZA 3UUEA 1UBCA 1H1LB 1XAGA 5JVDB 5C1IA 2KE5A 3HYTA 3OM8A 4PXSA 2FRDC 5E8JA 2IUYA 4PQFA 2O2IA 3JZFA 2DQZA 1EXNA 3GFVA 4RPIA 2OAP1 5E9WA 2OR3A 3FNRA 4J4HA 4TSFA 3RVOA 3SEZA 1I6LA 1U2QA 2WJVA 3RJ5A 4J7UA 3I9KA 4YXWD 5ES4B 3VHXA 2LW7A 1OV4A 1FNDA 2WSMA 1NA5A 1RYYA 1T2VA 3MN1A 4XYLA 4Q4CA 1N5KA 1KZHA 4J0JA 2V4MA 3WYNA 5LJLA 2FQXA 2PH3A 1CR2A 3TBKA 1GSHA 4TMVA 1Z35A 3P9YA 1O97D 1V8DA 2JAOA 1HDGO 3CE9A 1HE4A 1NU6A 1AVTA 2VUSA 3FOWA 2JJ2D 3AF4A 3GO4A 1IHXA 3CT4A 3HHEA 3KJGA 4HAZA 4JUAA 5LIPA 1Y1KE 3LI2A 3PGLA 4NAHA 4TRNA 2WHXA 3QU4A 3K31A 4TVBA 1Y3HA 4FOSA 5KYXA 1BS1A 2H7YA 2V74B 1WUIS 4K1XA 5ERXA 2EFCB 1ICEA 1RE0A 1HZZC 1JIQA 3CF2A 1EFVA 2B83A 4FZ3A 2DSTA 3I4LA 3ZJVA 3IESA 1BWPA 1YS1X 2A84A 3HU1A 4IHKA 4GXQA 1CUGA 1XVIA 1Z6GA 3VNRA 4C3UA 3S68A 1QORA 5DSXA 3OIWA 5KNBH 2NO4A 1IJKA 1V6CA 2FN7A 2IBTA 4QEDA 1D4ZA 1VIMA 5HKLA 2QTHA 1J33A 3GRPA 3KKZA 5KKCA 4DZZA 1C41A 2D5CA 2OORC 4JH0A 3F90A 2FW6A 3PEFA 3ER9A 2X0IA 3NPMA 1ONNA 4LKOA 2ZTUA 2WSSA 1S8NA 3CR7A 2XZOA 1T4DA 4FN4A 1QZ3A 4IZ6A 3JARA 4KBFA 3AVWA 4YAJA 3R9XB 4WJKB 2FVXA 4Q1CA 5IU6A 3LUAA 5HRUA 4PRKA 3H5AA 3P2EA 4V0MA 4JXZA 1E8MA 1KXZA 3VOBA 3BEDA 3D9QX 3ABQB 1HYBA 1NMYA 2Z5LA 5WRFA 2C58A 3D2BA 1GJRA 4G5HA 3KSAC 2WJWA 1L9XA 2UDPA 3EGCA 3IA2A 4BASA 4C3OB 4UDNA 3KTDA 1UBEA 1ZMTA 1JHAA 4FNOA 4FHGA 4BO2A 3BS4A 2DXIA 1NV9A 2W6JD 4D56A 2IH5A 5T64A 3Q7IA 4FB4A 3LPLA 5IHXA 5BSGA 5FTJA 4R41A 4IOMA 5AK5A 4KTTE 5H16A 3DMRA 3OIDA 4JB3A 4KNVA 4Z5XA 1WX1A 2DHCA 2BHNA 3AEKB 1XCPA 4NDZA 5KQPA 2OOKA 2XMDA 3MCZA 3K30A 4R84A 3S3TA 3ZQUA 5A7HA 4KWHA 4BMPB 1ZH6A 3PU6A 5T6BA 4FONA 4L57A 1PL8A 1M1YE 1SIBE 2DULA 2I6UA 1UP6A 4I14A 4BRWA 5A3RA 1BHSA 1KEVA 5TGTA 4E2YA 2OP0A 1DX6A 1Y6GA 2G6TA 5CVTA 1T36A 2IPAB 4TTAA 1DSSG 1Q1ZA 3OE4A 4NCNA 3V8MA 2F64A 3VDRA 2JKZA 1V16B 1CUJA 4QGAA 5HS6A 5A6SB 3SYTA 3KKMA 3UB4A 1Z0SA 4P4LA 3JZDA 2RKWA 1PQPA 5FAXA 3KD3A 2BDEA 2CLEB 3GOQA 3I12A 4CV1A 4BKOA 5CXUA 2JBWA 1BH6A 4NL4H 5FBQB 1YI1A 4ED9A 1V6SA 4HN4B 2WP0A 4C0WA 4J0DA 3UJPA 1C30A 3M6VA 1FP4B 4PGGA 4AF7A 2EBHX 2ONYA 1MX3A 2G08A 1QHXA 3WG9A 1QE5A 3UMMA 4I1PA 2A1UA 1KPHA 4WRRA 4EAQA 1KQPA 3KUCA 4Q9AA 4BFWA 4J2OA 1LI7A 4ZDWA 3A9UA 2AUMA 3AUXA 4OJQA 3UCEA 1QC5B 4O4LF 5J3JA 5CT8A 5IVDA 1PEKE 1OH8A 3GMIA 1AD2A 3F6PA 3QKIA 1BQEA 4LQ4A 2CNDA 4CKYA 1NG9A 5TVGA 1E69A 4P08A 3KFLA 4TLAA 3KJIA 1DRVA 2VNJA 4QDXA 4Z7JA 3NVDA 1RFLA 3LUCA 4NE9A 1IRIA 4Q37A 4Q3EA 