4GWGA

Crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
469
structure length
467
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Phosphoglycerate mutase 1 coordinates glycolysis and biosynthesis to promote tumor growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 188
structure length 467
sequence length 469
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gwgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gwgA01
4JLWA 2D2IA 2PD6A 2CDBA 2E4AA 2CVQA 1DAOA 2NACA 2VWHA 3EK2A 4W9NC 3VPXA 1XQ6A 1PGPA 2AE2A 2LDBA 4J4TA 4BNHA 2W4QA 1YQDA 4I9HA 4IPTA 3TSCA 4BNTA 1KC1A 1PGOA 1QYVA 2VRBA 4XQ9A 1WMBA 4RV9A 3A06A 2D8AA 3VH3A 1XDWA 1K89A 1YL7A 4IS2A 4IQGA 1GPJA 4Y67A 3ZWMA 5L7YA 5CFZA 2IEDA 2XF8A 1WMAA 3RJ9A 2WWRA 1X1EA 2ZATA 4DQVA 2LDXA 4W82A 3ZV4A 2DC1A 1HE5A 1T1SA 3T7CA 3X2EA 5DT9A 1E3EA 4DGSA 2Q2QA 1N5DA 3H9QA 3CE6A 3KRTA 1ADFA 3RC2A 1Y5MA 1E6WA 3RI3A 3VZQA 1PJBA 3JYQA 1YRLA 1YB1A 3DB2A 1XELA 3ETGA 4Y9DA 1Q7BA 4KOAA 3WGOA 5CPBA 3EC7A 3PHLA 3UH1A 1IUKA 4MKRA 4CV0A 1MFZA 1HZZA 2O7QA 1U3VA 5JLAA 4YAKA 3AU8A 3GZNA 3HSKA 3QLJA 4XDZA 3E82A 4E2XA 4BS9A 2VUTA 2IODA 3ZZNA 1I24A 2PH5A 3NDRA 3TL3A 4XQCA 3ENKA 2JD2A 2RIRA 2HJSA 2OHXA 4EUHA 2I99A 4JP2A 5JAZA 4UVIA 3TFOA 1NP3A 1YKFA 1H2HA 5EPOA 4FN4A 4MKZA 4EEXA 1JW9B 3GNQA 3E1KA 4NI5A 3RFVA 3R3JA 5I7FA 3GGOA 4MP8A 3KUXA 2DQ4A 3I9MA 2ZJ1A 4EI2A 2CUKA 4G65A 1X13A 3RU9A 4I08A 4IGFA 1DB3A 1M6WA 3FTPA 3S1LA 2AE1A 4E31A 2FN7A 3SXPA 1LU9A 1GYQA 1PTJA 3PDJA 4MVJM 4MVJF 1G0NA 3UFXA 1I8TA 1M66A 1ISGA 1F12A 1T4BA 4R5HA 3RUHA 4RPKA 2WD8A 4QFDA 3JD1A 5TJ9A 5EQDA 4BQRA 5KJEA 4OHUA 3V2UA 4CMEC 2VHZA 1WAMA 3V2GA 2D59A 1G6KA 2C20A 4FFPA 2EGHA 2W2LA 4WEQA 1LJ8A 1DOHA 1XA0A 1ULUA 4Y98A 2BMAA 3MJEA 4IBOA 1KIFA 3ZNPA 5DNAA 2DAPA 4FC6A 5T8KA 4O1MA 5CHEA 3FBGA 1YL6A 2PZMA 2G0TA 4A10A 4EDFA 1Y5RA 1ZKMA 2VWPA 4BOYA 1QXSA 1CDOA 4TQGA 3U3XA 2IE0A 2DFVA 1Z45A 2VRCA 1QSGA 2AA3A 3WDSA 1DJNA 1ISJA 4LCJA 3KZVA 2YW9A 4JJIA 1ENPA 4DMMA 1UP4A 5KKAA 4JROA 1MGOA 2C0CA 1E1NA 2B83A 5F5NA 1I3LA 3M2PA 4YA6A 1EUZA 4TZKA 3GVPA 4PLYA 2I65A 2Q1TA 1P1RA 5IAAA 3PYLA 1TI7A 5CPFA 4KUGA 2EGGA 4CV2A 1PJLA 3DOCA 4WCDA 2IXAA 5IXYA 4XIYA 1QV7A 4PLPA 5CDUA 4I8XA 2OGUA 3TQHA 4DPMA 3GHHA 1LSOA 5JC8A 4NNJA 2NM0A 2DM6A 1XKQA 4XCVA 2O4UX 1W4ZA 4ZQHA 1T2FA 3HB4X 5BT9A 5BR7A 4C4OA 3GK3A 3KSZO 2PH3A 2QZZA 3DC2A 4CMIB 2C82A 4GSKA 3UCFA 3WJ7A 4Z6KA 1FF9A 2HMVA 5ENDA 3RUIA 5KNLA 5IZCC 3L6DA 3FN4A 3C85A 3WXBA 1TT5A 1DRUA 3GEDA 4J9VA 1VSVA 2Y0DA 4MIYA 1B8PA 5EESA 4WASA 3DWFA 1EFLA 5A3JA 2HDHA 1P74A 2EKLA 4W99A 3RKRA 4RJTA 3KOUA 2X7HA 2O7SA 4JBGA 3OETA 1Y8QB 1Y1PA 3PK0A 4AG3A 2VUUA 3NYWA 2NADA 4BMSA 5THKA 1HDOA 5JFOA 1XQ1A 2PWZA 1YBMA 3ZV6A 4BGVA 1QG6A 1PWZA 5EMHA 2P9EA 4BO0A 5JDCA 2B4TO 1VM6A 1DJQA 2FY8A 3INTA 4KQWA 5ICMA 3PJEA 4E0BA 5GZ3A 4OL9A 1XCBA 1SCUA 1GYPA 2AHRA 1E3LA 2IZ1A 3V1UA 1I36A 3N58A 1HT0A 2Z1NA 5G0WA 2C5EA 3AUAA 4KUHA 3DMTC 3GFBA 2PZKA 3ON5A 4J1NA 4RPGA 5AXDA 1EBFA 1FK8A 4Z3DA 1HDXA 1GZ4A 4WNIA 4OQYA 1HRDA 3RC7A 4HBGA 1XR3A 4IM7A 1JVSA 2AQKA 4EGFA 1U8FO 3ROMA 1KC3A 3AM3A 5FEUA 3HDHA 4ILKA 2Q1SA 1R16A 2PKQP 2PZLA 3RFXA 1FDUA 3COSA 1JAXA 2Z95A 4PG7A 1OBFO 2ZCUA 2WTBA 1ISIA 4E5NA 2CY0A 3ZNNA 4DC1A 3DAPA 1B8UA 5DCUA 4AJKA 1O6ZA 4DQUA 1E6EA 3IKTA 1DLIA 4RDHA 5ILGA 4O59O 2J5RA 1DXYA 1QYXA 1TT7A 1GEEA 2YV2A 4NBTA 3OEYA 4PG5A 3KB6A 3AI1A 1JKFA 4F3YA 1I5RA 4NBUA 3SC6A 1AUPA 4O6VA 3OICA 2H6EA 3OA2A 4KZPA 1GDHA 1GR0A 5F1KA 5I9MA 1JDJA 1ISHA 3FNHA 3E9MA 1LDEA 5TRTA 5EN4A 4YAGA 2BGLA 5B4TA 4XJSA 3V2HA 2HMUA 2XPCA 1PR9A 4Q3BA 1M2WA 4R16A 1V8BA 1LA2A 3JYPA 3KEOA 5TT0A 5CAEA 3G3EA 3WNVA 4ZVVA 1ADBA 5JXWA 2PD4A 1LC0A 2VOJA 1ZK2A 3H5AA 4OGWA 5A9SA 1GV0A 2RH4A 5A05A 3RUAA 1Z82A 1CWUA 2FSSA 4WCFB 3MWEB 4MP3A 2O3SA 3GVCA 3IS3A 3WMXA 1TLTA 4ND5A 2FR8A 1VJ0A 3ZCXA 1ONNA 4B3HA 4EEZA 1YONA 1F17A 1I10A 3O4RA 2EIHA 4IMRA 5F5LA 4ALIA 4B4VA 2C2XA 4KUEA 5A02A 3ZN2A 3AFMA 4RVGA 3F5QA 3PHHA 1BSVA 3A14A 4LVCA 4D43A 5G2OA 3PQFA 1ID1A 2X0RA 3F6YA 4BNFA 3IJPA 4WLFA 3RUFA 1NAIA 4AJ1A 2I6TA 3H9GA 3VKVA 4FGWA 1R4NA 4DRYA 1PS8A 2NVWA 5L7TA 2P5YA 3AOEA 1QYCA 4AJHA 3U9LA 1KY5A 3HUDA 3U4DA 3VOSA 3DZBA 1F8FA 4FFLA 4F46A 1NBOA 3NRCA 1EZ4A 5GZ1A 4YJHA 4L74A 5T8KC 1N1EA 3NTQA 3KM0A 3D3WA 3JQDA 3DMYA 2AW5A 2QQ5A 1Z75A 4HFNA 2GF2A 4OH1A 1LNQA 1HKUA 2EP7A 1TEHA 2IYPA 4D41A 2WMDA 1U2GA 3HDJA 4BKQA 3HE3A 1OFGA 3Q9UA 1C1XB 1DRVA 3PI7A 4E5MA 3QWBA 4GLOA 1ZZEA 2G82A 4BNJA 4QEDA 3WGTA 2QHXA 5G4KB 1DC4A 4IS3A 1Y81A 3CXRA 1UZMA 3H8VA 1E77A 4GAEA 3ENNA 4NBRA 4XEHA 4DWVA 4LK3A 1GADO 1PIWA 1U5AA 1J49A 2Q2WA 3D7LA 3DMTA 3WB9A 4BB5A 2ZTVA 4HNHA 1FDTA 1GCOA 2CVZA 2GZ3A 4WGGA 5COAA 1WDMA 3TZCA 4TWRA 2GPTA 2Y0CA 1NFRA 2EG9A 3WJAA 2DBRA 4UUNA 2GD1O 5B4UA 2RHRA 1P1HA 4NJMB 4P22A 3FPLA 3JYNA 2DLDA 3H3JA 4IXTA 1L7EA 4BVAA 5A9TA 3RJ5A 2D5AA 3WNQA 1E7RA 2W8ZA 3WS7A 2GZ1A 4P4GA 5JAQA 4FFOA 3QSGA 2NQTA 5TC4A 5C5IA 5ILOA 3CUKA 4FD3A 4A26A 1ZSYA 3C1TA 3PHGA 4CM7A 4E2YA 3L4SO 4J1SA 4NFHA 2XXJA 2DVMA 7ADHA 4CLRB 5EQFA 4TZTA 5HRUA 1VJTA 3ASUA 2P68A 1E1MA 1AE1A 1E7SA 4RPJA 1N9GA 4CODB 