4HDQB

Crystal structure of the ternary complex of krit1 bound to both the rap1 gtpase and the heart of glass (heg1) cytoplasmic tail
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
164
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krev interaction trapped protein 1
publication title The Structure of the Ternary Complex of Krev Interaction Trapped 1 (KRIT1) Bound to Both the Rap1 GTPase and the Heart of Glass (HEG1) Cytoplasmic Tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 164
sequence length 167
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hdqB00
1ZD8A 1MO6A 4FMDF 2W00A 2JAQA 4POAA 4DSUA 1E9AA 2BKEA 4H1UA 4JS0A 1G6HA 1OE0A 3TQFA 2VL7A 421PA 2J0QA 4ZDWA 3D3QA 4XVRA 3VR1A 1FX0B 2GNOA 4BEJA 2IW3A 1E3MA 5CB6A 2CE2X 3CPEA 1RRFA 3KL4A 2HLDA 4LI0A 4NZYA 1X6VA 2OSBA 3RRYA 1NJFA 3K0SA 4WXRA 1KI7A 5DIFA 3TJZA 4IOMA 1ZM2A 1KO7A 3ZGXA 1ZD9A 3LFUA 4FD2A 4LZZA 2AKYA 4FCVA 1OH8A 3PEWA 3OIVA 1VCNA 3IDQA 3EARA 1KO1A 1D2MA 3UMSA 4NCHA 1JR3D 1W47A 1Z5ZA 2YOHA 4LJ7A 4HLCA 1V43A 4MGKR 3KDSE 4PO1A 1SVLA 1IXZA 2HCJB 5H70A 5F98A 2GEUA 4JBXA 3PR1A 4B2PA 4W5HA 2ERXA 4C4PA 2WSSD 4AYWA 1GAJA 3GLFE 4LV5B 2VP0A 4GDFA 1SHKA 3NC0C 2ZS9A 3TGPA 1RVDA 5JMTA 4IW3B 4U7DA 4LCBA 1IONA 5HKKA 2FX3A 4MKFA 3Q3JB 3AV0B 4C0QC 1B0UA 4DCSA 1OFIA 2VPPA 3A6PC 1NKSA 3I4LA 2OBLA 1X3SA 1G20E 1UKVY 2FFHA 2Z0MA 1XMIA 3IBGA 1WDTA 3SHFA 3KB1A 3DPUA 2FH5B 4TMVA 2G77B 3S1AA 3RDPA 3W6NA 4C0KA 3KJHA 1CS4C 4G5GA 1CXZA 2OXCA 3D31A 4MA4A 1SKQA 3U60B 2WIAA 1DG1G 1RJ9A 4G3XA 2Q3MA 2IYSA 1QG4A 3ZIAD 1UEJA 4PPFA 2F1IA 1ZP6A 2WWWA 3BIFA 1W5TA 2ZE6A 3OFNA 4L4UA 3T5GA 4E03A 3LRPA 4CZ2A 2VSFA 3V4RA 1LF5A 2QTVB 1JJVA 3CX6A 2ORIA 2QMOA 1J90A 3K70D 3W3AA 2WMNB 5KDOA 3VHLB 2JLUA 2GXAA 2XSZD 4M8NE 2FN4A 3A1SA 4UXIA 3FKSA 4CEJA 2FSIA 4LBVA 1MV5A 5SZKB 3IIMA 2PEZA 2P3SA 5D3MB 4KYIB 4Q7LA 5FBRB 1AGRA 1VYVA 2HV8A 3BS4A 4LX0A 3WYGA 2OT3B 2YWEA 3VHXA 2F43A 4OQLA 3BRWD 2GBLA 1TAGA 2ORWA 1FQJA 1NI3A 2FMXA 5FBQB 2QAGB 3AVOA 5HE8A 1OYYA 3EW9A 5CDFE 2CK3D 4ZKDA 3W5IA 5DH9A 2OILA 3SBEA 4GOKA 4TLBA 5TDHA 1Z0KA 2EFHB 1BOFA 3C16C 2WWHA 1TX4B 1T3LA 4HUQA 5DISB 1Q1QA 2C98A 2WJJA 4UXHA 2AXNA 2VLIA 4HDQB 5FTNA 1L2TA 2XTNA 3VR2A 4KVGA 2N42A 1NN0A 2ZE8A 1TQ6A 4OHXA 3KQHA 1BS1A 3K0FB 1E9SA 1TU4A 1K8RA 3LXXA 4I4LA 3IHWA 4B6FA 4DCTA 5HCNA 3A1VA 4PQFA 3QI2A 4D82A 1SGWA 4D26A 3CH5A 5G3ZA 1HUQA 2C99A 3K9LA 4JJZA 1I2DA 5CDFA 3WYAA 3W5JA 2GEVA 2GWHA 1G5RA 2YOGA 1CR4A 4Q18A 2ZSEA 3B1VA 1VTKA 1U9IC 2Z83A 4MKHA 1GILA 3SFVA 5TV2A 2BEKA 3KXKA 4R7ZA 3DDCA 5J4VA 1II0A 1RYHA 4BQSA 4TTRA 3GLIA 2KJQA 1UDWA 2QP3A 4P3YA 3CW2A 3QJYA 4PAQA 4YLGA 4BLTA 2YWHA 1IM2A 3W9YA 2A30A 1KI1A 2IWHA 3T5DA 2PLFA 4JVMA 3LO5A 1DAMA 4C3ZA 2RGNA 1I4TD 1ZJ6A 3KQNA 2BMFA 2PBRA 4LHZA 5DNYB 1W4CA 4BASA 2ZR0A 4CDGA 4EFMA 5J4HA 2X2FA 4EPYA 2QENA 2HXYA 2E9SA 4TL8A 1S0UA 2ZRFA 3E1SA 2J0UA 2R44A 2H18A 2IHBA 4HSEA 1UDXA 2FSFA 1OH5A 3AKYA 1SXJC 2G6BA 4PPNA 3L0IB 1N0UA 2F7SA 1G3RA 5BYKA 2C95A 2ZXUA 2NTYC 4TQAA 4A8JB 1NG9A 1XCGB 4KHZA 4F4JA 4C7OA 1S3SA 3THWB 2FU5C 5K8IA 4NH0A 4P32A 1P75A 2W58A 1TEXA 3QKTA 4QG7A 3OF5A 3RNLA 2VQSA 2C03A 4DEYA 4HAVA 1NNEA 4QHTA 3RS5A 4BFUA 1JR3A 1ZW6A 1ONBA 3VAAA 4MKIA 4KXFB 1UF9A 3UMRA 1XZPA 1S2MA 2X8AA 2ZEJA 2DFNA 4DB2A 2UVQA 4QHYA 2GILA 1E69A 1YZQA 1QVRA 2JLSA 3QOFA 1Z28A 2WZQA 3PUYA 2G0NA 2ZSBA 3VR6A 4HLDA 3BD9A 4R2HA 4JMPA 