4F1WA 3L0ZA 4RY8A 5JSZB 4IW3B 4XKJA 4DT1A 3RAEC 2XUAA 1O96B 2QJWA 4BVAA 5K3FA 1K5DA 2AFIE 2LR0A 3ADPA 4QLAA 3V8NA 3HB9A 4GIBA 3VZQA 4P4GA 3K5HA 1QS0B 5BPHA 5K6RA 3DOCA 1TTQB 2QG4A 1WKBA 1W5AA 1PR3A 5HMMA 4Z4HA 1DE0A 3FZEA 121PA 4RNDB 1A77A 1CUXA 1H4SA 1R27A 2GBFA 4HGYA 1N5OX 3NXSA 2WT8A 4WD3A 3JS5A 4JT4A 1PEDA 3HWRA 2IYSA 3A1VA 4TOIA 5IVIA 2IUEA 4YHHB 1QIIA 1JFSA 1BYIA 2TMGA 4HEQA 3ZKAA 1ZVQA 3K72B 5REQA 3E9MA 1ECLA 5C4GB 1OLOA 1XJ0A 1TXGA 3FZYA 3Q1LA 1DPFA 1E63A 4MQEB 2CWDA 5JT1A 1YQUA 1KK2A 4FW9A 4ZVQA 3BE6A 1NJ2A 4RMNA 4GQBA 3OKCA 3IQZA 3RVMA 4ZODA 3L6RA 3WIUA 3MTEA 4V0RA 4IIEA 3EOBI 4P3PA 3VC7A 5MDHA 3RTAA 5TPWB 2ZXEA 1TW3A 4KLAA 1M5TA 1XQYA 2BKXA 2XAUA 4KYTA 4B35A 4CIDA 3JD2A 3RNOA 4RC9A 2VNKA 3BXFA 3VKGA 4OLHA 4DQKA 2GCNA 1A5SB 3CRRA 3S2ZA 5HTOA 5LM3A 4QUDA 1I7DA 1ZVVA 3R6WA 3DHEA 2YN0A 4NFYA 1B6RA 1EP1B 1L1EA 2E2WA 3R09A 2YASA 4PQYA 2IHKA 2FJPA 1QK4A 5J43A 5F1KA 3CNEA 2BTOA 3ET4A 1JA9A 3EVGA 2UYQA 2PKCA 1KIFA 1UJ2A 2GVNA 3PDWA 4K1LA 5EYPB 3SQOA 5BQ5A 2X4IA 5HE8A 2YMPA 4ARVA 5CEEA 3VH2A 2VI5A 2W11A 1ZN9A 4XGNA 2HSJA 5A04A 2HBYA 4PANA 4GDFA 1FQOA 1H6DA 2P3QA 1AUXA 1TDJA 4NJMB 4PX3A 4RA6B 3I42A 1J25A 2W5UA 1JEYB 2AEJA 3G5TA 2NUPA 2BHRA 2QVBA 5AXCA 4DA6A 4DC0A 5C37A 3TVTA 1O2DA 4R3WA 4FX2A 2DYKA 3BHJA 2BYTA 3CH5A 1K7YA 2Y0DA 5C8DA 2Q9CA 2IYAA 2YHUA 4WXMA 4HJRA 2LXNA 5M7EA 4CLOA 1IXRC 5TMBA 4N5IX 1CXZA 2JB9A 5JQGB 3O1LA 4TLBA 4YREA 1IN8A 2XKBA 4ZRMA 2CJXA 1Z0ZA 3SIXA 4MB2A 1E64A 2NADA 2XMSA 2GCOA 4OM8A 2WYOA 4LZWA 3T5GA 4EGSA 2FFAA 1A72A 4NCXA 1EGHA 2ZFUA 1A8SA 5CM8B 3NM5A 4GX0A 4R9UC 3GW8A 3P8ZA 4C08A 5E9AA 1CUVA 1O08A 1QK3A 2V3WA 2MSEB 4F4DA 2EQBA 3WZLA 2OFXA 4HH3C 2WAXA 3LY5A 3TZ6A 4CMEA 4EG5A 5EHZA 1I9CA 1CRZA 2DR0A 5KSPA 1MW9X 3RIXA 3COJA 3JRNA 1QIMA 3HDVA 5IJXA 4XDZA 3V8VA 3LBHA 1F3LA 1MDFA 3QEMA 1PGQA 2LNDA 1MB0A 1R74A 1X7HA 5EZYB 4LF4B 4JKYA 1UDCA 4QTYA 1PL6A 4UPEA 1OOEA 5ICCA 4NYJQ 4GDMA 2QG9A 3HEAA 4MEAA 5EP2A 2BFPA 1XMVA 1OGIA 4MKZA 3I8XA 3NG1A 2QYSA 5TS3A 4AL4A 4R1NA 4V02A 4HWKA 4R1PA 1VCHA 4R1MA 5CVDA 1NKVA 1Z75A 3EZGA 1BVHA 3OWOA 3O38A 3DOJA 5IBCA 4X1KB 3MMZA 2O1SA 1DFIA 2QTBA 3O03A 1TIBA 4OSPA 4D3XA 1GGKA 3DL0A 1JQ3A 4GEGA 2C9MA 1DOZA 3NP9A 4WN9B 1NXSA 3LECA 1IVYA 4LX0A 3L8CA 3HJRA 2J9XB 3L0YA 3T9AA 3VHRA 4QU9A 2G88A 2OGUA 4M36A 4P3YA 3DLAA 2G9VA 3DCYA 4KK3A 3SQDA 4ZOBA 3U9LA 4MLDA 4YJFB 3SZMA 3VQTA 1SB9A 5IJ0B 1ZM9A 2O0HA 3RIYA 2FWMX 