1Q1NA 1IHXA 3EMKA 3K9QO 4OAQA 3G0OA 4MO2A 1B16A 5BSHA 8LDHA 3HJAA 1IULA 1IB6A 2OOSA 4ITUA 3GFGA 4MVJD 4AJLA 1GV1A 4K1LA 1MP0A 4XB2A 1B14A 1NPDA 4TRRA 2VHVA 1CQIA 4JQCA 4J0FA 1Z7BA 5CDTA 2I67A 2PK3A 3WGYA 2GUGA 6ADHA 4E33A 3MOGA 3FD8A 2O50A 2TMGA 3JQAB 3MTJA 4NBWA 1DBVO 4YTEA 1GCUA 3ZI0A 4D0SA 4BO2A 5HM8A 1OOEA 4BNMA 3DBRB 1SB8A 2AG8A 2EHDA 4GWKA 3GPIA 2AEFA 3QVWA 3HADA 4IY1A 2RHCA 1HEUA 3LC1O 4YBZA 4BKRA 2DTEA 3I23A 5KJ6A 2QRLA 3U0BA 4S1VA 4PRLA 1ZUD1 2WEKA 1K6XA 2ZB4A 4TMFA 5BNFA 4CL3A 1XWFA 3NT5A 1SBYA 4PLWA 4XIJA 5KOIA 3WWYA 4LN1A 4AVYA 5HTOA 1IZ9A 2QIOA 1E6UA 4Q9NA 4E30A 1AXEA 4EZBA 1VLLA 4DPLA 1VKNA 2QRKA 4M87A 2VRCD 3E9QA 5FYDA 3K8ZA 5U4QA 5FI5A 3DZJA 1OZAA 1WDLA 3PYMA 1DFIA 4Z9XA 1R0KA 1W8DA 1E3JA 3OM9A 3L9XA 3BZUA 3IP1A 4M55A 2CMDA 5JC1A 4RVSA 1PJTA 4W4TA 3I9KA 4QO7A 1PJSA 2IRWA 4J4HA 3LVFO 3OMLA 5JMPA 1G1AA 3IIEA 1H9BA 4NDNE 3VVBA 1P9LA 2VN8A 4UAGA 1UDCA 4MVJG 5JAMA 1UAYA 3F5SA 3DTTA 2WD7A 1X14A 5JY1A 1E3IA 2EW8A 4J1TA 3WTBA 4RGBA 1NXQA 3B20A 3VDRA 1QYWA 3K96A 3IUSA 4J9UE 1YB5A 1FMCA 2IDZA 2B5WA 5F3RA 2GNAA 2W90A 5J23A 4ND3A 3KBOA 3CINA 1WZIA 1XHLA 2X5JO 3QQPA 3NKLA 1GEGA 2YY7A 3GG2A 3NT2A 4YRDA 2I3AA 2Y99A 3DAFA 3FR7A 1KBZA 1E3SA 1U4SA 3PRJA 3HQ4O 2SCUA 4BO9A 1LQTA 3QE3A 1HE3A 3DXFA 1I2BA 5G0VA 2AEJA 4XGIA 5TF4A 2FPIA 4FCCA 4U0KA 4W7HA 2UVDA 4IDAA 1PR3A 3HG7A 3L6EA 4CM5A 3DEYX 3JQGA 1LSSA 2O2SA 2VWGA 1PJ3A 4RPLA 4XYBA 1AHHA 3UCEA 1P31A 1VJ1A 4PLHA 3BTSA 4II2A 4ROSA 2YFQA 4PZCA 1T25A 2H9IA 2VYND 2H1SA 3HWRA 1N92A 5DOZA 1H94A 1H0KA 1MV8A 1GUFA 3O26A 4NH4A 3ZHXA 1B8VA 2ET6A 4DQXA 1GPDG 4ZICA 5IDXA 3B6ZA 3LF2A 3D64A 4GPD1 3SBOA 1VC2A 4UUOA 2GRAA 4Q3NA 4JK3A 1XYGA 2NSDA 3IJRA 2ILTA 2WYWA 3DAGA 4YAJA 1N9GB 2WE7A 2ZB8A 4YQYA 1A4UA 1RKXA 3NUGA 3ZW8A 3QHAA 3RWBA 1UZLA 1RM0A 3QVOA 1HSOA 4J90A 1ZH8A 2D0IA 2QW8A 3JQ9A 4J1QA 3BTOA 3S2FA 1ADCA 3L77A 1D1TA 3HNPA 3RC9A 3UVEA 1NR1A 4L73A 4E32A 5AXAA 3CIFA 1CYDA 2EV9A 3FWZA 5G0UA 3DR3A 2PKQO 4W9NA 4BO3A 4B79A 5A06A 2Q49A 4N7RA 1TXGA 3N7UA 5DZSA 4L4XA 4U8GA 1JQBA 4CLXA 2WE8A 1LX6A 4BB6A 4Z3KA 1LQUA 3ITDA 3KYCB 1YQGA 4DIFA 4PVCA 2HJRA 3M1LA 3AY6A 5FF9A 3RUEA 4KTVE 4JCOA 4FDAA 5DN9A 3AOGA 3E8XA 2PNFA 1O94A 4CR8A 3GMDA 4E2ZA 4IDBA 1PGJA 1ULSA 4ZD6A 5HA5A 2PGLA 3EW7A 1MG0A 5KTKA 3ZNQA 5CDYA 1GU7A 1A5ZA 3DBVO 4YWJA 3GZNB 4B4WA 1NPTO 2WYUA 1V6AA 1F06A 4EBFA 2Q4EA 2WYVA 3GY0A 2I5PO 4D3SA 4R3NA 3JQ8B 3TZKA 3PFWO 2VQ3A 1BW9A 3P5SA 4YRBA 2XAAA 1UR5A 1LXCA 4RVHA 1O95A 2DU8A 2JJYA 4AJ4A 1H6AA 2A92A 4XGKA 4PCVA 3VDQA 3W8FA 4RQUA 2AQHA 1WLYA 2E82A 3NV9A 4IINA 3ZWCA 2IEBA 3LT1A 4J7CA 2H5LA 4J91A 4XYGA 4EW6A 5L45A 4OXNA 1BXGA 3VKUA 3PWSA 3ONDA 3OBBA 2OORA 3Q11A 1DO8A 1OAAA 1FDWA 4OXYA 4Z9YA 2FZWA 4NBVA 3JQ6A 3OIFA 3V1TC 3HN2A 2GYYA 3EZLA 4RORA 4PVDA 4CQMB 4I5FA 3EYWA 3I9LA 2O48X 5I7VA 3ZWYA 1WWKA 3PIIA 3CEAA 2C29D 4ND4A 1DIAA 4PIVA 4XZ3A 2IYOA 3BMOB 5DF1A 3IOYA 5THQA 5CEEA 2FR0A 1X7HA 4EYEA 2CDAA 3U5TA 1I2ZA 5JO9A 1H6DA 3E18A 4PFJA 4R51A 4JNKA 3RUDA 3GRPA 4ZQFA 4IXWA 4CQMA 4AICA 1YDWA 3K2BA 4R69A 4FR5A 1PSDA 1RYEA 5K6AA 5CP8A 2YZ7A 3D5QA 3F9IA 1KEWA 1W0CA 3ZU2A 5ADHA 1BWSA 2WD7B 2Y1GA 5EINA 4PLGA 3F1KA 3JQCA 2VZ9A 5L4NA 4MVJI 1NX6A 1ZSVA 1Q7GA 2PY6A 3NTOA 1P45A 3WFIA 2AXQA 3ZHBA 3I6IA 4YXFA 5L7WA 4MJLA 2CF6A 5B1YA 1OC2A 3WGGA 2Y1FA 5JNLA 2DTXA 3WOHA 3U09A 1OMOA 1EUDA 3M6IA 1S7CA 2PD3A 1X0XA 3KSDO 1P33A 3ZWWA 5L51A 1Z73A 3LF1A 4QSMA 4O0LA 2GDZA 4FJ1A 1EVIA 1SZJG 4BQPA 3HFGA 1T26A 3W4JA 4ALMA 3QWHA 1AXGA 5DDIP 4JJFA 1Q7CA 3GN2A 3DONA 2P91A 2UUOA 4M86A 4XGNA 3ZU5A 5F1PA 1SPXA 3JQGB 4WEOA 2YYYA 4RF2A 2DBVO 1P0FA 3C1AA 3NAQA 1N7GA 3JD3A 3WGHA 3E5RA 3S2GA 2AMFA 1PJQA 1TT5B 1RM4A 4W7IA 4PLCA 1XIVA 3JSAA 4CMKA 1YJ8A 1I30A 1VL0A 2X5OA 5LCXA 3PHJA 2EKQA 1O8CA 4GGOA 5ER6A 1U3TA 2GGSA 3VH2A 2HMWA 2GERA 4DBZA 4UVEA 2NVUA 1C0IA 3FNGA 4RLHA 1QYDA 2B4RO 1SMKA 5KKCA 2DUUA 2QG4A 4LRTB 2X9VA 1X15A 1NAHA 4E6PA 3JQFA 4GQAA 3WIDA 2JFHA 3GF4A 1H9AA 2IZ0A 4YR9A 2DBQA 5JY6A 4A7PA 4C7KA 4UUPA 2FWMX 4KWIA 1BVUA 5FI3A 4UEJA 3AY7A 4ALLA 5L3ZA 2EF1A 3H2ZA 4EITA 3PPIA 2Q2VA 1DFGA 4Z9FA 3AW9A 3HZZA 3WBFA 4YVFA 2O3UA 4UVHA 1OC4A 1JWBB 4MOWA 3DTYA 4XKJA 4BNZA 1UXJA 4R41A 3GVHA 2Y1OA 4CM1A 3TJRA 1HYGA 1S6YA 1T1RA 1EQUA 3KYDA 4TVBA 4MVJH 5F21A 3WMWA 1P0CA 1Y8RA 3OQ6A 1E7WA 3ZWAA 3WX0A 3ANLA 4BO1A 1ZSNA 4DUPA 5BNTA 2G5CA 1B3BA 3VH1A 3DHYA 1E0DA 3VPFA 1DPGA 2YQ5A 1H5QA 1QORA 6LDHA 4ZQGA 1EE9A 4YAIA 3PQDA 4A2CA 4P38A 3GLQA 2W98A 2NU6A 4RZIA 4NZ9A 3M1AA 3C1OA 3IC5A 3ORFA 3CKYA 4ZRMA 2P5UA 4BL5A 2QYSA 2VYVD 1DC3A 1E7QA 3GQVA 1LI4A 2ZTUA 1ZK4A 3GHYA 1W6UA 4QFCA 4Y6RA 1ONPA 3RASA 1H6BA 1RM5A 2V6BA 1QMGA 4Q3EA 4HXYA 2WM3A 3BTUA 1I3MA 1WW8A 3JYOA 1DDOA 1I3NA 3HHPA 4FBGA 4OSPA 5AQ1A 4WLUA 3V5NA 2FSVA 4OIMA 3SX2A 3PYXA 1HDZA 1TB4A 4YT2A 1LDYA 3ZWXA 1ZO8A 3ABIA 1QKIA 4CQLB 3ST7A 5KJCA 4J6FA 3RU7A 3BMCA 3QWAA 2VT2A 4NFSA 1J6UA 2Z5LA 3KTDA 2JD0A 4YB8A 1NM5A 1XG5A 3ONEA 4UEKA 4R1NA 3ONFA 4J7UA 1X1TA 1XU7A 1A71A 5TJHA 4WLOA 4OSOA 3R3SA 1WPQA 1U8XX 4R9RA 1NWHA 1HL3A 1ONOA 3VTFA 1D7OA 5DULA 1A9YA 3Q2IA 1LDGA 4JIGA 2HRZA 4LMRA 3OIDA 3LC7O 