4JL6A 2G0TA 2H5EA 1EFCA 2IYWA 3U3JA 1AQUA 1GFIA 3WNDA 2BIFA 2QT1A 2DPXA 3AUYA 4DUGD 2J7PA 1D2EA 1KI6A 2CMKA 4R71A 3ADCA 3CRW1 2ZAMA 5SZHB 4URZR 4CEIB 2V54A 2J7KA 1P73A 4LBYA 4JLDA 2Q0HA 4URYR 3HWSA 3AEZA 1S9HA 4GRAA 3GD7A 1XTSA 3C8UA 3LNCA 4IDOA 2QP4A 4DT1A 4B3CA 4QGAA 1G8GA 3KFXA 1XD8A 2OLKA 3BH6A 3H1TA 3N5CA 3T15A 1YZUA 2PL3A 4KFSA 3I5XA 4GP6A 5CK5A 1JEDA 1LB1B 3JZAA 4KLNA 3UWOA 4B34A 4HAUA 1OIVA 2J87A 3SYNA 1E2LA 4I1UA 4NPHA 2ZROA 3BFKA 3CNOA 1ZU5A 2BMDA 1E1QA 1ZC4A 1ODFA 2LCFA 4DDVA 1GWNA 1R0ZA 2WKQA 1K6MA 4ZIRA 1OKKA 5DI3B 1R5OA 3GJXC 1CR0A 2CK3A 1K5GA 1QF9A 2BEJA 2V1XA 1P62B 1GNPA 2XB4A 3RLFA 2HYDA 3K8YA 4M1OA 4UKDA 1T5IA 1E9FA 4B75A 5GADl 4QRHA 2QA5A 4NBSA 3R9XA 3SE0A 4OK6A 1S4QA 3RS2A 2BDTA 1R6BX 1SVMA 2HXSA 1DS6A 2AD5A 1J99A 3GJ8A 1VG8A 3TIFA 4FCTA 4RCZA 3CPJB 1Q57A 2QGZA 1F6BA 1DG3A 2OG2A 2AL7A 1AK2A 2XJ4A 3P1JA 2XB2A 3TE6A 5L3RA 1Z6AA 4DIDA 2VHJA 3I61A 4WZBE 4KAXA 1TEVA 1T3HA 4BFZA 4MRVA 1P61B 3ZIAA 4TSFD 1RPZA 2ZI3A 3HPQA 2F9MA 2WAXA 4M1WA 1E9CA 3U7EB 3CWZA 3KQUA 4PANA 1JECA 1XEXB 1ZD1A 3GLFA 1E0AA 4C0SA 1DO2A 4ZPXA 5TMPA 1E2NA 2DWPA 4Q4JA 2XTMA 1G64A 5AUNB 3Q9LA 3UATA 4HAYA 2O52A 4IDNA 2Z4RA 2IXFA 3QKSB 4FW9A 4L16A 2JLXA 2GZAA 2V8OA 5EE1A 3BWDD 3KFVA 1GKIA 2BV3A 3QEJA 2GKSA 1IHUA 5FOSA 2IXGA 4QM6A 2FEOA 3EPKA 3U61B 4BRUA 5AJZA 1GNRA 3THYA 1YU9A 5SZIA 2VP4A 3RANA 2IX3A 2DWQA 1E2QA 2OV2A 3BC1A 3UWKA 2WSSA 4N1AA 5FOWA 1VHLA 3LVQE 3CRQA 3NHAA 2O8BB 2NO9A 2Q9AA 4RZ3A 4UNRA 1G4AE 1VCOA 1H65A 2AWOA 5CYPA 4B32A 3T1VA 4XJXA 3BBPA 3BJIC 3QKUA 3EG5A 4IFEA 1N6RA 3WXMA 1AS3A 3B9PA 4EFNA 2CNWD 1KI4A 2RHDA 3BORA 4NHOA 4EPWA 2C9OA 3IEUA 4LJ9A 2P6RA 2VP6A 4AKEA 2W2VA 1KDPA 1V5WA 2H17A 4PTLA 1KKLA 3LW7A 2W2TA 1U81A 3WBJA 2QE7D 2WJVA 2ZAOA 3EPLA 3QIAA 3QXCA 5AK0A 1WCV1 2ZRDA 4M53A 4F4IA 2CLCX 2R62A 2CHVA 1YZTA 5JCZA 3AH8A 4DDWA 4BFTA 4Z1MD 2CL7X 1P72A 5CITA 4S2EA 1OB2A 1Z0AA 1P7CA 1Z07A 3HU1A 2D62A 4M1KA 1W7AA 3RAPR 2FFQA 1M7BA 1G7TA 1OJLA 1QG2A 1VYTA 4MITA 3UPUA 4TZ0A 4E09A 2O8FA 4V0NA 5BQ5A 2O8DA 4C7OB 3VKHA 4TT3D 2V4ZA 3KJIA 1JXMA 1A4RA 2EFEB 2E87A 1P60A 5A5GA 4BE7B 2OO7A 2AK3A 3U7GA 4O0MA 3RS0A 1H8HA 2ZANA 3PUWA 3CF0A 1QRAA 4RKEA 4URVR 1E2EA 4HAWA 3CLVA 2JDID 4IOKA 4DSTA 4QGHA 3ZD6A 4FMDB 4BZPA 1AS2A 4YMVA 3BB4A 1IY1A 4PHTA 1G6OA 2AWNA 2ZS7A 1U9IA 1MO3A 1E96A 3BAFA 4HDCA 3HDTA 2VP2A 3DMNA 2C9CA 1KMHB 3I72A 4ITRC 2VRWA 2WKRA 1NIJA 1LVGA 4HZUB 1D2NA 2GETA 1X8LA 3UKDA 2IYXA 1CJVC 2PMKA 1CIPA 4EQ6B 5EUMA 3IQWA 3WYFA 2WWXA 1S1CA 2GJKA 5FOVA 3CUEF 2IA5A 2OCBA 2QPAA 3ONWA 4CEHA 1E2HA 4CEIA 2NZ8A 3OAAD 4WZ6A 5JEDA 2QSYA 4JIMA 1KSHA 2XOKA 3DKVA 3FDIA 1P9NA 1XPUA 4FMBB 1US8B 1OXUA 4RVCA 2REBA 3P4XA 4P4TA 4EQ6A 4OI0A 2QG6A 2ZITA 4C30A 3FMPB 4E07A 1MRNA 5HR5A 1XD2B 3BERA 4A2PA 1KOFA 1XD9A 1YRAA 4LHWA 1P5ZB 1F60A 2A9KA 3TVTA 1WBBA 1SVOA 1W0KD 2D4HA 4LWZA 4AG6A 3N2IA 2HDNB 1ZBDA 2QMHA 1NLYA 2CE7A 1DTSA 1GG2A 3AUXA 5ELXA 4FN5A 1IY0A 1FTNA 2F1RA 1ANKA 2YINC 4YQFA 2JEOA 1P2SA 2A5GA 4A0GA 3SEAA 1VDZA 4P33A 2AX4A 4ZCIA 4M9XA 1TMKA 4JBWA 2W6ID 2RGAA 2YYZA 2QSZA 2H16A 5EE9A 3A1UA 3AP1A 3KX2A 5B58C 4IOLA 2GZHA 4TTPA 1E32A 5FR1A 4A9AA 2ONKA 1P2TA 2PX3A 4UNQA 2QNRA 3EZ6A 3QKSA 4XD7A 2IEZA 3JVUA 1W1WA 2IYVA 4WA7A 1P9RA 3QXXA 2CLDX 1N0VC 2RGGA 1AKEA 2OAP1 4TMWA 1UEIA 2ZE5A 2GAOA 2MSEB 4JJKA 1WP9A 1TPZA 3THYB 4JYBA 1T0JB 2WWGA 4KSBA 3P32A 4TYWA 1H8ED 4NONA 1NMZA 2EVWX 1XEXA 