2PU7A 3PXGA 2CGEA 1ZJ4A 2JEOA 3QF4B 4L0QA 1MC5A 4P0QB 4OJNA 1KEKA 5GOTA 1Y5RA 3FTCA 1B6GA 4Q3DA 3WJAA 1MX1A 1ZRSA 4RF4A 5BSRA 2WA1A 1NUQA 3KKQA 1GXSA 1LDBA 4OB6A 4W7HA 1W8IA 2R7NA 1ZVJA 2O8BB 3CJTA 2QZSA 1C8VB 1ZOOA 4IINA 4LSWA 5G3YA 1OAAA 3DO8A 1IZ7A 4H7JA 1OSNA 3FYTA 3UH1A 2C3OA 2IVZA 3K20A 7MDHA 3IP5A 2ZQZA 5JH7A 2IPNA 3PK0A 1Q74A 4BWYA 3HBLA 1ZM4A 5CDGA 3P2OA 1P9NA 1TIPA 2KHZA 5IN5A 1XGKA 1WW2A 2FFRA 2QT9A 4H7EA 3ZXUB 4FYKA 1HZZA 1AGRA 1E3WA 3M8KA 3THWA 2O2YA 1SVMA 2ZYTX 3EVFA 4ZVKA 3OHMA 4EH1A 4V0SA 4ASUD 4G4GA 4OTZA 2V7QD 1M8KA 3Q0IA 1UBSB 1JRLA 1I1OA 5EHNA 1DC8A 3L4BA 3NJ8A 3T4PA 3LX4A 4IOLA 3EE6A 5DNCA 3DAHA 421PA 4CU5A 5KMGB 3F6RA 1JHXA 1TCVA 1Z33A 1E1KA 2QR3A 4ZP1A 2R6GA 2D54A 2OORA 4OA5A 4MRAA 3TW0A 3WDSA 4ARSA 4GI7A 3IKTA 2YJGA 4TZ6A 1ZXXA 4KXNA 1G1AA 2HXSA 4DA0A 1DI0A 1Z8NA 3JQPA 3SIPA 2H11A 1ZH0A 4DCCA 2WG2A 1RBZA 4CFZA 3FFXA 3B48A 2RONA 3M2PA 1J2TA 2G1UA 3A58B 4OYRA 2VIIA 3HEBA 3HXLA 1ZRNA 3FUWA 4UFPA 3IDSA 5LFAA 1DIAA 3EBPA 2CYCA 1C1XA 1KSFX 2VUTA 1KGSA 5J2TA 4FTWA 2WDPA 3FNFA 1A2QA 2A5FA 3HY3A 2MINA 2JLVA 1HETA 2NOAA 2FHSA 1G98A 2IHVA 2CNWD 3KUKA 4AMBA 3IDZA 2PMFA 2QMYA 4LDRA 2WUVA 3OHSX 3NPAA 3UA3A 1BX1A 2O3UA 4AG5A 4AYXA 1SCBA 4ZCMA 1JVSA 4N0PA 4OGGA 1FK8A 3RAFC 4FHEA 3UJ9A 4EI9A 3JQAB 4K9PA 3RFCA 2B61A 3TMKA 3PXEA 1JEJA 4IS2A 4BOYA 4C3VA 4DILA 2AR0A 3JD3A 2BM0A 1HRKA 5DYIA 1XTKA 2CDAA 4KLZA 3U37A 4HB4A 3VYRB 2RBGA 3HR7A 1P4RA 3LHSA 3QF7A 3T7AA 5LDDC 1T8PA 2O9JA 3SDSA 3KV1A 2DAPA 5K0TA 2WABA 4DMLA 5BVGA 4QXQA 5KTMA 1K6XA 1BEZA 2B30A 4ZT7A 3EXHA 2R6FA 1GDDA 2PLWA 2IDZA 1TRHA 4RO0A 3LQKA 2OMEA 2Q6TA 3KZXA 3RRNA 3NX4A 3BWMA 3GVIA 4N7JA 1QF7A 4DGQA 1Z34A 1QDEA 2VF2A 4L74A 1IG3A 4XM0A 3NEAA 1PJ2A 2QAGA 4I3HA 4DJAA 5FA8A 4KAJA 3SGLA 4F3TA 1KYTA 1UOOA 1GLVA 1S0UA 2VK1A 1I10A 1CY6A 3OP4A 1GXSB 2R47A 1O0BA 4JI5B 4D9BA 4PHFA 2G1PA 1YBAA 4DLZA 4O4IA 5C8YF 2AR7A 2Y68A 1HR0B 1DAEA 1DC5A 1ZWKA 1FX0B 4LZAA 3PUYA 2K4MA 5ETJA 3VZCA 621PA 4LG1A 5IDWA 1UMBB 2HY7A 4U9IS 1JHYA 5JECA 2R62A 3NI2A 4QD3A 5ELMA 3P0RA 4D0NA 3PNOA 5ENDA 4EK9A 1QV6A 2VHUA 1IQPA 5FNVB 3L7NA 4KXYA 5HVNA 4HVLA 4MWZA 3DHNA 4WLNA 5G0VA 4EFMA 5CA1F 1XRRA 1N3IA 1Z25A 2YS7A 3D54D 3NASA 4YLGA 5BNTA 1ULAA 4ZK2A 1U90A 1JJVA 1O58A 2KS6A 3RQSA 4EYQA 4KTVE 1OJ7A 3JQ9A 3NANA 4I19A 1T4CB 3A2MA 4KFCA 3NORA 3VX4A 2XDYA 1Z6XA 2V6IA 3C4VA 5GPBA 1SH7A 2E9SA 3FDFA 4OQ4A 1SU4A 4IJQA 2WFAA 4JVSB 4BMSA 