2C7VA 4E12A 3D4PA 4AJPA 1LSUA 2A35A 3ICCA 2HQ1A 1VL6A 1UZNA 5A4DA 4GSLA 4XDYA 4TVOA 3HN7A 3L07A 4MINA 1SOVA 4F6LA 1DC5A 2P9GA 1A7AA 5AXBA 4B7UA 5L4SA 3I9JA 3B1JA 3AU9A 3ANMA 1HTBA 1EK5A 3WSVA 4ZGWA 3Q9NA 4DYVA 3E9NA 3SVTA 1E3WB 1VL8A 5MGBA 3NDIA 4R01A 2DBZA 3SC4A 5BSFA 2OZPA 4DXHA 4OMUA 3DL2A 3QY9A 3UOGA 4INAA 2JKVA 1GQYA 1KERA 2ZIZA 4BNUA 4BMNA 3AFNA 1ZXLA 2AEMA 3MTGA 2AQIA 2DKNA 4MIOA 3EGOA 3F4LA 2HK7A 2NU9A 4NG5A 1NFQA 2GZ2A 3ICPA 3QVXA 1B15A 3GRKA 1V35A 1JVBA 2X9NA 4YJFA 4XQGA 5IN5A 3DDNA 3A1NA 1OI7A 3JV7A 3I5MA 3QWIA 4KWHA 5DBFA 3JQFC 4H3VA 3WIEA 1IE3A 1SO8A 1GFSA 1RPNA 4NFYA 4PG8A 1M75A 1UXHA 3QA9A 2XXBA 3OFSA 2AQ8A 5JDIC 5AVOA 1E7YA 2FMUA 2YDYA 1FDSA 5T67A 3V1YA 4LSWA 1KEUA 4A03A 1KVQA 1C0LA 1ZK0A 1R4MB 2X86A 3DOOA 4PG4A 1UXGA 1MXFA 1YJQA 3JQBC 4RVDA 4IDCA 4CJXA 2FPPA 9LDTA 4GVLA 4HNGA 5EERA 1M76A 4CL8A 3AOEC 2OFPA 2HO5A 1WNTA 4HFJA 3FCOA 1G0OA 2Q1UA 4HKTA 1GUYA 4ALKA 3DZGA 3DO5A 3VH4A 2O3JA 1SAYA 4GH5A 2C5AA 5U9CA 1E92A 1JKIA 2VHXA 2UYYA 1YOVA 1EK6A 4CM9D 1E7MA 3QP9A 3KYCA 4CM8B 2PKRA 4YQZA 1V3VA 3W8EA 1ISFA 5TGDA 2RBEA 3ROQA 1YVEI 3KHUA 3FR8A 1ZVMA 3BA1A 1B7GO 1JA9A 4E13A 3F4BA 4J49A 1MG5A 1Q2XA 4FQ8A 5HWSA 3DOJA 3TZ6A 4R9SA 4ZQEA 2BHLA 1UJMA 4L0QA 4OYRA 3F46A 4D42A 4CM8A 3ZU4A 1P1FA 3KYDB 2J3IA 2CSUA 2ZCVA 2B36A 1UAGA 2BFMA 1PU2A 3C7AA 4NK5A 2PR2A 2J5QA 4H7PA 3CSDA 5IFLA 2RAFA 3K5PA 4M89A 3PLRA 5BSEA 1P1KA 1J5PA 1XEAA 2WSBA 3IQDB 3GPDG 3UHAA 1F0YA 1ENYA 3LLVA 3P2YA 1SB9A 4R5MA 2Q4BA 1LSJA 4BGUA 3PIDA 1BMDA 1PL8A 2B0JA 3A9WA 2B5VA 2CF5A 4BNLA 1NYTA 1BDBA 3SJ7A 4QECA 3MJTA 4ALNA 4RF3A 4ZJUA 4D3DA 1SEVA 4K28A 4NU6A 1R6DA 2O3RA 3UCXA 4A0SA 3UICA 3QIVA 3KEQA 2X0IA 1BXGB 4URFA 5T5QA 1I33A 2Q1WA 4HADA 2G76A 1SNYA 5TT1A 2PLAA 3U49A 1F8GA 1HDRA 4BO4A 4XRRA 4G81A 1ZJZA 1D8AA 4Q3CA 2OUIA 3LT4A 1NVGA 4IJWA 2C59A 5TLSA 1GY8A 2H63A 4RF4A 1DIHA 1U5CA 3MJVA 3OJFA 2PGDA 3ZU3A 4TKMA 2HKIA 2NUAA 1A9ZA 4N54A 1U7HA 4KP7A 5C3MA 3ROPA 3NEPX 4CMCA 2DT5A 2QYTA 2HK9A 3TZQA 4DC0A 5KVCA 3PZBA 4GVXA 1P1JA 4BNIA 4CLEA 3IL2A 1V0JA 3D4OA 3VC7A 4WCFA 3MEQA 3VPGA 1YL5A 3MOIA 3E5MA 4RF5A 5A5EA 3JD0A 3H3FA 3H2SA 3I4FA 3UAGA 4I1IA 1YGYA 3HFSA 4F45A 2O3TA 4J43A 3NGXA 4FPXA 3KLPX 1U9JA 1LLDA 1Y6JA 1Y9AA 4XWYA 3DBLA 1NFFA 3T4EA 5L53A 2G1UA 1VPDA 3QV1A 4BIIA 4UVGA 2YHUA 2X0NA 3MJ4A 4M54A 3WLEA 4YT4A 5EJ2A 5ITWA 3G1TA 3B70A 4XJTA 5HS6A 3CTMA 4R4JA 1HSZA 1PQWA 2BRUA 3BHIA 3DHEA 1LUAA 2JFFA 5TIIA 3GAZA 3DBLB 3E03A 4D3FA 1D3AA 4FS3A 5COQA 4DLAA 1N1GA 1Y8QA 2Q99A 3HDYA 3MWDB 1QRRA 3RBXA 1CRWG 2HRBA 5CEJA 5IZCA 3JQBA 3UN1A 1DEHA 2HU2A 2O3QA 1BXZA 3KYBA 2VYNA 4D7AA 3VZSA 3IMFA 5AYVA 1RYDA 3WGIA 5KCZA 1EBUA 3FWNA 1J4AA 4WPGA 4Z0PA 4L4RA 1Z74A 4WECA 1LC3A 1AGNA 5FWNA 1YBVA 1YOVB 3PWZA 1KVSA 3QW2A 1GQ2A 4HFMA 3SEFA 3DZKA 5JE8A 1WXDA 1DHTA 1VRWA 1PWXA 2E37A 4CR7A 5LDHA 4BNKA 3MJSA 3TNLA 1R4MA 3W1VA 3N74A 3LK7A 4MP6A 3GDGA 4UREA 4IZIA 4IGEA 2EWMA 3VTZA 3A4VA 5I9NA 2HMTA 4HWKA 4OJNA 4PRKA 1UXKA 3I9OA 3EDMA 4CUKA 3WG9A 5JS6A 2X22A 5DOVA 3WGZA 1PZGA 1DIBA 2QRJA 4GLLA 4DIBA 3JQEA 1DFHA 2GLXA 4HUJA 1XU9A 1ZMOA 3OF2A 3WQQA 4CLHA 3TRIA 4LSMA 5KVVA 3D0OA 4DVJA 3CH6A 3QWFA 4E5YA 4YPOA 1LDNA 3BHMA 2GN8A 3SJUA 5H81A 3K31A 3TOZA 2VYVA 4FGSA 4CMBA 1AN9A 4K26A 4DBVO 4DLBA 5HS4A 1Y8RB 4J7XA 3OH8A 3NT4A 2YV1A 4FSHA 1UDAA 4L8VA 2E6UX 3H9UA 2BLLA 3O9ZA 3LYLA 3RAJA 3H6KA 1Z7EA 4N5MA 1HLPA 5COBA 4EJ0A 3FNEA 1NVTA 1YH3A 4QXMA 2E49A 3AI2A 2BGMA 4BGEA 2GN6A 1PJ2A 2VHYA 4ZQBA 1A7KA 1H93A 3H5NA 5IXSA 2EJVA 2UDPA 1I3KA 3S2IA 3ZV5A 3RCBA 1SC6A 2IZZA 4M8SA 5LC1A 8ADHA 4WK6A 4GX2A 1U28A 3GMSA 5JAIA 1Q0HA 1ZCJA 5EIOA 4LMPA 3UW3A 4M49A 3E6AA 3GVXA 2GASA 5BQFA 4XYMA 4MVJP 4FJ2A 3C7CB 1CIVA 3IKVA 3GZ4A 1ADGA 1EFKA 4FFRA 4RDIA 5KIAA 1ZEJA 1UDBA 1KVUA 1LRJA 4FC7A 5C7IO 1GQQA 1DSSG 3TZHA 2FP4A 4EUEA 2Y05A 2O23A 3PGJA 5IG2A 5DCYA 4LVUA 3E48A 4R54A 4RL6A 3K6JA 1EDOA 2X58A 3FNFA 1B26A 4BV9A 4WKGA 2F1KA 3WBBA 3ZHYA 1X7GA 2BI7A 1GYRA 3KXDA 4O63O 3WICA 1ZMTA 3OHSX 9LDBA 2ZB7A 5DP1A 5A9SB 1HZJA 1D1SA 3Q0EA 3DFZA 1K0UA 3DQPA 1DC6A 4AJEA 3WTCA 4GX5A 1YB4A 1R4NB 5AOVA 4X54A 2EXXA 4PZEA 1UP7A 2J6IA 4KDFA 4GL4A 5I9LA 3GA0A 2OL4A 3D3EA 1MLDA 5A03A 4GX0A 2HSDA 1MA0A 4XA8A 3GUYA 2DFDA 5DP2A 4IDEA 4MDHA 4CMJA 2R2GA 3K30A 1Y7TA 4J2HA 3U4CA 3GVIA 1HE4A 2D1YA 2OBYA 1ISMA 4DLLA 4Z0HO 2V6GA 3OP4A 1C1XA 2ZTLA 1T2EA 3I83A 3Q3CA 2BI8A 2BH9A 2EERA 3WSWA 1IOLA 4J16A 1FJHA 4RVFA 3VZPA 3I1JA 4D46A 2JAPA 1VE9A 5G4KA 4UVDA 3T4XA 4CMHA 3W4KA 2NVBA 2ZYDA 3D1LA 1U7TA 4IIUA 1DIGA 5GMOA 2JD1A 1PS0A 4WOKA 5AXCA 4TRMA 3VAZA 3BTVA 3CZMA 1PJ4A 3WGQA 5G4LA 3AUUA 4J2OA 1YWGO 2FOIA 2RH8A 3GNSA 4YJFB 4BGIA 3L4BC 4GGPA 3DBHB 4BNVA 3U62A 3ZWPA 3WYCA 1WDKA 3PTZA 2C54A 5KJFA 1T2CA 4XR4A 3INRA 2JAHA 4AJIA 1NQOA 4B4OA 4CMIA 3ANNA 3K2EA 4ND1A 2BKAA 3S2EA 2OXIA 4JP3A 5T6BA 2CD9A 2J5KA 5L4LA 4IZHA 3NGLA 2OP1A 3ZW9A 2PA3A 5CEFA 3DFUA 3W4IA 1GTMA 3C8MA 3DBHA 3BMNB 3GN1A 2NTVA 2P4HX 2YHIB 3LU1A 4OKNA 1K3TA 5IDWA 5B37A 1R66A 3ZWBA 1HF3A 2GN9A 3R0IA 3TFQA 1H6CA 1NQ5A 2BELA 4E2WA 1C1DB 1ENZA 4NIMA 3MZ0A 4JN6B 2WJPA 3GR6A 1LEHA 3PLNA 1L7DA 2D3TA 