1Q20A 4PQRA 4XWAA 4A92A 4P31A 1E79D 4FCWA 3SHWA 5FI1B 4OL0A 5CYOA 1E99A 2BM0A 3SJAA 1NRJB 4XIGS 3DOFA 4NE2A 2CL0X 3CH4B 1FUKA 3IILA 3OIUA 4RZUA 5FR2A 3O8CA 1A2BA 2EFCB 3AP2A 1YR7A 4QOSA 1EFRA 2F3TA 3SQWA 1G9XA 3BH7A 2O8CA 3C15C 3BH0A 2CVFA 4ZV4A 3RYTC 1OB5A 2FSHA 2IS2A 5JWHA 3BOSA 2A5DA 4Q21A 3EZFA 2WOJA 4MGZR 2QTHA 2QTFA 3B7GA 4PSAA 2XNSA 2X2EA 5G41A 4BFSA 2FOLA 4OK3A 5FL7D 3IEVA 2BC9A 5J4LA 4KVAA 4OK5A 1F2UA 3BGWA 5E95A 3W6OA 3G5UA 1VCIA 4R2IA 2RGBA 1TADA 3IO5A 2KE5A 3EIEA 2E1RA 1EFRD 1XTQA 1LS6A 1DOAA 3K0FA 3RS7A 5BW8A 1W2GA 4QC2A 1L8QA 3ASYA 5FPYA 2XNDD 3Q8XB 3IBYA 4UNPA 3AVVA 4URWR 3WMEA 4G5QA 2ZJZA 4C2UA 4NMMA 3CX7A 4K81B 4QBGB 1UBGA 2O8FB 3SOPA 3ZQJA 4DLWA 3K0CA 1N6KA 4NYIQ 1W5SA 3MJHA 2QORA 2ANBA 4EUNA 1KK0A 4G0NA 1ZCBA 4PAOA 1FUUA 1YR6A 1YR9A 2RGXA 4PC7A 1BMFA 4AK9A 4JVLA 4DBLC 4G01B 3MG9A 2F1HA 1EX6A 3K0EA 2ODEA 1ZIOA 3L82B 4P0TA 2REXB 4OQXA 4O2LA 2XTZA 5LD2C 3ZDQA 3ASZA 3ADDA 4XOIA 1JPJA 3X1WA 4BLSA 5HPYB 4B44A 3TRFA 4MGIR 5EUQB 5FPSA 1KI6B 1XCMA 1KGDA 1KMQA 1T3SA 2LWIA 3A1WA 2A2ZA 2GVZC 4DLXA 3LD9A 2XZPA 4GZLA 4NU0A 4QGFA 1AS0A 1CR2A 2R8RA 3I73A 1ZUHA 1CULC 2G1KA 2GXSA 3PQCA 1MRSA 2CHGA 3LBNA 3ETLA 4OJKA 3JZMA 4EJSA 4XVQA 1QHNA 2AD1A 2VBCA 1DADA 3NDPA 2FG5A 2HUPA 2ZM5A 1G7RA 5EXXA 2QAJA 1KK3A 5IRCD 1F3OA 1E9BA 1E2DA 3K53A 3R20A 4HZUA 1KSJA 1Y3AA 4PX9A 2ODBA 5C4GB 3U3OA 3AVXA 3ZYCA 3T1TA 2AFIE 4LPSA 2N46A 1BO6A 1IOZA 2OM2A 4D4KA 3PEUA 1OFHA 5E7MA 4YONB 4GL2A 3MFYA 5JWOA 4LYHA 4FXPA 1FZQA 1LY1A 1U8ZA 4F4CA 2C5LA 3BFVA 2JCSA 1G8YA 3OAAA 2REOA 3KB2A 3U7FB 4QJ5A 2PJZA 4RKFA 2IHYA 5DLQC 4D81A 5KDLA 1I4DD 2WV9A 3TSWA 4ZI3A 2G1JA 4MKGA 1KYIA 3K1JA 1SQ5A 1D6JA 3SBDA 1GITA 4NYIR 4Q66C 5F9FA 2ATVA 5JECA 2NQ2C 3O47A 4DDTA 1IN4A 1HV8A 1Z83A 1WA5A 3V00A 2JLYA 4DZZA 5D3QA 3H4MA 2EQBA 2JDIA 3W8RA 4NCKA 4BWYA 1CKEA 5BWMA 3P20A 5L3QB 1H8HD 4XWKA 1IN8A 4JLMA 4YMSA 3DEFA 3A1TA 1YZKA 1YJ5A 2PLRA 1XTRA 1ZIPA 2WJHA 4TLDA 1E2MA 5BYJA 1N5JA 1AIPA 4D25A 4K8OA 3PENA 1YE8A 4N0EA 1QZXA 4TYPA 1UKZA 1NN5A 1ZYUA 1WQ1R 2JLZA 2J3EA 2WTUA 4LJAA 3SS8A 4B3GA 5K8LA 5DI3A 3K0CC 1VG9B 2V9PA 4YMTA 4D6PA 1E1RA 3DL0A 4Z1MA 2ZRNA 2ZRMA 3KXLA 4RFSB 1NVVQ 4QBIA 1L7VC 3GJ3A 3TAHA 1Z2AA 4R9UC 2JA1A 3CWQA 5DYGA 5GVRA 4DWJA 3B5JA 1RYFA 4EAQA 4RD3A 1ZM3A 2QE7A 3TUJC 1E94E 4Z8YA 5JCPA 4DVGA 1JQLB 2JIZA 4A0RA 3PCRB 4GOJA 5GJCA 2PCLA 2BCJQ 5FTKA 3LX5A 3FHTA 4FIDA 4OQNA 4LBZA 4LJ8A 3CR7A 1W4BA 1WXQA 2JLRA 4IVQA 2ONJA 3GFTA 4I99A 2Q3HA 2ODWA 1QHYA 3TR0A 5KOYA 1J8MF 4JLAA 4RJLA 4B3DA 1GVNB 1ZUIA 3R7WB 4JSYA 1MO5A 4NCJA 3GLGA 3C4JA 2J0VA 4OI4A 3O8BA 5JBQA 2B6HA 4EKDA 3CRMA 1EFUA 4TQ9A 2WWIA 2FZ4A 5EE3A 1IJFA 2QMEA 3QPUA 4ESVA 5TXGA 4BRWA 4JLKA 3MMPA 2G9NA 1C9KA 3L0OA 2KI5A 4F93B 3U4QA 5TY0A 2ZTSA 4BFXA 5JJIA 1XXHE 1FNNA 3HJNA 3B1ZA 5KO2A 3WNBA 4YMUA 5KNBA 1EXMA 1N6PA 2PMDA 4HAZA 4HB4A 1IQPA 4HEJA 5KU1A 2ZUCA 4G5SA 2RGCA 3B13B 4BZQA 1ZM4A 2WHXA 1Y63A 3NDBB 1F5NA 3KKNA 1YVDA 1NBME 1M7GA 1P2UA 1SZPA 2WICA 4BFVA 2FA9A 4TSFA 2G88A 2ANCA 3W8NA 3U6BA 3KKOA 2GAAA 4EJSB 2ZE7A 1R5NA 4AYXA 4FI3C 4BLOA 4BECA 4MYCA 3MRSA 4W9MC 4DHEA 1D8TA 2XZLA 2QI9C 1CLUA 2Q6TA 4GPTA 1XJCA 3UXMA 3SZRA 2IS1A 4KODA 4MYHA 3VFDA 3PG5A 2ZYVX 3I1FA 5FOXA 2ZSDA 1B23P 4KSCA 3ZVRA 4LHXA 4E22A 1NKTA 4JLVA 3WP0A 2J41A 4KJZA 3RC3A 1DEKA 1W4RA 4DSOA 2FFBA 1OXSC 2YC4C 3EXAA 4PSKA 4B2LA 5AUPB 3PITA 3NKVA 1TTTA 3R8CA 4QM7A 3REGA 