1R0KA 5CPBA 3WTBA 1DKMA 1ORWA 2V7UA 3KHTA 1R9MA 3WNCA 3GX1A 1NI4A 1BGXT 4NPCA 1CUZA 1JMKC 2HA5A 2ZSDA 4MRMA 3VZPA 4I7EA 4D8UA 1D9XA 3L79A 1E6KA 5AKYA 4AMGA 2WZBA 4XB2A 2GEBA 1YOVA 5P21A 4AF8A 1GU7A 5LQSA 2JFFA 1P6UA 4C06A 5ISMA 3EBLA 3CONA 3L04A 2XCIA 5E6SB 1RRGA 3AO0B 3UEOA 4A6PA 2NVOA 1I4OA 5DLYA 1C3XA 3GJ4A 1GEEA 4FZ5A 1OXSC 1R4MB 3OOYA 3I9LA 2FWRA 5FL7D 4DSNA 4M87A 3WQBA 5HZKA 1E9CA 1RLMA 1LPOA 4G8DA 3O2QB 2EFDB 2JK1A 2QTVB 3M3HA 3H17A 3QVMA 3I64A 1C4WA 4CRWB 4UHEA 4J76A 2DBQA 2VQ3A 3NHPA 2D62A 3LIIA 3ZW7A 3DOUA 5EKDA 4ZEMA 4GO1A 5DIFA 5AHWA 4BLWA 3WRVA 1JG7A 1X8LA 5K2MA 3WB0A 1X9IA 1OIXA 2B82A 4MI3A 4QGFA 1NRIA 1YQWA 1D7OA 2VQDA 2NN3C 1ZD2P 3SXJA 5GIOE 3ZDFA 4LE1A 5KJEA 4CF6A 3BTVA 4G8CA 4ZIRB 5IJWA 1TT5B 1FU4A 3TECE 1B0PA 4LTDA 5BRAA 2JLAA 3VR6D 3HYNA 3DTTA 1LW7A 2OAEA 5IPFA 2ZLBA 1PN3A 1NN3A 4C6TA 5B3LA 3GBPA 2X8WA 2BGNA 3VISA 5LDHA 4IF4A 1MKYA 4H0NA 1JLLA 1LBEA 3KM0A 3STVA 3UF0A 4ZI7A 1C8KA 2BDUA 2DFDA 1QO7A 3QG1A 2O1XA 2QN9A 4MPJA 2QK4A 4HT3B 4PAMA 2JLXA 1AS0A 3EA5A 3PXUA 1GT91 1AHIA 1M2HA 2P7IA 2TSYB 2OAQ1 4NZNA 4S1WA 3M34A 3RBXA 1AX9A 5C1PA 3ID6C 4G9GA 4FW8A 3L7OA 1EP9A 3AEKA 4U02A 3LBNA 4URZR 3PHJA 4QYMA 3T95A 3KKOA 3RVNA 2I6TA 2I2CA 2X0KA 2VJOA 1JMVA 2IOHA 3GAZA 3GRUA 3HYCA 1TUEA 3M49A 1WSWA 1XA3A 4KKVA 2ORED 2RKBA 1EDOA 2B8JA 3QUTA 4LRSB 3TQIA 3PF8A 2FQ1A 4G86A 3LW8A 1RI2A 5JY1A 4LMBA 1LCIA 2BP7B 3QLJA 4RTMA 3AILA 3R5SA 4H3SA 2O2GA 2WAOA 4RGQA 2HQBA 1QRUA 5C1BA 1ZH8A 1PI3A 2PPLA 1U98A 2QYOA 3NAGA 2R8YA 2LIPA 4PY2A 2CCGA 4RTQA 1K86A 2F3UA 2VPIA 1YMUA 1RPAA 4CM7A 1OX5A 3ZDBA 5HCIA 2OHXA 4P98A 3F5QA 2QVGA 1JX6A 1K89A 3LCUA 3KSDO 1MIHA 2FEWB 4FDMA 3W4IA 2A88A 3I0NA 2E4AA 4A0QA 1H3NA 2BJVA 3ZE0B 3R4CA 4IWYA 4F5ZA 1IK4A 5IAGA 1E6CA 1KQ3A 2O8VA 1L7RA 4R51A 1WMAA 4W1QA 4CT0A 3AR7A 1C81A 1UBRS 5FPPA 2OWDA 3OZCA 1WUJS 3SR3A 4DZRA 3F8SA 4PYIA 5EXXA 2P2NA 1KBOA 4AG3A 3CVUA 4OATA 5ERGB 3WX0A 4ER5A 1L8XA 5CHEA 2DPXA 3Q7QA 1QS0A 5G4KA 5I9IA 4XPIB 5L3RA 4E5UA 5ER9A 3ZJYA 3A4MA 4MR9A 2R86A 1YIAA 3UBTA 1M2WA 1YE3A 1AKEA 4N5NA 4TWIA 4AJ4A 9ABPA 2HLNA 3CZ4A 1FFAA 2QSYA 3DULA 4UPVA 4YAEA 2YOHA 3EIEA 3UOGA 3WLEA 1FS6A 1RACA 4ID9A 2YZMA 1QYVA 1ZD8A 2B92A 3INGA 3P9QA 4TSKA 2HR1A 4O33A 4O2BA 4AICA 4OX9Y 3RUDA 3DLBA 5G3ZA 2BKEA 3GYGA 3ROMA 1HE8B 3OOJA 1M5UA 4AN0A 4YCCA 3E22A 4J9VA 5AI4A 2XDQA 3AM3A 1V3QE 2P2LA 3DVRX 3HKBB 2AVNA 2HNBA 4LZZA 5B3AA 4AUMA 4D9KA 3ZR4B 