3P2OA 3BMNA 3UKOA 4BMVA 5K9ZA 4CPDA 3T7EA 3F47A 4Y6SA 3ZWVA 3UXYA 2UUPA 1U4OA 4CMEA 2YDXA 1PQUA 3JYLA 5C7LO 4J0EA 1A27A 1KYQA 4JXKA 4PZDA 1R0LA 3DHNA 3NTRA 5H82A 1PL7A 4LISA 1MX3A 2Y0EA 1P77A 4L9RA 3FTNA 1TA4A 1D4FA 2X1HA 1GAEO 1MC4A 1O9BA 2A94A 2TMDA 3IP3A 4YT5A 3AM4A 3OJ0A 4WJZA 3OECA 3WYEA 4D79A 1NTOA 2GSDA 1ZFNA 3QJ5A 1JLLA 1B2LA 2NU8A 1N8KA 1EUCA 1UH5A 4I9UA 2GCGA 5IDQA 4M1QA 4CMAA 3ZGYA 1ZEMA 4PLZA 4U7WA 1KOLA 3RC1A 3S55A 2VTEA 3GGPA 4E5KA 3GH3A 1ZIDA 1BW9B 1C3VA 4L75A 2EJWA 3OA0A 2X4GA 4XB1A 2ZYAA 4I5DA 7MDHA 4FOSA 4N5NA 5HBRA 3UGKA 4FW8A 1R0SA 1BXKA 3LQFA 3R1IA 3MCVA 4RZHA 3C3XA 3LDHA 1J0XO 2A4KA 3U4HA 1O5IA 3VVCA 4GKVA 3L0DA 5I7SA 2BGKA 5DCWA 5F1OA 1ML3A 2PTGA 5H83A 2J3KA 1HDGO 2Y93A 4RCVA 4ND2A 2X6TA 4IDGA 3GEGA 3QVTA 3TDKA 4IDFA 4BNYA 1M67A 1DRWA 3ROKA 4BKUA 3GNTA 3FF4A 2EW2A 1X7DA 1PZEA 3IDSA 1A72A 4UEOA 1T2DA 4JJGA 4Q39A 3BAZA 2YQ4A 3DZHA 3PJGA 1HLDA 2P9CA 2FHSA 3BIOA 1LDBA 4LGVA 4K6FA 4B8WA 1EMDA 2OO5A 1HWYA 4J3FA 2B69A 4WNCA 3RBZA 3TL2A 4DL9A 3I3OA 1XGKA 1WP4A 3TOXA 4AJJA 1UUFA 1LTHR 3LSYA 2DPGA 4EJ6A 2B35A 1PX0A 4LW8A 1I01A 4R1UA 1T2AA 2I66A 4A27A 1ZJYA 3D4NA 1U2DA 4YJDA 2E48A 4AJNA 4E21A 4TKLA 3H65A 1YO6A 3K92A 4BNWA 4BNXA 3VPHA 1T24A 1EVYA 3PZRA 4CUZA 1IYZA 2JHFA 3PQEA 4I5GA 3EZYA 3KSUA 5JCJD 3KV3O 2NU7A 3PDUA 4OOFA 4WOJA 2D4AA 3KVOA 1PJCA 3FI9A 3WR5A 2VHWA 1LBEA 1PEDA 2P4QA 4DYDA 2I76A 4B7XA 4BV8A 1P1IA 3OSUA 2RCYA 2J3JA 3OIGA 4ZN6A 1E1LA 1UP6A 4ONEA 2NLOA 5IDYA 4BO5A 2PZJA 1E5LA 4YJHB 5JPIA 1IZ0A 5T57A 1KEPA 2Y66A 4P4LA 1M6HA 3FBTA 4XYLA 5JCJA 1ZW1A 5CG2A 3Q1LA 1CERA 1RWBA 5A3VA 1BRMA 3GDOA 2VZ8A 3L9WA 4LCEA 4WE3A 1FXSA 1HYHA 1BTOA 1NVMB 2R00A 3I52A 3IUPA 1PGNA 2NQ8A 3ZHZA 4BO6A 4RVUA 4IJUA 4BKPA 3WFJA 4H16A 4PG6A 4NJMA 5JMWA 2BF7A 3Q6IA 4E4YA 4PN3A 3ZWOA 2CDCA 1CEQA 5GY7A 4YJGA 4MPDA 5I8ZA 1K5HA 1LLCA 1EVJA 2J8ZA 2F00A 5MDHA 4OOEA 4FFNA 3KO8A 3NX4A 4Y6PA 2V6MA 2X9GA 3HB5X 1ZK3A 3OJLA 1L1FA 4TRNA 1XSEA 3LC2O 1Z6ZA 4NK4A 3D5TA 4WCFC 4F6CA 1ARZA 4OKIA 4HX5A 2Q3EA 4YJGB 1DLJA 4PGFA 3O03A 2V6FA 1B0AA 1GD1O 2CFCA 5TX7A 3DZFA 3RUCA 3OQBA 1HDYA 4NJOA 1LLUA 5JYEA 2Q46A 2DTDA 3H7AA 3H9EO 4IMPA 5JW6A 3WQSB 4WLVA 2EEZA 4U6QA 4EJMA 1PGQA 1C1DA 3LZ6A 1PZHA 3JD2A 4W6ZA 1DHRA 1AHIA 1ZK1A 2ZK7A 2CZCA 5ENVA 4G2NA 3ETEA 4YEDA 3I9NA 3FSRA 4NU5A 3ETDA 3O8QB 1GZ3A 1IPEA 3PVZA 2VUSA 4YYZA 1I2CA 2O4CA 4CLRA 4CUJA 4NQZA 2FRDA 4GBJA 2IXBA 2VNSA 5C7OO 4ESOA 1Q0LA 3GC6A 1U3WA 1U3UA 4GX1A 4JGBA 2JCXA 1SEPA 4OXKA 4YDRA 5KVSA 1NQAO 1MB4A 3I6QA 1EQ2A 1V3TA 2X23A 3SLKA 5K6AC 3VZRA 3GDFA 5B12A 1TVEA 3JQ8A 4GKBA 4JBHA 1HE2A 4MVJA 1IHYA 3R6DA 1JKJA 4S3MA 1KVRA 3GGGA 3ZH2A 3L6OO 1K6IA 4II3A 3ZNOA 1NWCA 3BXXA 3AI3A 5L9AA 3OJOA 5A9RA 5L95A 3H4VA 4IJVA 3JQ9C 4D45A 4XD2A 3W6UA 1WZEA 4HP8A 3DBRA 1C0KA 3PXXA 1VSUA 4IDDA 4R1TA 4ZA2A 4CLOA 4Q3DA 3ADOA 3EVNA 2VOEA 5TQVA 3NDJA 3AM5A 4CLDA 1IL0A 5K0ZA 1EVZA 1MC5A 1JWAB 2YJZA 5KJ1A 1E5QA 2BFOA 4AJ2A 1QR6A 1QV6A 4QO8A 4RLSA 2DPHA 4JBIA 5C37A 3PP8A 5ITVA 4QX6A 3BMOA 3ZWNA 5KVQA 5U1PA 2HLPA 1JTVA 4GMFA 2NNLD 4B4UA 3C24A 3EAGA 3BHJA 5BNIA 1KETA 2W2KA 3JQ7B 3PGXA 3PJFA 3RBVA 2Q50A 5I7EA 5JYDA 1BHSA 5IN4A 2Z1MA 4DPKA 3ZV3A 4BKOA 2POQX 3GAFA 1HXHA 4NPCA 3WQRA 4B3JA 2Q45A 1B3RA 3CMCO 2Y1EA 1C14A 4H15A 1ZBQA 3ADPA 1Q0QA 2A9FA 2P2SA 2PFGA 3JD4A 1R37A 3JQ7A 1ZXBA 3C7DB 1I0ZA 4CM6A 2ZB3A 3NJ8A 4IJKA 1ORRA 2OBNA 3VHRA 2VZ0A 2J3HA 4TRJA 4CMGA 4GWGA 4BO8A 1WVGA 1EEHA 1SOWA 3KLMX 5EL0A 4MKXA 1A4IA 4QT0A 5JDCC 4AJOA 4D0RA 4CQLA 4U5QA 3SLGA 1NASA 1XLTA 3WWZA 2OP0A 3CTVA 5KWEA 2I9PA 4ZHSA 3AWDA 4CR6A 3D3WB 2C7GA 4B8ZA 4UUMA 2X5KO 5T64A 4CV1A 4KTTE 3QVSA 2DUWA 3GT0A 3INGA 1NQTA 2ZTMA 3LT2A 5JCXA 2JCVA 4ALJA 1NHWA 4G5HA 1BG6A 1KVTA 2Y1CA 4NMHA 4YACA 5DBGA 1R12A 3EVTA 1MFPA 3AK4A 5G0SA 1JU9A 2HAEA 2PV7A 3JTMA 1X0VA 4U6SA 5IF3A 4AFNA 4IQ8A 2VT3A 2ZQZA 4ID9A 4D44A 1P44A 3RD5A 2X8LA 2EKPA 4WUVA 3H5RA 1YDEA 4U0JA 3HDQA 4KDEA 3Q2KA 2NVUB 3F3SA 2G17A 2Y68A 4FJ0A 4R1SA 4DIOA 2AG5A 1LRKA 1YS4A 1JN0A 4YRAA 1YBAA 2YHIA 5ES3A 3O8QA 3TF5A 2ZKLA 2R00C 1O0SA 3ITKA 4J4BA 3LT0A 4FB5A 4Y8VA 4A73A 3BMQA 5L40A 5LDGA 1CJCA 1VI2A 3RROA 2B4QA 2GO1A 4BNGA 3WYBA 1BDMA 3G17A 5ER9A 4CV3A 2HCTA 3G49A 2VTDA 4XR9A 2FPGA 2C2YA 2QX7A 3W8DA 3CMMA 1PS9A 3G79A 3BMQB 4TSKA 1E1KA 2ZJ0A 4QQRA 3CZRA 4CQMD 4DMLA 1NR7A 1O89A 4K6CA 3GG9A 2O2YA 3FHLA 1RM3A 2Y1DA 2XOXA 4FOOA 3PFFA 2W2LD 3DZIA 1N7HA 3EY4A 4WLEA 3F1LA 5JBIA 3A28A 4P4NA 3OJEA 4RQTA 3W6ZA 1NPYA 2JCYA 2JFGA 1CETA 1ENOA 4ZRNA 2VWQA 2JL1A 1NHGA 3AY3A 5IJZA 4K9DA 3OEWA 4YAEA 3CPSA 4XYEA 2Y67A 3L4BA 4CLOB 3NJ4A 4NHEA 1C0PA 3MJCA 2V65A 1GZ6A 3O38A 4IIVA 4BNNA 1NNUA 2OMEA 4C7JA 3P19A 4HV4A 4IQ0A 3JQAA 4ZU3A 4A5OA 4CM9A 5TS3A 2BFPA 1DIRA 2QZ9A 1BGVA 3BYZA 5BSGA 3IAHA 3JCZA 1FDVA 4RPHA 4L76A 2VNAA 3RQSA 4QUKA 3G1UA 3PWKA 3LLSA 3S8MA 1V9LA 5TSDA 4B3IA 3PEFA 2HUNA 3AJRA 2HMSA 1T4DA 1Y9EA 4BUCA 2B37A 3RFTA 3GUCA 1MUUA 2NWQA 2X0JA 4Q3AA 3TWOA 5A04A 3ULKA 4EUFA 5G0TA 5TNXA 5JO0A 1HYEA 4QTZA 4BO7A 1KS9A 3BMCB 4LRSB 3OQ1A 2NTJA 1HETA 3M2TA 4HFRA 1YXMA 5I8WA 1EE2A 4HY3A 1YQXA 2YFHA 2WDZA 2YUTA 1P3DA 4P8RA 