5DE3A 1E0SA 4L5BA 3IIJA 4A15A 1TF5A 4MDEA 3CM0A 3UMFA 1UKYA 3PIRA 3FMOB 1Q1BA 1JEEA 4KI0A 1UADA 1E1QD 4DB4A 4OKSA 1Q44A 2NIPA 3NBFA 3SJBA 3OIYA 3CPHA 4B76A 4CRWB 1PUIA 3ICQB 2AFHE 5E7JA 5L8VA 4DDUA 2F9LA 4YC7A 4Z54A 2ZRHA 2IS4A 2F6RA 3CZQA 4Q9JA 3RRZA 3GLFB 1RKBA 1LS1A 4LJYA 4MYUA 1XXHA 5JRZA 3EIHA 5B57C 1SXJA 1P6XA 1KO5A 3VKWA 3NVAA 2ZETA 1XEWX 2ZYUX 4HATA 4TN1A 3PVSA 4RD6A 3AF3A 5J5CA 2PJRA 3PEVA 3WY9A 1FFHA 2R6FA 2PEYA 3TSZA 1R0YA 4P4SB 1JAIA 4WBSA 1VIYA 2W6JD 2WWFA 2O8BA 1Z06A 4GZMA 3OEHA 1T8UA 3A58B 3OZXA 4TLAA 2C2HA 3CO5A 2P2LA 5CLLA 4TMXA 3REFA 2GESA 4IDHA 4CEJB 1FP6A 3PV0A 4M1TA 4Q48A 4EIWA 1ZNYA 1NIPA 2NO6A 4TTQA 3MWYW 2PZGA 5EXSA 2QY9A 1MOZA 4RZXA 4F92B 5K8TA 1TF2A 4HAXA 5KYKA 1U8YA 1XCPA 2J0SA 1KI2A 5EE0A 1TQ4A 2JATA 1E4YA 1ELOA 5IK2D 2CJWA 1G3MA 3LW8A 1KNQA 1T5LA 4TQUS 2FEMA 3B60A 3X1YA 2NG1A 4EPXA 2D74A 1G19A 1H8EA 1AN0A 1BYIA 2VHQA 6Q21A 2VTKA 1QHIA 1QHGA 2X19A 1Z22A 5C4MA 2UKDA 3GJ0A 4KCGA 2A5JA 4QJ4A 3E5HA 3SC3A 1QHHA 3M6AA 5KNCA 3CIOA 5CJPA 5FTMA 5H1YA 4LUCA 2ZI6A 5BN4A 2LKCA 3Q7QA 4XD7D 3E70C 1R2QA 1T6NA 1R0XA 1VIAA 3PUVA 3K9NA 4I1OA 1Q3HA 3I5YA 2ATXA 2C9YA 3IKJA 3U4QB 4AG5A 1PLKA 2D3WA 1G17A 4A6XA 1G8HA 1CRPA 4JLOA 4QBHA 4B73A 1D5CA 2UZ3A 1S3GA 4M9QA 3BK7A 3QEOA 2GXQA 1YRBA 2Z6VA 3ZVNA 1XMSA 5CJ2A 2IF2A 1DAGA 4R98A 3PEYA 1DARA 2EWWA 4S35A 5L3SB 2OZEA 3MAAC 4X8LA 4MRNA 1WMSA 1G21E 5KHOC 1W0KA 4KITB 3MGCA 2ZQ5A 3LLMA 3MWLA 1FTSA 2WJIA 2CEAA 4ARZA 1XU4A 1CBUA 1XZQA 1HTWA 4A6PA 2F1JA 3U3MA 2D06A 2P65A 1P3JA 4IFBA 3W34A 1AGPA 4Q1DA 3EWSA 1NN1A 3B9QA 4OHWA 4GSYA 4ACBA 2XOKD 5FOTA 3NBZC 3CRRA 4AY2A 5C46F 2IUUA 1X1RA 1RIFA 2A7QA 4DCVA 1UKEA 5FTLA 3EPHA 1DAFA 1KJZA 2SHKA 2KB0A 3H84A 5AJVB 5LPNA 2QBYB 4Q9LA 1FP7A 2TMKA 3F3YA 5DO9A 1HT2E 1GRNA 2WOOA 4EPTA 4GI7A 4WOPA 3NG1A 1IN6A 2GA8A 2EYUA 4RSGA 1ZCAA 3CX8A 4M4SA 3QUSA 4L9SA 1XJ0A 3THXA 1ZUNB 4CEHB 3DM9B 3U44B 5EXPA 4IXNA 2UZIR 1GKUB 1W48A 3GCGA 3VU9B 5JWRA 5DYIA 2XSZA 1T91A 3RRNA 2NOAA 3LWNA 4NYMQ 4Q1BA 4DIEA 4IHQA 1J7KA 1O87A 4OI2A 5TB5A 1EK0A 1U2RA 4US1R 3OFND 2BM1A 2PZEA 4TT3A 3THXB 1XRJA 4NYJR 3BE4A 2CVHA 4DSNA 3P27A 3ZVMA 1OHHA 1UPTA 4FWTA 2ZRKA 5HE9A 2CBZA 3AVWA 3TVDA 1UBEA 1OT3A 2Q21A 2CXXA 1U99A 2IXEA 4IVRA 3RS4A 4Q1AA 5AJXA 2ZJ5A 4DCNA 4HUQB 1P2VA 3IUYA 3KUCA 4PHFA 1VYUA 1VCMA 2DR3A 1YR8A 4G5RA 4A0HA 1IXSB 1G5PA 1JXOA 2VSOA 4Q03A 2ZIAA 1G5TA 5JZVA 3T06B 1KSFX 1UBFA 3EA0A 1MR3F 5FBWB 4Q9KA 4Q4HA 3U2QA 2VH5R 4CT5A 4D0LB 3EASA 3F0TA 2HYIC 4OJQA 2ZR7A 4GNKA 5EXTA 4EPVA 1N2CE 4JL5A 4Q00A 4B47A 5JHHB 3ECCA 5JSZA 1VPLA 4HLQB 2GF0A 2JJ2A 3B1YA 5A0FA 3T1OA 5HTKA 2IBMA 3NIBA 5E3HA 1KO4A 1UJ2A 1E9DA 1XTJA 1VKJA 1ZM9A 3P4YA 1N6IA 3AB3A 2CNWA 4V02A 2J46A 4D80A 3Q72A 1KK1A 1Z6YA 5GJBA 2OFOA 2BVNA 4V0ME 4B2IA 1XWIA 3V4FA 4A8JA 3I32A 2RGEA 3TR5A 2JJ2D 521PA 3GFOA 1DELA 2YZ2A 1NVWQ 1HEIA 1CJUC 4LHYA 4A82A 2H57A 2CCGA 1Z6TA 1O3YA 1CRQA 2QUZA 2HLDD 3I8SA 5AUOB 3FKQA 5HZKA 2QM7A 3G0HA 2AR7A 1EWQA 4B35A 4J0QA 1XEFA 4ON9A 2KBFA 3CONA 4Q9HA 2B21A 4I81A 1NBMD 1T0HB 2XEXA 3K9GA 4FWIB 2O8CB 2WKPA 2XAUA 3MSXA 4Q47A 1FMJA 4IDQA 5B30A 4CGZA 4ZDIA 3KJEA 1NSTA 1KDOA 5FUVA 3TUZC 1ZM7A 2YWGA 4WAUA 1OHHD 3QXHA 1GOTA 4UXJA 1MO4A 2FPKA 3DVLA 3EAQA 4PO8A 4D4LA 1MABB 2EWVA 4OYHA 3DHWC 4MRPA 5EP3A 4BPBA 1GKYA 3FMIA 4NDZA 1IBRA 3FGNA 4JLNA 4PO9A 2B7CA 3M4YA 3VR4A 3EIQA 1KDTA 4B33A 2VO1A 1Q22A 1NJGA 5FPKA 2JLQA 4LYAA 