4O08A 3FH0A 4IGAA 5BR8B 2ZVDA 1G16A 2FWBA 3EN0A 2IS4A 1CY0A 2Q5CA 1EDDA 4UFNA 4II2A 1RXCA 1W4CA 4KXQA 5AK4A 2N42A 3A3NA 1VE5A 3LHFA 3QPDA 4OYHA 5F2EA 5A5DA 5FUQA 1RI3A 5K8VA 2B98A 2RGGA 3O21A 3KJZA 2BKLA 3BCSA 2CKDA 5GJBA 1L4EA 3AY6A 4TKUA 2J87A 2Z2YA 3VNBA 1GILA 3CLHA 4F5WA 2XW6A 5G1NA 1D1QA 4B85A 4JY7A 1RWBA 2O8BA 4JT8A 1H2BA 1DC7A 1YMVA 4BX8A 1GN8A 2G0AA 3W7VA 4B4KA 3I2KA 1SD2A 4F9GA 5BV1A 4HZUB 3PG5A 1F2DA 1D8AA 3OZRA 2RGXA 2XE6A 2DTDA 1D5CA 1WLYA 4MVJA 1RRFA 2DFKB 1JGTA 4QAJA 3ZWAA 4IFTA 3N2LA 1AGYA 4U4AA 5DHQA 5F9FA 4R54A 2ZJ1A 2X8JB 4TV8B 5DTJA 2EWMA 4BXOB 1T3ZA 2HF8A 4WKBA 2AZTA 1HDXA 1M7BA 2KLHA 1EK2A 3UAGA 4H35A 2X0EA 1C8LA 3DXYA 1ORRA 3ES9A 4O25A 4ZOLA 4AWBA 1D6JA 4G56A 3OUZA 1BSVA 1SRQA 1GNLA 4UD2A 4D9HA 1R9NA 5JNSA 1AQLA 5ALXA 4DABA 5CFZA 1G41A 3OWHA 4MWTA 4KXVA 3TOZA 3EPLA 4FHZA 1IK6A 1SCUA 3MTGA 1D6NA 3HCEA 4EYSA 1BFDA 4PYNA 1DX4A 3VO2A 3UC5A 4YVFA 5SY6A 3UWKA 2VBGA 3IMKA 4WKPA 3TAXA 1KJNA 1OYOA 1R10A 1VLVA 1L5WA 5CNKA 1N5MA 2QGNA 4QLOA 1F9AA 4H7FA 3TZKA 2CLSA 4NOJA 1GPKA 1ORTA 4Q16A 4XXHA 1T1IA 2HAEA 2WKSA 1VSVA 3NT2A 2VK4A 1KI2A 1M83A 2CXQA 2NYUA 3BB3A 3F78A 1MIOA 2OWEA 4FGUA 4M76B 3MILA 4PVCA 1EWQA 1NT2A 1ZH2A 1TJNA 2GEVA 5K99A 4KGVA 5MFZA 3OIUA 4F4IA 4G89A 4JZKA 3WYEA 4EVSA 1JU3A 3WZMA 2WF5A 1L4LA 1YO6A 2YV5A 3KHUA 4C4SA 1C7EA 1KK0A 2JHAA 5HCUA 4KYVA 3IIEA 4CKCA 3TCNA 3ZVKA 2IDKA 4L5CA 4MUNA 1VSUA 1PK9A 4G23A 4MDYA 4RVDA 1YRHA 3FPCA 4CDMA 4NABA 4W82A 1Q2UA 3LDHA 5D51S 2X86A 4RA9A 3NBYC 5KYVA 4O63O 1X1DA 3MTQA 4CM4B 3O8CA 1YKSA 4J1SA 3RWBA 1GUYA 1HQKA 5LQAA 2D8AA 1CT9A 1QFJA 4JLWA 1YDMA 2OT3B 3Q9LA 3OJXA 2XY4A 1AO0A 5CIQA 3DLPX 1QB8A 4JASB 3NFYA 4QO7A 5AXAA 2Z08A 3R7WB 4HPWA 4Y2HA 4FPXA 3NHYA 4BFTA 5KYKA 1JP7A 3AUKA 2HPZA 1KF0A 2NUPB 4ZYYA 1OXKB 1ZSVA 5E2BA 3WWPA 1Z4PX 4QC2A 3EGOA 2WG0A 3K8QA 2CNBA 3GRFA 3PUXA 4N7RA 2WMYA 4JSRA 1OWNA 1S5PA 2RHJA 1YQTA 2WWIA 3OJ0A 4YLYA 1IBLB 2H63A 4OQNA 4R81A 1H93A 1I01A 1OI7A 3KKLA 4GECA 4KHPB 3EIOA 1QQ6A 4PHCA 3WBFA 1ZMBA 2JIDA 4BNWA 2HOQA 2WSBA 2PUHA 4J0HA 1L5RA 2J0SA 2XKJE 2DP4E 4OKIA 2RGBA 4Q1EA 5AW4A 4LZLA 1R9GA 1CPYA 4HNSA 4BNDB 1Z82A 2GPJA 5IJ9B 2BKVA 4GUDA 4K8OA 3EAGA 3EXIB 3OESA 1T0UA 2IHUA 4EJ0A 1XZFA 3IVMA 5BO5A 4EG6A 2G5GX 2R87A 2OE2A 2RI6A 4LFAB 1XTUA 2FAXA 1SU7A 2E49A 5LP6F 3G7SA 3FX2A 2XYRA 2QA5A 2AOUB 2G72A 2CMGA 4D8WA 4N12A 1XTIA 4NRDA 4D3SA 2O5EA 2QTLA 3HCFA 4L51A 2OSVA 2PXXA 