3KETA 3GEMA 4GMGA 4E3ZA 1EDZA 1LRLA 2UV8A 4DA9A 4BHTA 1CF2O 1GL3A 4GI2A 5FFFA 4PLFA 5DBIA 2W2KB 1UXIA 4DTIA 1LLQA 4TROA 4KQXA 1DAPA 2I3GA 4E5PA 1U1IA 2BFAA 5A5FA 1HDCA 3JQAD 2PGJA 3ZDFA 3QRWA 1YE3A 2V7PA 4CM3A 4RO0A 3PJDA 3STHA 1F14A 4WLNA 5CDGA 4I5EA 1W73A 5CDSA 4I9NA 1ZNQO 4AL4A 3B1KA 4O5OA 2JHGA 3FRJA 2GR9A 4XRGA 1K2WA 1N2SA 5A1TA 3I4CA 3AUSA 1QLJA 4Z0TA 1LDMA 1QLHA 3H9JA 5JDIA 4MIEA 1KY4A 3GOHA 4L4SA 1K6JA 2EP5A 3UF0A 3VPSA 1PZFA 1CQJA 3EHEA 3WLFA 1V3UA 2GN4A 2CVOA 3TPCA 1PQPA 3V8BA 1PL6A 5ICSA 1IPFA 3EUWA 5B4VA 1IY8A 2ZYGA 4FFMA 4R3WA 5IZ4A 4PLTA 2CNBA 1JAYA 2R6JA 4NR0A 4UULA 3RVDA 2ZQYA 1BVRA 5GZ6A 1RJWA 3PHIA 4PLVA 2FZEA 3RIHA 4CM4A 5JSFA 4OQZA 3P7MA 3UUWA 2HK8A 4KMSA 3RKUA 3K73O 3X2FA 1QP8A 2D5CA 4B7CA 1VKOA 3ASVA 4FIZA 1E3WA 5CG1A 3B1FA 1H2BA 4JX8A 4MVJE 2NTNA 4N5LA 4XX0A 2C07A 4OM8A 3U4IA 2FR1A 4OO3A 2BD0A 4XQEA 2NV6A 2YV3A 1I32A 3FPCA 4CM4B 1GUZA 2VCYA 4IUYA 3AUTA 3TN7A 4R68A 4YT8A 4N18A 1MXHA 2UAGA 4DREA 3RSHA 4YCAA 1KEVA 1R15A
chains in the Genus database with same CATH superfamily
2GEBA 1FP4A 4FI3F 2CDBA 3BL8A 1RP1A 2E4AA 1DAOA 4OFWA 1E96A 3EQ2A 4PCLA 4CIXA 1OFCX 1G7SA 3RQIA 1YUBA 2LDBA 3G02A 4I9HA 1YQDA 3TSCA 2FEAA 5LZ7A 1JJAA 4BNTA 4NS4A 3QM1A 1AURA 3FWKA 5HKBA 3TG2A 4JB3A 2ZUSA 1I94B 1MB3A 3ZQ6A 1AS2A 5HQ3B 4RTKA 3VH3A 1XDWA 5BORA 3DJFA 1J1UA 1YL7A 3K1YA 4YV7A 3UTCA 3HBAA 4IS2A 1GPJA 4B8YA 1V5EA 3O6VA 2MSDB 2R4QA 2ZBPA 4D5EA 3KNZA 1MCZA 5L7YA 3WNZA 5CFZA 1UC4B 4AS3A 4ZYWA 5GONF 4WESA 2FWIA 3B6EA 5LXTB 2I9KA 2ZATA 4W82A 1S3IA 2PH1A 3MAAC 1GFZA 4IIDA 4YMWA 1M1XB 1E3EA 5DT9A 4DGSA 1BHQ1 1NNSA 2O8NA 5L3VA 3UC9A 1F5NA 3DH0A 5CGQB 4W9MC 5EUQB 4UQLA 2DHDA 3RI3A 3UT5B 3JYQA 4WHMA 3W2IA 3F9CA 1DKOA 2YN0A 3ETGA 3N2GA 5DM70 2F7SA 2DJ5A 4ZT2A 1KO1A 2MYTA 1T9CA 3TEFA 1NNEA 1V45E 1VJRA 4G1CA 1H1DA 2VA9A 4PGHA 1ZNZA 4YDHB 4KE8A 5JPDA 2HCBA 4RU1A 1P72A 3EC7A 4JMPA 1Y6GA 4I8DA 4JFRA 3N2YA 5K6RA 4YRMA 1TLFA 2O7QA 1U3VA 2TRSB 4I19A 4YAKA 1F2TB 3AU8A 5CVTA 3BB1A 2E2WA 2I8AA 3QLJA 2CNWA 4XDZA 3E82A 3DWIA 2KSQA 2R4TA 2IODA 4O2RA 3ZZNA 2PH5A 5KWJA 2ZOSA 1MH9A 4I50B 2XADA 1Z47A 4XQCA 5TR9A 4X64B 4BCDA 4BP9A 2OXRA 2HJSA 4UPEA 4B9EA 5JAZA 1IY9A 3JAKA 1JYFA 4ARCA 1Z2OX 1Z8NA 3GLKA 1U31A 2CMFA 4FX5A 1YKFA 3HKBA 4V02A 3OCYA 4FN4A 4MKZA 1PE0A 2J32A 4OXXA 3HKDA 3NBUA 1I6MA 2DFLA 2HOQA 5EWMA 3KUDA 1FY2A 2XITA 3DFKA 1VI6A 1QGYA 2L2QA 4O4JB 1VJGA 2CUKA 2WTXA 3DMGA 1QC5A 3MCAA 4NOLA 1KSGA 3RU9A 4IGFA 1KQGA 3C0KA 2Z6VA 4Z4CA 2AE1A 4IFIA 2HJHA 3R3WA 1Q1BA 4KK4A 1LU9A 1GGHA 1E3DA 4NONA 4MVJM 1QUEA 3RNLA 1OTYA 4JVOA 2OSBA 2PO7A 3THOA 3UFXA 3AG5A 1F12A 2FPSA 3RUHA 2ATVA 4FFSA 3HKDB 2PE5A 4KODA 4QFDA 4Z2AA 3ED1A 3HU1A 3JD1A 4Q24A 5K4AA 4BQRA 1L4HA 1DE0A 4BE4A 3L1HA 2NZWA 1WETA 3V2GA 3K6SB 1PD0A 2D59A 2VCEA 5A71A 1G6KA 3UIEA 1GO2A 1KAHA 1JX6A 3K9WA 1T6ZA 4BJ3A 4Y98A 1OA1A 3MJEA 3SS7X 2EVWX 2GHTA 4Z53A 1PQ4A 3GJ5A 4ETIA 5BV0A 2D74A 2DAPA 2F8MA 1LV8A 4AMZA 3EGDB 3FCYA 5CHEA 2QRZA 3ZOKA 2BM8A 4LTNA 4X97A 5IUJC 2PZMA 4UCQA 1OY1A 4MW9A 3CZQA 4BQSA 2NXEA 2CN1A 2R8XA 1XKXA 3ITEA 3D43A 2NUAB 3AZOA 4GQIA 4PZAA 3BSSA 1DBRA 4ITVA 1QXSA 2IE0A 3F2IA 5B30A 3CZ5A 1J39A 2JW5A 5IF9A 3VOTA 3VR2A 3CUUA 1Z45A 4LY9A 2AA3A 1ZY2A 3VNAA 4LCJA 3KZVA 4MW1A 7GPBA 2CLOB 2QRNA 4C4YA 1ENPA 3B51X 4DMMA 1UP4A 2GK7A 5HVNA 3GH1A 1BE8A 1F0KA 1UOQA 2C0CA 4FWIB 2B83A 4UU1A 5EE3A 5F5NA 4KXXA 2V7BA 4DQ0A 1QK5A 2AUNA 2Q4TA 4HDMA 1UWKA 1HE8B 3WO1A 5JCOA 3PYLA 4L50A 2PRJA 1SIOA 3BN3A 4ETMA 3IGFA 4CV2A 2D7JA 4DMKA 3DZ8A 5T3YA 2IXAA 3WBKA 4XIYA 5IXYA 5KQLA 1DAEA 1Q19A 2OBXA 2W2VA 1GGKA 3P20A 2P90A 4PLPA 5CDUA 2NN3C 3GHHA 3U3DA 5J4LA 1LSOA 3FTEA 4P3PA 2FB9A 1OVGA 2DM6A 4KXVA 4XCVA 5LZ5A 1W4ZA 2O6HA 1Z13A 4L57A 4ZQHA 4J3NA 2CD7A 1FTNA 5BT9A 1VZ2A 1X1AA 4OIFA 4C4OA 3D59A 1ECCA 4HX2A 5J2UA 3T41A 4ESEA 2QZZA 1L5GB 3DC2A 5GIPE 5ENDA 1ADJA 2YICA 3I2YX 3EULA 4MEAA 5DI3A 3L6DA 2B9EA 3FN4A 1VA5A 3GEDA 4J9VA 2HHAA 2Y0DA 2SBTA 5DHFA 3TL6A 3ZCUA 2Z2YA 3E7XA 3FCCA 3DWFA 1YNSA 2HDHA 4IDHA 4W99A 4A8JA 4A2QA 3T3MB 4AMUA 5ELXA 5FD8A 1Y1PA 4QVGA 4AG3A 4BMPB 3KTOA 1OCEA 3F8SA 1R8YA 3ND5A 2NADA 4XJXA 2FPOA 3QFRA 5THKA 4BMSA 4G97A 5DIFA 1C2TA 2GXUA 3TVTA 2XX3A 1Z5UA 2PWZA 3MAJA 3UTDA 1J21A 2C42A 4D56A 4KXLA 2V3CC 1QG6A 1JKMA 3Q88A 4G8CA 3L0IB 2P9EA 1PG2A 3M1YA 4D4GA 5JJKA 4BO0A 5JDCA 1P80A 1VM6A 1D1PA 4DOMA 3INTA 3T1HB 1JH9A 1XZFA 4E0BA 1F8UA 1RYZA 2PX6A 4BNDB 1XCBA 3VSEA 2AHRA 4PY2A 3Q40A 2IZ1A 2IGBA 1KO5A 2XMQA 4S04A 3EH2A 4FEEA 1Y3DE 1HM5A 2I1VB 1Z4QA 3EXG2 4TT8A 4DV6B 5ALRA 4NCNA 3RT1A 5KVAA 1U0HC 4TZ6A 4OVKA 2J3LA 2QG9A 1SRQA 2RIPA 4I4TF 3UJ9A 4A92A 3ON5A 1ZCZA 5AXDA 3UT0A 1TNDA 4F4HA 4P86A 2QUZA 3LX5A 5KTSA 4OLBA 1D6JA 3USES 5BPFA 3HXLA 4C43A 3NATA 1GZ4A 3D8BA 4WNIA 5JU6A 4E7OA 4GXRA 1DEXA 1HRDA 4YECA 3MTIA 5BSKA 2JFNA 4BX9A 4CU2A 3PXCX 3WRVA 4IM7A 2OD9A 1XTQA 1S2IA 2OR3A 4I6JA 4C1BA 4EGFA 1KC3A 2G9ZA 2E4ZA 3I01M 1VG9B 2G8LA 1TJ3A 3IB6A 3NBQA 3E81A 4ILKA 4ME6A 3B3JA 1A4RA 2PKQP 4LPSA 1K8QA 1WSDA 2L18A 2C99A 2ORYA 1W5BA 2WSLA 3COSA 4PG7A 3COYA 5J5CA 4C3ZA 3GFRA 1K5PA 2FU5C 1JEYA 3WGUA 4Z51A 2ISCA 