1TNDA 5AWFC 2FDCA 2OHFA 1DPFA 2O8DB 3GPLA 4Q19A 4JT2A 5EP4A 3SYLA 2ZJ8A 1NY5A 1WF3A 1SHZA 1LTQA 3QG5A 5BN3A 3NH9A 2O5VA 4LDJA 2QRZA 4II7A 2QGNA 1CF4A 2IYYA 3TAUA 4TYYA 2R6GA 3GLHA 2AN9A 4LGMA 3NEJA 3I62A 2OCPA 3CKLA 1XNJA 2CCJA 2HCBA 2IWRA 3HYRA 1HE1C 3MCAA 2RHMA 2I1VB 2GTPA 4Q7KA 3CNLA 4GT1A 4XVUA 4KFUA 3OE7A 1HQCA 3CF2A 2EYQA 2XXAA 4LV8B 3GLIE 2J5XA 4Q5IA 3VTKA 3IQXA 1PLLA 3GEHA 1Z8FA 3AF0A 4TMKA 3SJZA 2QQ0A 1J70A 1FX0A 2DFTA 3NH6A 4MUAA 1Z0FA 5E4FA 4B74A 4LYJA 2DFLA 2ZS8A 1YZGA 2IYZA 5KSOA 4WZAE 1F2TA 1AJEA 2R6AA 2GRJA 3GJ5A 4V0MA 2D2EA 5IDVA 1ETUA 2VP9A 1KJWA 1NBMA 3VR3A 3EX7C 1ZRHA 1GNQA 5CLQA 1L4UA 2QM8A 1M1YE 1SXJE 3AKCA 3AP3A 1KDRA 2MMGA 3DO6A 1Q21A 4IRUB 3RSLA 1N5KA 1A82A 2V6JA 2J7PD 4C0HA 1NY6A 4DUGA 3H86A 3X1XA 3VX4A 3KXIA 4RFVA 2QROA 3Q85A 3TKLA 2V1UA 3SI7A 3KQLA 4P4UA 3TSOA 3UG7A 2VHTA 2EU8A 2XITA 2NMVA 1KHTA 3U3KA 1LF0A 5AUQA 3UG6A 4ZI2A 1E4VA 2ZRJA 2GJAA 5EP2A 3TQCA 3ZZ0A 3U44A 2DCUA 2O0JA 4DLZA 3QQ5A 5DI9A 3IPYA 1E98A 2ERYA 3QENA 5CIWA 1BKDR 1YKSA 4Y0VA 5CM9C 4YDSA 2O0KA 5DN6D 2IYRA 3ZS8A 2OCAA 2ZSAA 4RZ2A 4A0FA 2NGRA 2RMKA 4Q1CA 3BB1A 4JL8A 3LDAA 4Q7JB 2P67A 2ZJBA 4DLRA 2G3YA 1CJTC 2VHUA 5JS8A 1PZNA 2P6NA 3CR8A 3SNHA 3NBYC 3QKRA 1HY3A 3DZDA 3ND8A 1P9WA 4M1MA 4LV6A 4QJ3A 4BGDA 1SKYE 2RGDA 1DAEA 2XZOA 3V9PA 4C0AC 4GOXA 3X1ZA 1T9HA 2ZU0C 1KZ7B 4D0NA 5DSZA 1RJ9B 2R2AA 3RWOA 2J1LA 3TW8B 1II9A 1R5BA 1RFLA 3KZ1E 5IK2A 4AD8A 5J4YA 2B92A 1UM8A 2GK7A 1RRCA 4Z51A 3N2EA 4L9WA 1XDBA 4Q4AA 5L3QA 5G40A 4NKRA 2J59A 2ZYTX 3K09A 3VQTA 1CR1A 1JBKA 2W2XA 3UK6A 4A2QA 2B8TA 4KFRA 4W7SA 1RE0A 1SVSA 3QG1A 2O8EB 1QHHB 4LSGA 4PHGA 4U00A 5EZ6B 5K8UA 1HQYE 1JR6A 4PZYA 4Q4HB 1GL7A 3OEHD 4RCYA 2ZJYA 1KO8A 4KV9A 4DT1B 2W6JA 4M21A 1GUAA 2RH5A 4PSVA 5AJWA 1U90A 2QPOA 5JEEA 3TH5A 3KKQA 1NVUQ 3C7KA 1R10A 5CIQA 3FFBA 1LV7A 2GCOB 4KBFA 3RABA 3U6KA 4MDFA 2Q9CA 3UANA 5F9HA 1CJMA 4LPKA 1E2JA 2DBYA 2CDNA 2KSQA 3VR5A 2V7QD 3GLGB 4NYMR 4DLVA 1N6NA 5LD2B 5DHAA 4RY2A 3D6TB 3X1DA 3J81k 4ACAA 2EW1A 1Z63A 2BOVA 3R8FA 3ND9A 2P0EA 3BB3A 4H9GA 621PA 1JAHA 1VHTA 3EWAA 2YC2C 5JJLA 1GRRA 4PXAA 4XSGA 3ADBA 3D8BA 4IEEA 4WIAA 2IEYA 3I92A 4AYTA 3TLXA 3NTUA 2GJ9A 1JNYA 4AWXA 4X8OA 3C5HA 2GK6A 5IF9A 1OPXA 3HR8A 2R6CA 4DLTA 3KQKA 4RD0A 2BMEA 2DY1A 2WBLC 3A37A 1OSNA 3I3SR 3R7WA 1G18A 2QAGC 4A1FA 3A36A 3ZH9B 2X77A 2P5TB 4BLPA 1U0LA 2VF8A 2BBTA 3DKPA 4LJ6A 1M2OB 5EP1A 2ZRLA 2IL1A 4A2WA 1XF9A 1COWA 1SULA 1KI3A 4V03A 3VX3A 5L3SA 4MUBA 5UKDA 4ABYA 4QNMA 4EFLA 4TYQA 1RRPA 2QN6A 2JLWA 3PJRA 1OIXA 2OBMA 3FKSD 2ZVPX 3AVTA 2ECKA 1FPMA 4JYCA 3U7HB 4LY6A 4Y0AA 3VNVA 1M34E 2YWFA 1Q0UA 2FF7A 2IUTA 1NLZA 1YQTA 2QL6A 4O2RA 3VU9A 4DRZA 2Y8EA 4ERNA 3SJCA 4Q01A 1XX6A 2P6UA 4PC1A 1TF7A 4JSTA 2F55A 3HYTA 5J40A 4C0LA 1KY3A 4PC3A 1W36B 1E9RA 3C14C 4IEIA 5FH9A 4NCIA 5F2EA 1N3BA 2FV8A 4PFSA 1IJEA 4AURA 3FOZA 1Q1EA 2GZDA 3AVYA 1IN5A 3AVUA 1OXXK 3FHCB 4I1VA 2ZRGA 5IHPA 1GP2A 3GEEA 4JLPA 2JJ8A 5G3YA 4ZO4A 2DB3A 4Q1EA 5B2ZA 2OUKA 2IC5A 1MH1A 2HJGA 4JZKA 1BIFA 2ZU6A 4JLBA 1US8A 1DAKA 3C41J 1HT1E 1SKYB 2WAYA 5FI0B 1E0JA 5HKKD 1G16A 4KU4A 2IS6A 4D2IA 3T1QA 5LDDC 1Z0IA 1WB9A 4M0LA 2QMUA 2C8VA 3LX8A 1N25A 4DCUA 3W3ZB 1D9XA 1JB1A 4URUR 1PUJA 2LKDA 3QPVA 2V55B 4NP6A 1M74A 2BBSA 5EE5B 1J8YF 5A4JA 4V0KA 1IAQA 4TMZA 5HCIA 4XH9B 1R4AA 1N6OA 2ZI5A 1R8QA 4MYTA 2NPIA 2D7DA 2IYTA 3CBQA 4AKGA 4HUTA 1A2KC 4LK2A 3WHLA 4B3FX 1E6CA 