3AW8A 2J8ZA 3A4NA 4II7A 2D5IA 4LRYA 3A9VA 4AZVA 3T7JA 2H9YA 1W85B 2QVYX 3DZFA 3NHFA 1V8PA 2JFGA 4RTOA 1NJ5A 5JMWA 2I9KA 1NXTA 4IVRA 3OHPA 4FQ7A 5KWIA 4ML3A 2BZSA 4ETIA 2B8WA 2Z2KA 3CX6A 1TMKA 3C5HA 4R7GA 1DADA 2JAHA 3H5NA 4WBXC 5BQPA 1AUVA 4BKMA 3KEMA 1XZQA 1Y7PA 1FVHA 1CV2A 1PP4A 1QV7A 2V8BA 4CKBB 4UMEA 5KSWB 4HNVA 5JAPA 1CFJA 1Y3AA 4QPPA 2ZR0A 1ST2A 5TQ0B 1Z36A 1QO0D 2KX7A 3WRXC 5J58A 4BJ1A 4YJHB 1VGRA 5I7EA 1YF3A 3OU2A 1UR5A 2OBMA 1TU3A 3QBTA 4RK5A 3MTBA 3UZUA 1DO0A 4E94A 5KNBD 2FWPA 4UBMA 1MC8A 4YT2A 5A03A 4Y7CA 1IHDA 2Q3EA 1G21E 1QH8B 1M0EA 2JLWA 2H06A 1G17A 1ML4A 4PW0A 4QFMA 5JNTA 1SK8A 3WZ2A 4KODA 2P68A 4EYKA 1JT2A 1FTSA 4QYSA 1SIOA 3QVUA 3BEOA 4XCXA 4UM8B 3A9SA 3CUKA 2A14A 1E79A 3PUZA 3WGMA 1P81A 2FUNB 2ZWVA 3SKXA 4EJSC 2LKCA 3TQRA 1TZMA 4YPVA 3FBWA 4MR7B 1YZQA 4LOAA 1R16A 3RF7A 2QUIA 2IYPA 4CV2A 2Y1XA 5CUQA 2QSUA 5IULC 3TLEA 2HB6A 2VZLA 3OM9A 4C6TB 1DRUA 2JVJA 3E1KA 1M34E 2QLLA 4UMDA 1E1QD 4YV2A 1ZM3A 4ZGWA 2JLZA 4HEA1 4KZPA 1V3VA 2YVKA 3BA6A 2RC6A 4DM4A 4JVLA 1E9BA 4MB6A 4K88A 1Z2AA 1XEFA 2GJSA 1T5OA 2ZSUA 2DR2A 5AXDA 3EXEA 3W1VA 3ZDRA 2F17A 5D84A 1P9RA 4PLWA 3C6BA 3RT9A 2ZRMA 3GEPA 5DVZA 2IUUA 1GFZA 2R68A 4R1SA 4LNHA 2FWNA 2WY2D 3WTCA 4MVJP 1P2FA 1DJQA 3DEFA 1GIAA 4BB6A 4EIWA 1YJCA 4KMRA 4U7PB 3MJEA 3OPYI 4I4IA 3KJNA 1S1CA 1JR6A 3BG5A 4ZREA 2IXAA 1U6JA 3KCNA 3LH5A 4YNBA 1NN0A 4IJVA 2VTBB 3IEVA 1X7ZA 2V7EA 3B7WA 4DXHA 2RHCA 2O52A 1NW5A 2F67A 1E7WA 4YV0A 1LJ8A 4UCWA 3HA5A 2H08A 4H0CA 2A94A 5EE1A 5F98A 3ZXSA 5CTAA 1PV4A 1ZN7A 1ANKA 4M88A 2ZI7A 2IXGA 2V6BA 2BFEB 4OU5A 4K05A 3GDWA 4J16C 3V6LA 3CUTA 4MA5A 4NV0A 1SUBA 3KAKA 1HRDA 1T6XA 4DV7B 4JLVA 3O93A 3PCRB 4R1QA 1NXOA 3DMYA 2B1JA 3KVNA 5LR6A 4JI2B 4KQFA 4Q7LA 1E9DA 1M8PA 2B6HA 1ESCA 1TJPB 3GELA 4O2AA 4Z0TA 3GZ4A 2H4WA 2Z43A 2D2FA 4FZVA 3EVDA 4NJEA 3ZS8A 2HD4A 1U3TA 2ODNA 3KK0A 2XUIA 3BC1A 3M4JA 4NMWA 4AMVA 3VAYA 2Y66A 4DIFA 3OC0A 4MWGA 2OENG 1QH0A 4JBGA 1QG6A 3NYRA 4FYMA 1JFFA 2DH5A 1XTSA 4TN5A 2JIOA 5EE0A 3LP5A 4YA6A 4DFDA 3S5JA 3FSGD 4L3OA 3RS9A 3FB1A 3GJXC 2GZMA 2Q4EA 5T4FA 3V4OA 5BOSA 3P9ZA 1IB6A 3ETNA 2Q27A 3PL5A 1IXYA 4OI2A 2J3EA 2RH9B 1EDEA 1K0FA 1AK9A 1U1IA 1COWA 4YRBA 2IOQA 5CFMA 2P67A 1U3CA 3IL2A 4N01A 1WXEA 2X13A 5H81A 4IDEA 1KYQA 2RGCA 3K1JA 4FBMA 4KLCA 4QSHA 5A4DA 3ZWKA 4EP1A 4MWBA 5B6JA 3PEYA 2GB4A 3RKSA 2ZJAA 3BTSA 3N8IA 4ZU6X 3DOIA 3TTYA 2FP3A 1TZCA 4DDKA 2GZ1A 2VLBA 3Q12A 1N1GA 