3HABA 3FMPB 3M3PA 4YJ2A 2R0QC 3JZFA 3LDAA 5HJ7A 4DJTA 3HP1A 4ACAA 1OI4A 4O59O 1N7JA 4Q93A 2BMWA 2IELA 5EIEA 1Z5VA 3KAJA 1NT2A 1X9GA 3I4LA 3AVQA 3AI1A 5IVDA 4F3YA 1AF7A 1AUPA 1O4WA 1P4RA 2C0PA 4O6VA 5AK6A 5KHOC 1DS6A 3Q85A 4MLZA 4L1KA 1RRCA 2Z2JA 4NX2A 3GA7A 4BZXA 1DCKA 4CIVA 4ZP1A 4FR0A 4D98A 3P2EA 3MWEA 3LVBA 3FCXA 2C03A 1FBNA 5AK0A 3SZMA 3DP9A 3TLKA 4DR1B 4LZWA 1HFJA 2HMUA 3D2BA 1PR9A 3I2GA 3ONVA 4NVRA 4Q3BA 4WVLA 4QLBA 1V8BA 1LA2A 3BREA 5TT0A 3OQIB 2I4OA 4WACA 4PSKA 2EWWA 4PGAA 2WZDA 4ZVVA 5C1IA 3IDAA 3IHKA 2PD4A 2CLSA 2PX3A 5J4HA 2VOJA 4Q18A 3EXFB 5A9SA 2XCLA 1BJTA 2RH4A 3PFGA 1Y3BE 3RUAA 5AM2A 1CWUA 1XNGA 2FSSA 5EY5B 2AOTB 4MV8A 3MWEB 4LUCA 4L7VA 3U31A 1I2DA 4KAXA 1ZHHA 1JBEA 4OHMA 4D26A 1GZHB 1NR5A 1VJ0A 3AR8A 2C5SA 3H13A 4KCGA 3MJHA 4OAOA 4R2HA 1KE1A 4TLDA 1UPBA 4GNRA 3O4RA 4LE2A 5F5LA 4V38A 2W37A 1RCTE 2C2XA 4WUTA 1PZNA 2JGKA 4RVGA 3C7KA 1Y6RA 2O8VA 3GDWA 3K1JA 3J80A 2DPMA 5KINB 4S1WA 5THXA 3BL5A 1OBCA 5SICE 1T34A 2Z4TA 4V3CA 2QAGC 4OJQA 2G8NA 2GZMA 3EEBA 5H5JA 2RGWA 2VSFA 1WE2A 2QD4A 4MRVA 3LTNC 5EJIA 3VGPA 4WLFA 4GC9A 4GM1A 4K9KA 3RUFA 1NAIA 1V9CA 3K72B 2NU7B 4AJ1A 5FCDA 1A7JA 5ALYA 4FGWA 3NV7A 4EPYA 2CZQA 3BJMA 1NI3A 1YHZA 4X45A 2QE7A 4ZXFA 3AOEA 1KDPA 3RT9A 2H5EA 5EHGA 1KY5A 2DULA 2O2IA 4P80A 4V0MA 3TLMA 3VOSA 4E07A 4F46A 4A2PA 3R3HA 3AT1A 1KDRA 5GZ1A 1W93A 1YZGA 4L74A 5T8KC 3S68A 2R62A 3AR7A 4ZKEA 1E5TA 1GR1A 2GCEA 5EZ5A 5AVVA 1EXVA 5L6LB 3D3WA 1WB5A 3F6PA 3OZVA 3E9EA 5MN6A 3UG7A 3BKXA 1Y9DA 2XZPA 3OUZA 3AIMA 1BWPA 4JH0A 1RQ2A 3UB3A 1TEHA 1I7NA 2WMDA 4BFZA 3HDJA 3PD0A 4BKQA 1G64A 3RSLA 1OFGA 4ZO8A 1DRVA 2Y2UA 3U7HB 1CY2A 2OBLA 1URPA 1ZZEA 1JFRA 3T7IA 5KYGA 2QHXA 2ZRHA 3B1WA 4D9JA 1XK6A 1DC4A 1Y81A 5B1EA 2NO0A 3CXRA 1W5FA 2ZUVA 1XD9A 5FTWA 3QENA 3ENNA 4KQJA 4LECA 4NBRA 1EG7A 4IDOA 1UQUA 1U3FA 1IDOA 3PQ8A 4O02B 2PJRA 3QBDA 3DE6X 3DFMA 1AZTA 1I7PA 2EFDB 2P2NA 2YZGA 3D0QA 2WM9B 3GL9A 1GUBA 5KNDA 1PUJA 1IB0A 4URYR 4WGGA 1SUAA 4XPZA 1U6IA 1AA9A 5COAA 5EE5B 1GTG1 2CC2A 3KCNA 4NZYA 1RJ9B 1W4BA 4HEJA 1PI3A 5E2BA 4MV1A 2VAVA 1YZHA 2OXCA 2C2OA 3HKEB 3ZKWB 1G55A 5DB4A 1MEOA 5HFAA 3A6DA 2DFKB 4UHBA 3C5EA 2DLDA 1KGSA 3N28A 4IXTA 4BVAA 3FOZA 1L8LA 1UFOA 3WNQA 3BG5A 4LFAB 3WS7A 2FEKA 2GZ1A 1ICIA 2V54A 4R83A 3I0ZA 5CT8A 5A4FS 4PYOA 2WILA 5C0OE 3UJBA 4TYWA 1V4BA 3DL0A 3CUKA 1EFUA 3TGPA 1KDOA 1W4CA 3ZU6A 4GI1A 3SQXA 2CBXA 3LD9A 1DC8A 3RC8A 3F7TA 4J1SA 3LUAA 4NFHA 3D6FA 2DVMA 5EWJA 1ULTA 4M9UA 4Q02A 1L5OA 2GCPA 5BR8B 1JDUA 3AY0A 3AHCA 4PIMA 3CLTD 2AT1A 2VL7A 5EQFA 4AO8A 3JS5A 4EPTA 1FYWA 3T61A 1CQIB 4PZPA 4TSFD 1VJTA 3FZGA 1CXZA 3ASUA 3M5CA 3ANTA 1E7SA 1JLLB 3OBIA 1P9OA 1AKVA 2QSYA 2JH8A 4ZREA 3L7KA 2R1UA 2VDKB 1JPNA 1WXIA 1Z2DA 2EDCA 2HDWA 3H9BA 3NIFB 4MWTA 3HJAA 1ACJA 1IULA 3IERA 4C7OB 1FNSA 2REQA 4XW2A 1M72A 4XB2A 2VBIA 3KEFA 1NPDA 3DJYA 4DDVA 1CQIA 4H31A 3KKZA 5ERXA 1Z2PX 5K0GA 4NRDA 1Y6FA 3SYLA 2PUCA 2P9ZA 3WGYA 1APBA 1N7IA 2HIHA 3VYRB 3FD8A 1VQ1A 3FWHA 1AMNA 2IS6A 1OLOA 1E8NA 1JHMA 1KOJA 2TMGA 4NBWA 4FHGA 5ECGC 5LUBA 3RS2A 1GCUA 3IO3A 1SU6A 4FDTA 3ZI0A 3GFQA 1OOEA 2HZBA 2PG3A 4P3XA 4D0SA 4AXBA 3W34A 2C9DA 1CUBA 2AJLI 4FGKA 5FI1B 5ICEA 1O0BA 2ZAYA 1SUWA 1DX4A 4GMKA 1C7QA 1PFVA 4O2BA 3GPIA 1RTTA 4GLJA 3A10A 3IOMA 2AEFA 3KTFA 2AMLA 2C8KA 3HADA 1I6WA 4IY1A 3W2GA 4AYTA 2R65A 1HEUA 1JFFB 3LC1O 3KL2A 4Q9KA 1K8XB 3WHPA 2F3PA 3RSQA 4BKRA 1P4AA 1RQ7A 1J90A 3SX4A 4PRLA 3AO0B 2WEKA 2OBMA 4ZYUA 1CY4A 5BNFA 1LJLA 1XWFA 3NT5A 4ZVOA 4B75A 1I51A 1VHQA 4GU5A 1BJRE 2QAIA 2OYCA 4PLWA 1Q2UA 4PHCA 4XIJA 5B7GA 2OCYC 4AVYA 5JHHB 2VT7A 4M9SA 5HTOA 4DLZA 1POWA 4YUVA 3BUSA 1J8DA 5EA2A 2I3BA 5LQDA 2P2GA 1VKNA 2QRKA 3D54D 3N8KA 3UK0A 2HIMA 5FYDA 4MEBA 5BQXA 5U4QA 1DWOA 5FI5A 4E94A 2ATEA 1OXKB 1H5UA 1RLJA 2IBMA 3IPLA 5ALFA 3QW4B 3LRXA 2IY8A 1XF9A 3MLAA 1MJ5A 1O95C 4Z9XA 3JASB 1DKPA 5ULLA 1OILA 3A4MA 3H1EA 1AT1A 3ZHOA 4DIMA 4Z4GA 2CMDA 2OO5C 4RVSA 1PJTA 2B82A 2ZWPA 4G0PA 4MK4A 4J4HA 3LVFO 2ZRQA 1DG1G 3QVVA 5BVGB 5LYJA 3EZ7A 4R05A 4TL8A 4UAGA 3OQNA 3CPHA 1N25A 3OIYA 4MVJG 3WMRA 3DHVA 4GI5A 3KP1A 5FQNA 2ODNA 3DTTA 1ZQ9A 5JY1A 2EW8A 3MS4A 3CISA 3B20A 5EKSA 4OQNA 3AXTA 4X95A 1ABFA 3K96A 1XDZA 3WA7A 1W1WA 2FW1A 2C96A 3PEUA 1QDEA 1YB5A 2IDZA 1ZJ4A 5F3RA 3TBKA 3FPHA 2FDXA 1UJ4A 1NOJA 3AR3A 3P4XA 3G2KA 3SZUA 4KQHA 1NULA 1WZIA 1XHLA 3ID6C 3BWVA 1EM8A 3F3MA 4RE6A 1II0A 8OHMA 1Q57A 4YRDA 4N3AA 1I7QB 3IOBA 1UM9B 4NATA 5AI8A 4IOKA 2Y99A 1QTNA 3DAFA 3NIGB 3VU8A 3VAAA 3FR7A 1V5GA 2ZRCA 3Q5DA 3TQCA 5AO9A 3UMRA 1E2JA 4NNOA 3KJIA 3EF0A 1BIFA 1RYFA 1K6MA 1YUMA 3TD9A 1JDSA 4PICA 4PYMA 3O4FA 1J23A 2FK7A 4LBWA 421PA 4F6RA 5I6DA 6ABPA 3O8RA 3TUZC 1H23A 2FPIA 4FCCA 2UVDA 4EW1A 1YAJA 1THTA 1L9KA 5CA1F 3DEYX 2XH8A 3FVVA 3JQGA 1V3QE 4R9NA 4CRWB 2VWGA 3NMUF 2R8ZA 4RPLA 2LIPA 3SHTA 1OE0A 3TW8A 1AHHA 3IUJA 3B6IA 4PIPA 1P31A 2CNNA 1J99A 1YB6A 2BR5A 2OK8A 3V34A 3RAEC 4PLHA 5E6RB 1TGVA 3TW0A 1QAOA 5HR5A 2W70A 4ER7A 1RZVA 4I7EA 4L5YA 5AHRA 4GZ5A 5KKNB 5ALHA 1J0BA 4II2A 1MO3A 2H9IA 2P7IA 2YFQA 2F59A 2XGOA 4ZXPA 5DOZA 3Q2OA 4QA9A 1MV8A 1U3CA 3L0BA 4IUDS 2X9QA 4A15A 1WNFA 4BXOA 