4ZKEA 4P4SA 2JLVA 2NZJA 4LOAA 5JLJA 3ZD7A 1G8PA 4PPGA 4G5OA 5H68A 3TK1A 2XJ9A 3TBKA 4TYNA 2JIZD 2F3RA 4OHVA 3KJGA 1G4UR 1N5LA 2C04A 3VMFA 2ZSFA 4YXWA 2ODNA 5J4KA 3IO3A 1EFTA 1NVXQ 3LH5A 1F48A 3QKRB 3QSYA 2ZRAA 2WWYA 1SXJB 2OAQ1 1KK2A 4KBGA 1FQKA 4O25A 3T35A 3G82C 5KTYA 3W90A 1AZSC 2MSDB 2H7VA 2VA8A 3AF2A 3FWYA 3IGFA 5KUTA 3NC1C 4OQMA 4B3BA 5KSYA 1N0WA 1U94A 3B1XA 5C18A 2OESA 4KYUA 1CTQA 1NVVR 3MWKA 3QF4B 2BMJA 1KNXA 5SZJA 4B3XA 1SXJD 1I2MA 1OYWA 2PT5A 2ZVQX 3NEYA 4CT4B 5P21A 1FNMA 5JSZB 1A5TA 1KAOA 3ZLJA 4EDHA 1KJYA 3S1AB 1ESMA 4JKIA 3MUFA 2OBNA 1NLFA 1KY2A 3ADKA 1E2IA 2A3RA 1TU3A 4CIDA 2WPDD 4G1UC 4MRRA 3QF7A 3QF4A 1U8AA 4GBMA 1E2PA 1TQ2A 2B7BA 4O3MA 4A4DA 1WRBA 1N5IA 3GMTA 1S8FA 2QRNA 3HR7A 3QXSA 4M1YA 3W6PA 4ESHA 5GJVC 4CW7A 4X8HA 4LJ4A 2I4IA 4TL9A 2IYUA 4ZCMA 1J2JA 1JPNA 4M22A 2Q9BA 3DM5A 1Z0DA 4LC1A 3LVRE 4HI0E 1AQYA 4BZXA 3SFZA 4BFWA 3EC2A 1W0JD 2IT1A 3SR0A 3ZQ6A 5TARA 4C9BA 4TMTA 2YV5A 1JALA 5FPHA 2FSGA 3Q5DA 1VECA 3SU8A 5B64A 4KLZA 5FBLB 2FFAA 1EWRA 2VIIA 4PHHA 3DOEA 3OESA 3IPXA 1JR3E 1Z08A 4I1SA 4K46A 2HEIA 3EC1A 8OHMA 3WMGA 3GEIA 3GLHB 3PXGA 1GRQA 5KSZA 5FTJA 4LYFA 2FZLA 2RCNA 3L0SA 2NPFA 3ZVLA 5FFMA 3WRYC 1SVWA 1KIMA 1E9EA 2FE4A 2GHIA 4W5JA 1SVIA 5JJKA 1NL3A 1WE2A 2ZJ2A 4CVNA 1N6HA 1R0WA 2C77A 5AR1A 3EA5A 4US2R 3LXRA 4Q1FA 1XPOA 1PVOA 1EGAA 1DO0A 1Z47A 1NSFA 4GFDA 4NYJQ 1QHXA 3TUIC 1KI8A 3QBTA 1GIAA 3ZJYA 2A5FA 5TVKA 2NO7A 3B82A 1E2FA 3QE0A 3MLEA 4Q02A 2J45A 2JJ1D 1JI0A 4D0GA 5JI3E 1GDDA 2BJVA 2ZRBA 2ZUDA 1EX7A 3H2YA 1PLJA 1P4SA 5CM8B 5J47A 1OV4A 4AKHA 4IOJA 1MT0A 3DMDA 3QPWA 4GMDA 4LRWA 4ASUD 4ZDKA 3M0EA 1TUIA 1OW3B 4PZZA 4TWZA 2GBLC 5C1BA 3FVQA 4ARZB 1XJQA 1Q3TA 4BLRA 1X1SA 1W0JA 5KPDA 3P26A 4IVPA 1XP8A 4C0JA 1X86B 3T12A 2BBWA 1CP2A 2DWOA 4C0BA 1OLOA 3RSOA 3LA6A 5CK4A 5KSPA 3FPAA 4IDPA 4F7WA 5JRJA 4TL6A 4OQFA 1PV4A 1HURA 2GF9A 3BFXA 1I4LD 4PC2A 1ZINA 4DLUA 5GJWC 1S1MA 2QT0A 1XTIA 4CYMA 2ZI7A 4L15A 2PT7A 2HT6A 4MRSA 2GJ8A 1Q1ZA 1U98A 1X8KA 3AKDA 3L2OB 1NN3A 2FWRA 3A4NA 4F38A 3WP1B 4U5XA 2BJWA 2IUSA 4HLUC 1F2UB 1W2HA 1RZ3A 1W49A 1NP6A 3Q7PA 1E0KA 1G41A 2D7CA 4PAMA 4QXAA 2QAGA 3GFPA 1E1RD 2IK8A 4A36A 2D2FA 2L0XA 2MMCA 5G53C 1Z6GA 2ASEA 4LHVA 4Q4AB 4XTRA 1ESNA 4YXWD 2ZREA 4C2TA 2ORVA 2YOFA 2OFXA 4L8GA 4WW0A 3GQBA 3LBIA 3WHKA 4QHSA 1OH6A 1HYQA 2AK2A 1ZVQA 3LAWA 3WBKA 1G3QA 1XB2A 2DHRA 4Q7MB 1G7SA 5JFGA 2HT1A 2ZJOA 4FINA 4TL7A 4HYYA 2FPMA 3A4MA 3GJ4A 5H8WA 2DFKB 4QGGA 2OFWA 3AVQA 1IN7A 1OF1A 2VEDA 3LLUA 1XXHB 1CEEA 5LB2A 4IXMA 4XSHA 3LBHA 5FUXA 1F2TB 4BFYA 4XTCS 1A1VA 3L8YA 3L8ZA 2RAPA 4XWOA 3QBVA 2RGNC 3N70A 1Z2CA 1M7HA 2ZRCA 3FMFA 2OE2A 4V0LA 4UQOA 3OIWA 3E2IA 1EFHA 4EJSC 2GCNA 3A8TA 3HU3A 5BXQC 4ZDJA 4NCNA 1TUEA 1UFQA 2JGNA 3K0AA 3NWJA 3OEED 4X8MA 3FHOA 2ZYWX 5DGXA 2WIBA 3AQ4A 3FE2A 2DYKA 1M8PA 4N0DA 1G3IA 2ZRPA 4B71A 1CU1A 1CJKC 1KI9A 3RRMA 2RKOA 2QQEA 3AM1A 2OEPA 2A78A 1NF3A 1DE0A 2BWJA 2IF0A 3B85A 1SVKA 1XBTA 5LBIA 3R9WA 2W6IA 2NO1A 3KUDA 4JVSB 2J0UB 4NTZA 1GTVA 5JS7A 2AKAB 2FGJA 1XTKA 3IIKA 4HB0A 3M1IA 1R8SA 5ANRB 3PFIA 1OIWA 2ZI9A 4Q9IA 3HPRA 1LNZA 4BEBA 4M2LA 2QZ4A 3EPJA 1E2KA 2VHCA 1KSGA 5C2JB 3VKGA 2I1QA 2WVJA 2WSMA 2Z43A 2WM9B 3F8TA 3UIEA 2GDJA 2XGJA 4FMCB 2CHQA 4QNRA 3ZS9A 2C78A 1Z3IX 1COWD 3KKMA 2QPTA 5GVSA 2BKUA 2YJTD 1VMAA 4WXPA 5KDDA 2ZJAA 1GL9B 5FL3A 3GLIB 1G291 2MSCB 1L4YA 2OCYC 3QNUA 4MGYR 2FPLA 5FBVB 2CJWB 3OHMA 4TLEA 