3AV0B 3PR2B 4NJOA 3ZHCA 4JP8A 2EJBA 4INOA 3TH5A 2OK8A 1CZRA 3DLIA 5DJ5A 5FL7A 2Y93A 1WPRA 4BIIA 4DR3B 2UUBB 1H2AS 1VLLA 1ZD9A 2AHRA 2EF1A 2QL9A 3DFKA 1EFPB 3M9XA 1DBQA 2TECE 2EYQA 4QDKA 4PZAA 1KKUA 3AI1A 3LV8A 1T4MA 4DQLA 4RKWA 4WNIA 1XCMA 2GQ0A 4XA8A 4LVNA 2WPDA 2Q49A 1Q7BA 2P3SA 5BR7A 1PWZA 1CR6A 3RRBA 4NH0A 2YX1A 4CN9A 1K6IA 5K3SA 3E9NA 3H87A 1I6WA 5BUSA 1UBUS 5TPZA 2OCLA 2P2GA 2WTBA 2KQUA 4WVFA 1GITA 4I9UA 4QJ5A 1OJLA 3L77A 1AH2A 1H1DA 5HKAA 4E08A 1SUWA 3OMXA 1YRLA 2H1FA 1BWSA 5B64A 1RQ7A 2JGRA 1K3TA 1TI7A 5KOJA 3ZY6A 3I04A 3L18A 1NW8A 3NDRA 3CO5A 2H1IA 3OQ1A 4YJ3F 3THXA 5EIEA 2FPPB 4XWGA 5ALOA 4IV8A 4MHSA 4Q6WA 1UK8A 4WFKA 1IHOA 4MWSA 3S2UA 3UIEA 3CMCO 4HH4A 1E9AA 1CUHA 4E12A 1I4EB 4ZQBA 2J45A 3LCVB 2FG6C 3A2NA 4ARBA 3IBSA 3SXPA 1F8YA 4B2IA 2XUFA 3LQFA 1GNRA 4WK6A 3JASB 4NS1A 1GZ4A 4HG2A 2HCFA 3CIOA 1K9VF 5E1DA 5LN1A 2GO7A 2AFHB 2YC2C 3HBJA 3SQWA 2FW7A 4B9AA 4G9BA 3BX1A 2QN3A 3A10A 4QQKA 3FNQA 6PFKA 3R9WA 2OBFA 4URVR 1VHLA 2YWFA 4FLFA 1OROA 2X77A 1EUQA 1NF2A 3QVJA 3DBHA 4CLDA 5LP6C 3DEJA 4L6IA 4IZIA 2A9OA 1ZBDA 4TRRA 4UAUA 1IH8A 3MHTA 3TG2A 4TLMB 1MRZA 1KPIA 5AHKA 4R16A 1U3FA 3VUFA 5HQTA 1J90A 3FYHA 2O6LA 4OHMA 1UIRA 1VPVA 2Q5OA 2WG1A 1ISHA 1W35A 3B5EA 2I2DA 4DXAA 2H4YA 4I46A 2W2KA 3R4VA 4KFSA 1YU9A 2WZQA 1EAMA 1QBKC 3I30X 3ZJ5A 4B7AA 5A62A 3UMGA 4D9CA 5K01A 3EIUA 1JA0A 3DFUA 4MROA 1Z0KA 3PFIA 1ECCA 2Q1UA 2J6CA 3MOIA 4MVJE 1PW7A 1KMMA 3SZOA 1Y42X 1N2GA 3AI2A 4FILA 2WUEA 1VZ2A 1A9PA 2QT1A 3HM9A 4JI4B 3QBVA 2AH5A 4RY2A 1G3RA 5HJ5A 1SVOA 4C6HA 1VPLA 1E2JA 3UH0A 4DCJA 4Q82A 4FCCA 4I8IA 4XASA 5DNWA 3JQCA 1J1UA 1UOEA 2NU8A 4RZXA 1U3UA 1QTRA 1E92A 1NF3A 1X7YB 3FF1A 5EJMA 1SA0A 4ZCSA 2IXBA 3UJDA 3A4YA 3LT2A 5AVJA 3KR9A 1U8CB 3SC4A 2G1AA 2CBZA 3HNPA 5F7XA 1FC0A 1ZD4A 3GT4A 3I2YX 2WIFA 3B9BA 1OTYA 1UAYA 2B1IA 3NTQA 4HAIA 3UKJA 4MUFA 1SIWA 1GKKA 3JRXA 3D8HA 1GL6A 3EC2A 4L5BA 4GU5A 1PV1A 4TV9B 4YO7A 4I3FA 4IEIA 5LBIA 4D4MA 4KOEC 2INGX 2XKAA 1FX1A 2XUJA 4FT2A 2GRJA 3ZNQA 1NMEA 5LQUA 5FLKA 2G40A 2NT4A 4MQLA 3AL0C 4BBPA 1LH0A 4EY7A 1N57A 4Q1AA 3U80A 4WY2A 3UAYA 1WU8A 4PYKA 1ZCJA 5LL6P 4GWKA 2QJOA 1WDMA 4C7MA 4ZD6A 2RGRA 5AD1A 1B6SA 1LFAA 2JFZA 1CUEA 2E1PA 1UM8A 3ISVA 1A98A 2Y1OA 2Y71A 3IO3A 1U0OC 3T7TA 4LISA 1Q22A 4C3ZA 1QJ4A 1PJCA 1QIEA 1UBNA 2ERXA 2GN0A 3TYXA 5JBQA 5CM2Z 3H8VA 3JQ8B 4EX7A 3NV7A 3A14A 1E4VA 4H27A 4Y6RA 3PLNA 4PXAA 2FXVA 1FNSA 2ZE7A 5DGHA 2ZAYA 