5M2QA 3LUKA 3MWYW 3OZTA 1G8KA 2B1IA 3ZHXA 3IT2A 1GPDG 1IK4A 3PNPA 2CHUA 5E6RA 3NHWA 5JYBA 2IBTA 2B8TA 2OV3A 1CZOA 1DEKA 1PEYA 1E2UA 3LHDA 3Q7TA 3WGLA 1QS0B 3RTBA 4AMBA 1YS9A 3G9TA 2WE7A 4TMKA 3MSCA 1IBCA 2EX0A 4NJEB 1QF9A 4P83A 1VMKA 3IIIA 4P7FA 2AN4A 4QDJA 1EK2A 5E4TA 4OFZA 3RWBA 4ZZIA 3VZBA 4E4TA 2D0IA 2PKEA 2YWFA 1ZKDA 3L43A 1RE1A 3OU6A 4GKAA 4LJLA 3HLYA 4LSZA 4OHRA 4C2AA 5IM4A 4X60A 4ZARA 1ADCA 1D1TA 3GPLA 4QU9A 4X0EA 4KEAA 4X85A 3P5BA 1CK4A 3FWZA 3EUFA 3LI2A 5G0UA 4DSAA 3DR3A 3D31A 2PMWB 4B79A 5C8DA 3PUVA 4JGGA 4ZQIA 1T1GA 4N7RA 1SUBA 2BL4A 3N7UA 1U1EA 1L1EA 2AEEA 1DUVG 2BJVA 2D00A 1XMVA 3QKRB 1M8GA 3L1IA 3LUPA 4Z3KA 1WV1A 3KYCB 3ITDA 3W3AD 2CV2A 1YC5A 2FVXA 2HJRA 5FULA 2VHTA 4DIFA 4DLSA 1ATZA 4Q4JB 4PYQA 2UUAB 4KR0A 4MA5A 2F1OA 1HNZB 3E8XA 1J2TA 2WUGA 2WJ4A 3EEYA 3MMPA 2I2XB 2QLFA 2ZSJA 3GMDA 4GE0A 4GF5A 4CR8A 1G60A 3PC2A 1ULSA 4ZD6A 5CJJA 1KK3A 3EW7A 1TMOA 1MG0A 2AK3A 4TV8B 2LTAA 4BECA 2OXFA 5INTA 4EX7A 5CDYA 2WB4A 4OHYA 2GETA 4IIYA 2OYRA 4UPDA 4PTLA 3MRVA 3WV5A 4HDRB 4W5JA 4ZVUA 1FMJA 2JGRA 5GADl 1ESZA 1RI4A 3LX6A 4KXFB 4MZDA 1UIRA 1ZIPA 2Q4EA 3KZNA 5DO9A 4RIEA 2O2ZA 5LLSA 3RVSA 4DHWA 1SXIA 3R6TA 1U2ZA 2VQ3A 4HEQA 4YMGA 2NO4A 2OHGA 3W5CA 3ZLJA 2XAAA 4PQRA 1BHJA 2R86A 4NMXB 2ONCA 4B33A 4DUZB 2IT1A 2P8SA 3VDQA 3DMFA 1S9DA 2CFSA 3HKBB 3N87A 1BWQA 3H11B 3KKLA 4M0KA 3ABQB 2FOLA 2DHQA 2AQHA 2FPXA 2W6JD 3B2NA 2E82A 3QXJA 4PX3A 3ZWCA 4IINA 4YP9A 1M2JA 2XXAA 4EW6A 2H5LA 4ZOEA 1BYUA 1D4ZA 1JDPA 3LKVA 3MMZA 4C4ZA 5C81A 2GCOA 3PWSA 1RQGA 4L02A 3G0IA 5ALXA 3TPZA 5H4HA 4OXYA 1DO8A 1ZC4A 3FOWA 4KXWA 1ACLA 2FZWA 2WIBA 4Z9YA 3OIFA 1RVV1 3O47A 3V1TC 1K0FA 2GYYA 3F6BX 3INNA 3EXHB 3TLAA 1IWOA 4ZMRA 1F7UA 4QDXA 1KH3A 1M34A 4QWWA 1KAEA 1RQPA 4EA6A 2QD2A 3S2ZA 2IV7A 3SIXA 3DEHA 1WWKA 1C3OB 3RVNA 1XC7A 2C29D 3KUCA 2IUEA 2I6UA 3ONWA 3AEZA 3D0KA 3SOPA 4LYFA 1AA6A 1AY0A 4EYEA 2CDAA 5K0BA 4KPFC 4UKDA 3E18A 3MT0A 4PFJA 4EPVA 5JT1A 1ZWLA 3AUFA 5FAXA 1C8VB 3DUFB 4WKCA 2A0WA 3DM5A 3K2BA 5IAKA 1PSDA 3DCJA 1RYHA 4OU4A 4TYPA 5K6AA 2YZ7A 3K4PA 2HQOA 3QK7A 1IEXA 2QTAA 3ZXIA 2IHVA 4JYAB 4F8JA 3ZU2A 5ADHA 2QBYB 1BWSA 1L7PA 3CLUC 2WD7B 3SWWA 4PLGA 4Y2SA 2VZ9A 1P2SA 3CJQA 3LXXA 4MVJI 1NX6A 2BE9A 1AGRA 1B43A 5EWLB 3WSTA 2W58A 3I01A 1P45A 3ZHBA 3LHSA 4BNDA 2EBUA 3COZA 2AG0A 4MJLA 1PJAA 2CF6A 4QJ5A 4KIJA 2ZBFA 3EXIB 3NIDB 4HGRA 4WXHA 1M1ZA 2P3LA 3WGGA 5ALGA 1GG8A 1BD4A 1OMOA 2M32A 2LPMA 3M6IA 3U56A 2FQYA 4Q15A 1Y80A 3EDQA 4JKIA 4DCJA 4QJIA 4IR7A 4IRMA 1XPOA 1D0IA 1X94A 4OATA 2C5GA 1Z73A 2V9PA 2XWBF 2OC4A 2Q0HA 4KDRA 2FFBA 2G5PA 3D7SA 5JV5A 1KI2A 1IOVA 2V59A 3M4NA 1T26A 2NXJA 2PT6A 1EFCA 2X6RA 3QWHA 3R5HA 1KZGB 3W4JA 4ALMA 3OO1A 1SRRA 2NSLA 2BTQA 4MQMA 2X3UA 4OJKA 3RIYA 1PVDA 3ZHVA 5F1PA 2AC2A 3NASA 4IW3B 4Z8YA 4YYEA 2V7QD 1WHTB 4WEOA 5KAPA 2C3UA 3ZUGA 2YYYA 2YVUA 5DISB 1U1GA 1VBKA 4C4TA 5F73A 5K0FA 2UYHA 3OE7D 3WNCA 4RF2A 2QDXA 1MHTA 1UBRS 2QG6A 1CVLA 3IE2A 3C8UA 3F71A 1C4XA 1I0IA 2Z3ZA 3E5RA 2WVHA 1OLUA 1X38A 1PJQA 5DI3B 3S2GA 3STWA 3T9BA 4F2PA 5BWMA 3H8JA 3GJ6A 5DGXA 4YRGA 1JV2B 1QX3A 4PLCA 3AB7A 4U2GA 4W7IA 1XAHA 4JYPA 3UHJA 1S02A 1JG6A 1YJ8A 2PYDA 1AKMA 4PSAA 1M2KA 5EHZA 3ZWQA 1P91A 3DVRX 1O8CA 2HIAA 5LA6A 3S27A 1U3TA 1SELA 2GGSA 2NNWB 1JFTA 1UBGA 1X86B 2GZHA 2NGRA 4QAQA 3HB7A 4ZAYA 1RZUA 4D8WA 2PKWA 1FLDA 4PSVA 4RLHA 1QIFA 4RHXA 3Q3HA 3UMFA 1SUPA 3OSZA 4DARA 1XRQA 3QBTA 2QJTA 4QYTA 1F0PA 5HE9A 1X15A 1U8CB 2JCGA 1XD2B 1GL6A 1RLUA 3BM5A 1LPSA 4LC1A 2XUAA 3VU3A 3GF4A 4YP0A 5AUQA 1JNYA 3WIDA 3DUWA 5LQAA 1PSWA 5F3DA 4YR9A 2G36A 2DBQA 4D2IA 4A7PA 5GM1A 1JXOA 2JLAA 3E4DA 5EVCA 2XBLA 5BMVA 1BVUA 3O93A 3ZHUA 1S4QA 5ESXA 4ZT5A 1Q50A 3A3KA 3G0CA 2HLNA 4O33A 4HNAB 3TYXA 2EF1A 3IEVA 4JB2A 2MDTA 3DW3X 1JDTA 4CIYA 4NS1A 4YV0A 3UOAB 2ZRBA 3AFGA 2VXYA 4TWBA 4K5QA 2WZQA 2O3UA 2CEAA 5HEKA 4OHBA 3C3YA 1OC4A 3C5WP 4DV5B 1UDXA 1S1MA 3NXSA 2AMVA 4R41A 5F2EA 4OB8A 3AR5A 2OLEA 2Y1OA 4RESA 3ZD9A 1HYGA 1S6YA 1T1RA 3H2GA 3QVMA 4K9SA 5A4AA 3CGGA 5E4YA 1Y8RA 1BMFD 3K8YA 1DU4A 2J0SA 1Y8ZA 2ZYRA 3WX0A 2HU8A 1SCNE 4NZNA 5BYJA 4FWBA 4YFYA 3VH1A 2XYGA 4YY3B 3GELA 1E0DA 3GBSA 3HYCA 1QORA 5HIKA 1OFVA 2O59A 4H1UA 6LDHA 4ZQGA 1SOAA 1OQAA 3PQDA 1W46A 3QY0A 3VR5D 1VFNA 2C88A 1ZVVA 2C9ZA 1I6KA 1Q84A 1NRIA 4HPWA 4P38A 1YDHA 1J8VA 3L92A 1PDVA 3CKYA 5EMLA 2VYVD 3T95A 1DC3A 3L82B 3HO1A 2XB2A 1DQNA 1FU4A 5DNVA 2H1OA 1ZD1A 3GHYA 4J94A 1VDZA 5BOSA 4POOA 5BMVF 3I3SR 1X1SA 3REGA 4GRIA 2FW0A 2WM3A 3OTQA 4MPTA 4NECA 1YVDA 3AC0A 1WW8A 3MC1A 1DDOA 3BWDD 3L8MA 4FBGA 3ZPXA 1OFHA 3KHSA 2X8BA 2AZXA 2FN9A 3V4VB 3EE6A 3IA2A 2PUWA 4NBKA 4UBLA 3QQ5A 4M1OA 5E9WA 2IHBA 5TPZA 1K68A 3BSWA 1LDYA 2PGAA 3VTAA 1NI4A 4YT2A 1BH2A 2HBYA 3G9QA 2H5IA 5JJCA 4MR7A 5JNWA 2Z8YM 5FPHA 3P27A 2QPLA 4CU5A 1QFZA 2ZBDA 4J6FA 1U7XA 4TMVA 4BLVA 2WT4A 3QWAA 4BN0A 3C6MA 2Z5LA 5CLJA 5FXMA 2R6ZA 2XD9A 3HEBA 3JWJA 3JX9A 4U63A 4TPKA 3TZEA 3WYDA 1XG5A 4UEKA 4R1NA 2HJGA 1DEOA 3ONFA 3CX6A 2ZUFA 1DKRA 1M8PA 1X1TA 1XU7A 1Z06A 4OB6A 3I5YA 3KJGA 1IHDA 4HR7A 1JDBC 4AF7A 2O1WA 4YRKA 4OSOA 4F97A 3I30X 2EJTA 1U8XX 3ZLUA 4QPNA 1ZITA 5J47A 1QYIA 