1EESA 2BHRA 2VSXA 1IY2A 1M6NA 1HA3A 3B2EA 5FOUA 3WNCA 3SDZA 4OI1A 2PCJA 3CRVA 2YVUA 4V0OA 2J9RA 4M1SA 5KPJA 3OEEA 5EJEA 1Z6XA 4UNSA 4UNNA 3PUZA 1KKMA 2RB4A 1GL6A 3D7MA 4JLJA 1UAAA 1BMFD 4DKXA 4OHYA 2GCOA 4AKIA 1KTVA 1YHNA 3IHLA 2R6DA 2FNAA 2I3BA 1UBCA 5LB4A 5IT5A 3BXZA 2V3CC 3L43A 3NHBA 2B8WA 2ZI4A 4DXAA 4HB2A 2ZRIA 1XMJA 2GJSA 1FW6A 1R7RA 821PA 3TNFA 3MD0A 3K70B 1S9DA 4WVFA 4JVNA 1DBSA 2R65A 4A8JC 1Z0JA 2IYLD 3H0KA 2XNDA 3SN6A 4BUJA 2V7QA 3THWA 2CCKA 2H1LA 2BBOA 4CF7A 4D4MA 3O8RA 1YZLA 1XMVA 2WJYA 1FL9A 1VG0B 4ILEA 5HZHA 1MKYA 3LQQA 4MQBA 3FB4A 5FL7A 2OLJA 3AKEA 1NG1A 1OFUX 4MH0R 1QBKC 4JKYA 4RD1A 2O0HA 4NL4H 4DEXA 2QP9X 1AZTA 1LW7A 1XPRA 2W0SA 3FTQA 4URXR 3A4LA 1BH2A 1W36C 4TZ6A 1ZNWA 2H8KA 3VNUA 1U0HC 2K5UA 2JASA 3SQXA 1W46A 1ZU4A 4B6EA 1AM4D 1X8JA 4DC9A 1PJRA 1QVAA 2ZUBA 3MWJA 2GCPA 1DAHA 3EZ9A 2PH1A 3SYKA 3JVVA 721PA 1RRGA 1RC8A 3HP1A 4US0R 1E79A 3U3RA 3GP8A 4HB3A 3DZ8A 4LC0A 4YDHB 5E7IA 3QXJA 1K5DA 1W44A 1LFDB 3TW4A 3B8HA 1AA9A 4RD2A 2AXPA 5F3WB 4LBWA 4QBFA 3NXSA 3O8DA 2GEDA 1OXTA 3RWMB 2FJUA 3AF1A 3B6EA 3GLHE 3CNNA 1OFTA 5DN6A 4H1VA 4DJTA 2NO0A 4IKEA 5JHGB 2QBYA 2QEQA 4PR0A 2CL6X 2HF9A 3QVUA 4W5WA 5JI2E 4E5UA 2YKGA 1G3UA 4JT4A 4OBEA 5FUYA 3AGQA 3RHFA 3KTAA 3C5CA 3QY0A 1S96A 5D3MA 2IYQA 4GP7A 1ZNXA 1ZNZA 5EZ5A 4D4JA 1NMXA 4YMWA 4FMCF 4OHZA 5KNDA 1XD2A 1G8FA 3NBXX 2PZFA 2ZPTX 1OXVA 221PA 3RS3A 3RVBA 2Q3FA 4ASUA 3K70C 2O8EA 2BCGY 4GMXA 1FMLA 2FGKA 1JQJC 3K9HA 3GLGE 3THOA 1T4GA 3KTAB 1ZAKA 3L0PA 1T8TA 4HLUA 3TMKA 1D9ZA 2JJ1A 2VP5A 2Z5FA 3T61A 5EQTA 2YHSA 4KO8A 1FOEB 4F91B 3K0AB 4PQYA 3AVPA 4QFMA 4PC6A 1QHSA 3AF4A 5FPTA 1GSIA 1TQDA 1AKYA 1VG1A 3AGPA 4IJMA 1OH7A 2EFDB 3EZ7A 4JBYA 4M9ZA 4EPRA 1IXRC 2VYFA 1DAIA 3LV8A 4DLSA 4UJ3A 4PPQA 1GZSA 1DVRA 1HH4A 4Z8XA 3WRXC 2F43B 3GJ6A 3GJ7A 1WBDA 4PZLA 2AHOA 3LY5A 1E2GA 2GXUA 4AI6A 4ZIRB 5M04A 1TL7C 4HDOB 2QU8A 3LQRA 1Q12A 2EFGA 5CB8A 3OE7D 3HU2A 2A5YB 4BLQA 1BYUA 2WMOB 3KKPA 2Z4SA 1ZMXA 3ZZUA 1U0JA 3FFAA 4N3NA 4QL3A 3RC8A 121PA 2W83A 1NMYA 3X2SA 1MABA 5BN5A 1II8B 1G1MA 3CZPA 1C4OA 1W4AA 2G83A 5L3VA 4U02A 3U5ZB 2HF8A 2VF7A 1HE8B 1G7CA 1YZNA 1W36D 3ICEA 3I8XA 4TLCA 4RD4A 5FUWA 2C96A 4DLYA 3F5FA 2XX3A 1GM5A 3Q5EA 2KWIA 1N6LA 1RW4A 2W0MA 2R9VA 2OXRA 4M9SA 4UJ5A 3R9IA 2H92A 4AIIA 1OKKD 3CB4A 4AC9A 3MJRA 1A7JA 3QVVA 1II8A 5DHFA 1EG7A 5AJYA 4B48A 3T34A 3B1WA 4QKQA 2CLSA 1JJ7A 2ZR9A 1XFAA 2HJVA 4KFTA 4HZIA 3ZZTA 2N1BA 1KAGA 1Z29A 4RFSA 4Q4LA 2WPDA 1QDEA 3B78A 2V6IA 1C1YA 1XEWY 2PX0A 1KZGB 4Q4JB 3FYHA 2P5SA 2GVDC 2YNMA 3CF6R 3WMFA 4ZCLA 3EZ2A 3K09C 1KMHA 2KBEA 1ZC3A 4B43A 2WJGA 2X1VA 4LJ5A 3PUXA 2XXAB
chains in the Genus database with same CATH superfamily
5K3OA 4FMDF 3ETDA 5D01A 5DRYA 2HHAA 1DBQA 3F6YA 4K0KB 1A7AA 4KMRA 1EVJA 1W5AA 1MIHA 3R23A 2VL7A 2N47A 4JIGA 4ZDWA 4ECEA 2LD4A 2GNOA 5DBEX 5B2EA 2IW3A 3JQBC 1QXSA 1U3VA 4EYOA 4YJ3F 5A6SA 2PUWA 3IQZA 1RRFA 4ODIA 1ADYA 4LNHA 2VNSA 1ZA2A 3LBFA 3BM5A 5HIIA 3A9CA 4U63A 4CG0A 1SC3A 4BLVA 3A05A 4OQDA 3U4DA 2R7MA 1FLVA 1I7PA 3ZGXA 2R1ZA 2AEFA 1SMKA 5FYQA 2HQ1A 4FCVA 4Z7OB 1Q0LA 3B6JA 1A5BB 1OBOA 4D45A 5BVGA 1N2XA 4MI9A 1T0IA 1VCNA 3IDQA 2FZKA 3BXHA 4O29A 4TV9F 8AT1A 3D64A 3EXEB 1Z75A 1D2MA 3KLMX 4BNTA 4F3CA 4GZ3A 4R1NA 1YOVA 4B4UA 3IURA 2YOHA 1Z5ZA 5KYYA 2W37A 2VNKA 3OE1A 1SVLA 3AXSA 4ENTA 1EJ0A 2FHPA 4I08A 2D2XA 1NJ6A 4U2DA 4AM8A 3PR1A 4W5HA 4KIUA 1SQSA 2VT6A 2QVLA 