1GYPA 1RRPA 1XKQA 3K1TA 4MPDA 4ZVNA 1MJFA 2X1VA 3C39A 3HFJA 3FIJA 4LTNA 5AOVA 4FCVA 2V7WA 3TIFA 2R1VA 4PHHA 1XAJA 2VDUE 3RS8A 3S2IA 4AO7A 4BNJA 5I45A 3JR3A 3WDMA 3BWCA 3EQ2A 2AFHA 3N2IA 4BE9A 1AKYA 3Q40A 5DSTA 1Z08A 4ARUA 4YYEA 2X5JO 2Z56A 4NOMA 5ED0A 2J09A 2FQYA 4CV0A 3GQBB 3IKVA 3K6KA 4MYSA 4P7FA 4RE5A 4GR9A 3S2FA 3JALB 4BO5A 1QLJA 1TKRA 2YYZA 3IBYA 4RQBA 4TQGA 4YMWA 3RSGA 1AF7A 721PA 1ZM2A 2W00A 2AC2A 4F9TA 2XA9A 2OXIA 2BM1A 3WRXA 4P81A 1Y3IA 4LGYA 1PYOA 3NHRA 5KHAA 4MGHA 2IWHA 3TNYA 4D9MA 3WLKX 2YWGA 4PHTA 2GM3A 4ZI5A 2HLDA 2IFTA 4IGKA 1Y34E 3DZBA 4Q6BA 1G2QA 3DWGA 1H3FA 3M6AA 2ON6A 2Z4SA 3ETLA 1WD5A 3SHFA 1RMYA 1FMFA 2WI8A 3G2HA 1EBBA 4Y9RA 1TQ4A 1EFKA 1K7FB 1SCKA 3QVOA 1UBLS 4WADA 2HHHB 4INPA 1FRNA 3N8DA 1TPZA 3MUNA 2JLSA 1MENA 1II8A 3ZLJA 1YJBA 4E0BA 1L8QA 2ZI5A 3KDSE 2ZG6A 5ALUA 1EJ0A 1SUDA 2HMYB 1DCFA 5F52A 3KQTA 5AJVB 3HKDB 1GGEA 4G36A 4AROA 4JC0A 3VJMA 2QY9A 4V0NA 5E7QA 1E2BA 1TGVA 2VAXA 3AR4A 3ED1A 1KK1A 1V5GA 3EMKA 3LFUA 3OLVA 3WWCA 4B75A 2Q3CA 2A3RA 1EFVB 2GAFA 2WTNA 2QLNA 4XGRA 3WS7A 4Q7KA 4GMXA 4M0LA 4KH1A 4XGKA 2OPBA 3JWGA 2FPIA 4ER6A 2RHGB 3PNPA 1UL1X 4PCLA 3R74A 2HLDD 2YQ5A 1G8FA 3I34X 1BHQ1 2R1TA 2WIBA 1FRFS 1GG2A 1DFHA 3ANNA 4HPXB 4RIHA 4X54A 3ETHA 1L3IA 3PJDA 2PH1A 4ZCIA 4U7JA 5HF9A 2J4DA 1VBFA 1GU1A 2NAPA 1XQ1A 2VDOB 1C4KA 2QVZX 4LJ5A 4CVNA 2GHTA 1EQUA 1T8TA 4P2GA 3V7UA 2D5LA 2N3ZA 2H1LA 2Q5LA 4O0LA 5LNK1 2X23A 3Q98A 2C9BA 2OFFA 2QD1A 3THYB 3K7EA 4K40A 4D57A 4A2QA 1OBFO 2OC9A 4EW3A 1FSFA 5DI3B 4PNPA 4YXWA 3QPCA 1FSPA 1CP2A 2IOFK 4UCQA 1WDLA 3IKLA 1EE9A 1QPBA 4RESA 2ZWMA 2BGUA 4QSMA 2AOVA 2HEGA 5BYAA 3ETCA 2OL4A 3DFFA 5A1JA 3KLPX 3CBQA 1ZU5A 4R8MA 2VFAA 3NTRA 3SEFA 4H1HA 3FMFA 3N28A 1SG9A 2J5KA 4B34A 2PYDA 3C16C 4PX2A 1K4MA 4OI0A 1H4QA 2I67A 3KU1A 3D8SA 1I4TD 1LC3A 2O7SA 3ONEA 1G8AA 1VJCA 2AQ8A 2R00C 4LBZA 3TB6A 2NUTB 3VR3D 3WDLA 1KJIA 3ZU5A 4MI1A 3FW1A 3ZX5A 1VI6A 4Y18A 3ESCA 5EJFA 1VCNA 3BQNB 4JIGA 4EGJA 4YMVA 1Z4QA 3O83A 3IUEA 4C4ZA 4HWSA 2HZBA 3ICEA 3GT7A 1ZLYA 3H7AA 5ESDA 1VIYA 1DBVO 2AMLA 4RULA 1H05A 5U9CA 3BFPA 4P53A 1YS9A 3UGTA 4DOMA 4IHAA 4F3KA 1SAYA 1KVUA 2P77A 4NICA 3IR5A 2HHCA 5FBWB 3WQQA 3MRVA 5CA1A 3O3OB 1V96A 3DM5A 1A76A 2ZBEA 3D7KA 2Z5FA 3DUWA 3PWKA 5KSZA 1AQUA 3M9LA 1FSGA 4EMTA 3EBOA 3Q1KA 3ZCUA 1WXGA 1CUWA 1YVDA 4JS0A 4GOOD 2Q1WA 5FULA 1J7JA 2C29D 1IN4A 3AEYA 5ALTA 1HUQA 1YDEA 5MF6A 2AMJA 3K6RA 1G55A 1CW2B 1GG9A