3JVIA 3ND7A 4MKGA 1A9YA 1JHOA 4X1IB 5CX1B 4P0QB 1JHVA 3GJXC 3ZCPA 4E12A 1Q11A 1OWOA 4GFDA 4S05A 4D5GA 2NXCA 2K2WA 2OGTA 2E4YA 4XDYA 5B1IA 3HN7A 2BI4A 3DLIA 3L07A 2YMPA 3O21A 4F6LA 2ZM5A 2HWYA 1A9TA 1A7AA 1UT5A 2P9GA 4HZUB 2Q5CA 1T9HA 2WKQA 1OZGA 2JLQA 5FADA 3RRZA 5C7YA 3ANMA 2HA7A 2HM7A 1RAHA 1FOEB 5E3IA 3WSVA 4YXWD 2WHRA 4ZGWA 3E9NA 3SVTA 4G1FA 5TMPA 1VL8A 1GTRA 1YAHA 1BS9A 4G5FA 3T0FA 1RBZA 1I3OA 4E09A 5M7EA 4EJ2A 5AMXA 5BSFA 2OZPA 1E3QA 4ER5A 4DLVA 2OUKA 3ER6A 3DL2A 2JKVA 4FW9A 3P9ZA 2QTVB 4BMNA 3ZDAA 3AFNA 1ZXLA 5HCIA 3SP1A 2DKNA 2WJWA 3EIWA 4G5XA 4PV7A 1XZGA 4QARA 4F2HA 1NYLA 4NMLA 5C8VA 2IYUA 1G2QA 3QJGA 3C8ZA 2XNDA 5CLGA 1FFEA 4OLHA 1L5HA 3OIUA 4XWTA 1BRTA 2EX1A 3GRKA 3DF9A 3NCHA 1V35A 4JWKA 1RJEA 2A1TR 5CA0F 5F7JA 2QN3A 4KXMA 5K05A 1OXUA 1OXTA 1SUIA 2ZIEA 3CNHA 1VCOA 3DYIA 3IQIX 4M1WA 5IN5A 3VU0A 3JQFC 1BFDA 1TYCA 4L3WA 5IAJA 1THGA 4AWAA 1IE3A 1SO8A 4Q00A 1AB6A 2MSCB 1JBQA 1GFSA 1QPBA 1KDTA 2GPAA 3IOEA 3S8YA 1JLRA 2RGNC 4MCIA 3VPBA 1UXHA 2G9VA 3QA9A 2AFHE 5EJMA 2AQ8A 4DDHA 1K1EA 1PD1A 4RK6A 5JXJA 3MG9A 1G18A 1QRAA 1QH8A 3WLRA 2YDYA 3SGLA 1JPJA 3URKA 1KR5A 3OCUA 1JHRA 1X8JA 1YU9A 1RJ9A 2GXSA 3V1YA 1SXPA 4F6RB 1Z8HA 2OGSA 4Z8XA 4PWZA 5EJ7A 5AI9A 4Q9IA 3UQZA 4MGIR 4BX8A 1I4WA 1G8GA 1GCIA 4QHSA 1NXXA 1L6IA 2YOGA 3LCCA 2ZJYA 4MQBA 2WJJA 5J9FA 4RFSB 1T0UA 4JUFA 4CJXA 3ZDYB 3R0ZA 4JKYA 1M76A 1NXOA 5B3KA 4CL8A 3AOEC 2HMYB 2B3TA 2J0EA 2ZIWB 4HFJA 1ODFA 1DTWA 4GQBA 2Q1UA 1L4BA 3MS2A 3BVPA 4A1OA 1UJ5A 2O3JA 4FK8A 3PLAE 5M29A 5DHRA 4EFKA 4Z7NB 5U9CA 4DUYB 2J4DA 3IUEA 1YOVA 1EK6A 3M9WA 1IQRA 1E7MA 3WKBA 4CM8B 2HW8A 2PKRA 3TPFA 4V0NA 1XRLA 1FXUA 1YVEI 4U9IS 5HKOA 5LWHA 3PC8C 4H18A 3NHUA 1NLYA 3F4BA 2HXYA 3UT6A 4O4LA 3TW4A 3HCRA 4LEIA 4PHGA 4AECA 1Q2XA 4MUIA 1O8BA 4ZEMA 1WO8A 4D74A 3DOJA 3TZ6A 2FJUA 4WDQA 1Z0JA 1QFSA 1ZICA 2XT9A 3HS3A 2JFXA 2REQB 2F67A 3Q5GA 1GRRA 4G1EB 1HZZC 1Y34E 1UZAA 2OQIA 1P1FA 3IPCA 3KYDB 4UHJA 3CY6A 4J03A 4LFCB 3VISA 4PPGA 2WD9A 3SM9A 3K9LA 3O8LA 4M38A 5I47A 2BFMA 4O4LB 4NV1A 3IAAA 3FAKA 2PSFA 2HNAA 2Q6IA 4MUHA 2UU9B 3FPFA 2G40A 3K5PA 3RS4A 1AVTA 1U0GA 4QM6A 1Y89A 4DA0A 5BSEA 2WSBA 3GPDG 3W7VA 2B92A 5JLJA 3UHAA 1ENYA 4GGMX 4HN9A 2CNKA 4QM7A 3B12A 3UA4A 1LSJA 2VQSA 1PL8A 3WRYA 1G20E 4MUXA 2B5VA 2CF5A 4YJ3F 4BNLA 1BDBA 1U99A 3QOFA 4ARVA 9ATCA 1PBNA 4RF3A 5D3MA 5ECDA 3N53A 4O2BB 1H1LA 2GN1A 1BMTA 2O3RA 3O3NB 2PUHA 4A0SA 3R9KA 1JG3A 3GYBA 3KEQA 1BXGB 1J5EB 1E94E 1QHYA 4G9EA 1I33A 1HTTA 2Y1LA 5ALUA 3ZE7A 2B1JA 2P6NA 2NZ2A 3G8BA 2ZS8A 3L7YA 3UMVA 4DCGA 4YLYA 4RIIA 5JZOA 1SNYA 3A9RA 3L7IA 1SKMA 1NW3A 3GLTA 3U49A 1CYEA 3M81A 4MI6A 1G17A 4LMBA 1X1DA 1TVKA 5B53A 5IEBA 1D8AA 3QEJA 1SD5A 2OUIA 5DHSA 2DY0A 3PUXA 2V0NA 4HG2A 4O4LF 1NW8A 5TLSA 4FMDF 1RMQA 4XWAA 2MYUA 2O20A 4KIUA 5HF6A 5KOYA 1P0PA 4UUBA 3FSGA 3ZU3A 4WDRA 2ST1A 1D2EA 3VV2A 3H19A 1U7HA 4Z7OB 2TSYB 1GNPA 5AI6A 4UE2A 1ITZA 3V3TA 3V97A 2YASA 3JTEA 5G1OA 4QE3A 2HK9A 3TBFA 5CDFE 4TM8A 2JG3A 2H57A 3O4VA 3TZQA 2H92A 4DC0A 4XM0A 1NY6A 2ZJ7A 1GPYA 2ODAA 2JHPA 3QKWA 4QUHA 4BMXA 3IL2A 1SQSA 1AKUA 3JATA 3LS2A 1JG4A 4JLOA 3H4MA 4MS1A 4BLQA 3WYAA 1G5IA 3U3OA 3PX2A 5ED0A 2QJRA 1NJ8A 1TUBB 3O5AA 2NYRA 1VPVA 4G0OA 3VPGA 3OOYA 3VYWA 4ZO9A 3A1EA 3E5MA 3ZGLA 4RF5A 4ZCTA 4TLCA 4UM7A 3JD0A 4EJSC 5DASA 2F9MA 1SCBA 4DM7A 2EYQA 4E08A 1O54A 2BCJQ 3ACDA 3EXAA 4ND7A 5D7BA 5JXHA 3ZDQA 1M3SA 2GZSA 3PGVA 4MV3A 4FVTA 5BN1A 3W3AH 2PS9A 3WWDA 3HFSA 1ZBDA 4HRVA 2WYIA 1D0VA 1OFUA 4RUKA 2YH2A 3G5AA 1Y9AA 1EM8B 1VZ3A 2QW0X 3FSEA 3NALA 2VJKA 1NFFA 2IZOA 5L53A 2QY9A 1H0SA 3L06A 4ER3A 1PV4A 1EBBA 2XVYA 2YHUA 4ZMBA 1V16A 1NVKA 3THSA 3DYVA 3MJ4A 3P45A 1I4LD 2W6OA 4TMYA 4F91B 3O8OB 4A9AA 5AW8A 5ITWA 3ICEA 3B70A 2LZ0A 5JBNA 3HKCB 4OK5A 5PNTA 1NATA 1HSZA 1TVMA 3DHEA 4FOLA 3CLRD 1LUAA 4ZT4A 4P5EA 5TIIA 3NHPA 3E03A 1CQXA 1D3AA 2D1FA 2IL1A 3ILHA 1UIMA 3R4CA 4H4DA 3G2LA 4L28A 1T0BA 1E32A 1N1GA 1MGPA 1NBMA 3KR2A 2XDQA 3HDYA 3MWDB 3UJNA 2FQQA 5HXAA 1CRWG 5IHPA 5DH9A 1TMKA 3HGMA 4IUCS 3KZOA 5FL7D 5IZCA 2AH5A 4JEMA 2W42A 1MIHA 3MGCA 1M2HA 1EVLA 2AC4A 4M36A 3HP4A 4GR5A 4Y1EA 1PG0A 3SXUA 1H2YA 4ETWA 3KYBA 4ECAA 5B3JC 3NVKI 3UWKA 1X1CA 3RWOA 4A3SA 2DYKA 4AY5A 1F8YA 4KMOA 2XDQB 1J4AA 6Q21A 4IVQA 1IXKA 4WPGA 3B3QA 1FSGA 4WKBA 4K6HA 1LC3A 1WEKA 1FE8A 1YA8A 5E7IA 2D0OB 4HAUA 3PVCA 3QW2A 4HFMA 2HJVA 2FGKA 4K3VA 4YASA 5JE8A 3W5IA 2P30A 3SXUB 1WXDA 3C3EA 3NAZA 3A6GA 4IMJB 3G85A 1K4MA 1VRWA 1HDIA 1L9XA 1PWXA 2E37A 1D2GA 3DE2X 3EIHA 5LDHA 3LGXA 2A9KA 4M8LA 3HY6A 5SZIA 2FPRA 4MYHA 2FZGA 1R4MA 2YYAA 4PCAA 3W1VA 5ICGA 3QXGA 2RCNA 4Z5XA 3RIEA 2WWTA 4UREA 4IZIA 4IGEA 1E4VA 5GPBA 3A4VA 1HI9A 1VKZA 4BVHA 1NVWQ 5I9NA 4UMDA 1UQRA 2FEXA 3SKVA 5JPCA 3B6KA 4KVFA 1EWVA 2CXRA 2P6MA 2Q9CA 3CUEF 4H7FA 1UXKA 4Q9AA 3WQBA 3WG9A 2YJ3A 4JXJA 5FNVF 1CD5A 1S5PA 5DOVA 3WGZA 3ELDA 1DIBA 2AFIA 1QH9A 2PS3A 2QQ0A 3AL2A 4NYJQ 5KWIA 2C4TA 5CB0A 3E3MA 1DFHA 2FPKA 5DU2A 4HUJA 1XU9A 3MTBA 1G4UR 3ETCA 2AHOA 1JAIA 3PPYA 3TRIA 2D7CA 5KVVA 5LXTA 3QWFA 2YJGA 1M1NA 2CFRA 2R11A 4H08A 2IEIA 5DTJA 3RJZA 3SJUA 5JQGB 4LXHA 2GRJA 4FGSA 2CHVA 2G9QA 2HXSA