2ATIA 4C4PA 2WSSD 4HGQA 1GAJA 3WYNA 3GLFE 3FRJA 4JMLA 2ZIFA 5AM1A 5KTMA 4GDFA 1G2PA 1HYGA 3R77A 1CJSA 1JPVA 1MJFA 1BKYA 5EJIA 4FYIA 3B6KA 2GTIA 2Q0XA 2Y76A 4JP1A 1N2IA 3TLCA 2QTCA 2A0XA 3CR3C 3OX3A 3VO8A 4JGBA 4C0QC 4EMSA 3CJRA 1KYTA 1E1CB 3G0IA 5HMLA 5HUQA 5AW0A 3FSGD 1G20E 1ICEA 3AZOA 4GX2A 3OCUA 3IBGA 1WDTA 4ZRDA 5EQJB 5HS6A 3UHFA 4TMVA 5LSAA 3S1AA 5H80A 6NULA 1AV7A 2ICAA 4G5HA 4BQQA 1XKLA 2WIAA 1DG1G 4PWZA 3EDRA 3N3AC 1E63A 1EKXA 1P5JA 2Q3MA 3EVTA 4G3XA 2PZKA 2I4TA 1ZK3A 3MK31 2FP3A 1BGVA 4U9UA 3CKKA 1KZYC 2ODQA 4KRGA 4OXRA 2WWWA 2Q0SA 2CB9A 3G5AA 3NT4A 4U0JA 1P8AA 1SD2A 3Q10A 5HKLA 4Z0PA 2J4CA 3Q9SA 4DV2B 1XMPA 1HLDA 2QMOA 1J90A 3BMNA 4MS3B 3W3AA 2WMNB 2BGWA 1C8VB 4GM0A 2CDCA 3PNBA 4RF3A 4ND1A 2GXAA 3R5HA 5DM4A 5JZBA 3A1SA 1J06A 1N3IA 1NVGA 4WLOA 2ACWA 4CEJA 3FSEA 1N1MA 5SZKB 3NYWA 3IIMA 2PEZA 2P3SA 3TDKA 3WSVA 5FBRB 1AGRA 1VYVA 1GGNA 3FOCA 4YALA 2W6OA 3GA0A 2YWEA 3G7SA 2F43A 3KYDB 5JQWA 3OQJA 2PKWA 3R0VA 1TAGA 3S4YA 1FQJA 3PYLA 1BX0A 5F77A 3IAFA 5FBQB 2JFWA 5KKAA 1Z62A 2C7RA 3AVOA 1L7BA 3EW9A 3TW0A 3JD0A 2CK3D 3I53A 4W4TA 1DKOA 1YRLA 1R66A 1TVKB 2HNKA 2QN8A 4NATA 4C29A 4DUPA 4JXZA 4CODB 1JRLA 4I7EA 5AM2A 4PHCA 3SXUA 3MXOA 1J22A 1Z0KA 3KZMA 1NW7A 3T5CA 1TX4B 1T3LA 1J8VA 3LSYA 1Q1QA 3IE0A 4INJA 1H5UA 2AXNA 4B87A 2F67A 4RPIA 2RD2A 4O4LB 1CJCA 1NN0A 2Z3VA 2ZE8A 3UKOA 1OD6A 2C8KA 1JT9A 4FD3A 2NV6A 1T2VA 4N6OA 3SJ7A 4BRZA 1AX9A 4MV5A 4UZEA 1G0NA 2ZPUA 1HT0A 3ROTA 1XFDA 1E9SA 4WK2B 2HWUA 1GQFA 2DG2A 3D5TA 3ZEIA 4DCTA 5JSQA 5HCNA 5BN5B 3A1VA 2RG7A 3G8BA 1ECJA 1HE2A 1WEKA 3V7YA 2R751 2R85A 2D0DA 3K9LA 2OAEA 4JJZA 3RUDA 1ZONA 1I2DA 3WYAA 3W5JA 1ZRNA 1N8TA 2GEVA 4MAFA 4NE9A 3DP7A 4BQFA 2ZSEA 4IF6A 4EY7A 4XD2A 1CZRA 4X3CA 2ZXEA 4A7PA 3I9LA 2B34A 5ARBA 3GIDA 1XVAA 5SYAA 4ND5A 2ZJ1A 2I4OA 2PGJA 4D9GA 3HUUA 4UFPA 2HHLA 4RXUA 5F1YA 4MV7A 3UJ6A 5B5SA 3WYCA 3O1JC 4TTRA 1NOIA 1UDWA 4G41A 3Q7IA 4M7OA 5BW5A 1B8VA 1HLPA 1PJAA 3QJYA 4CNQA 1EHCA 2Q5EA 4FLFA 4X45A 2X0FA 3S8YA 4U3JB 3F9RA 4DMKA 5D3KA 2YWHA 3DZIA 1ORWA 4FONA 2IWHA 1AQNA 1OC4A 2IU4A 3SBXA 5KJ1A 3WLRA 1QRUA 3B1KA 4IILA 1YI0A 2FZVA 2V74B 3DHEA 2RGNA 1CERA 2CMHA 2J4FA 1ZJ6A 3EXIA 3LO5A 3OOEA 4R81A 3ZW8A 2BMFA 3VYTB 2PBRA 3X1MA 4F21A 1RU3A 1W4CA 2AW3A 1YC2A 3EODA 2X2FA 3FWHA 2QENA 3WL5A 3IQEA 3OZFA 4KXYA 2CJPA 3KD3A 2VWGA 5ALSA 4KR6A 1S0UA 5CHYA 5AK5A 3FI0A 3CWCA 4RACA 3EZGA 4QTUB 3A06A 3UV7A 1V39A 1L4HA 2CXOA 2G6BA 5DK6A 3ZD9A 1Z5NA 1CDOA 3G2LA 1YMUA 2WTAA 5EL0A 2C95A 1VL1A 4XGQA 2ZXUA 2NO4A 4S1WA 2X7JA 3R6TA 3WNQA 1E58A 2HAEA 1NUSA 2C7VA 3OQMA 2QMQA 4I1RA 3V1MA 4E1VA 4R0MA 1J0AA 1ETHA 1HYHA 2DJ5A 2F62A 2VQ3A 4GI1A 3DFMA 4HQ6A 3THWB 1QH9A 4NH0A 4P58A 5EIAA 1CZHA 1P75A 2W58A 4CKEB 1EP2B 3QKTA 3CLRC 4E70A 3AUKA 2EV9A 2VQSA 4DEYA 2WVHA 1GPUA 1ZK2A 3RS5A 5J2UB 4BFUA 3G5TA 2YQ5A 3VAAA 4KVFA 4KXFB 5LVAA 2AYXA 3SIWA 2LCIA 2NXNA 2X8AA 1S2MA 2ZEJA 1JR2A 1ODLA 3AY7A 4ER6A 1LPOA 2GILA 2DSNA 1ZG3A 3WYBA 4MCHA 2ZG6A 3AESA 2OBFA 4OGFA 1WHSA 3P97A 1U3UA 3S28A 4CF5A 1FY2A 1AH2A 2O8VA 1RTTA 4EGQA 1BXRA 4UARA 2CSXA 1AGXA 1GFIA 4DLLA 4N7MA 2Y67A 3WNDA 5JT1A 1JFTA 3DQQA 3ZWQA 2C0PA 5ARCA 3DE5X 3L01A 4AMGA 1V5EA 2QTBA 1U3CA 3IXLA 3CA8A 3KZCA 4QDTA 3T9BA 4AY3A 4DUGD 4CKBB 1KI6A 4IMPA 5E0KB 2WM8A 3OQ1A 4HN2A 3G8YA 2EFJA 3ND5A 5JAUA 2ZAMA 1E7YA 5HFNA 3DBHB 1EQUA 3MRVA 5SZHB 4QEZA 5KIAA 1EIWA 1NXOA 4IXDA 3AU9A 4URYR 3ZI0A 3AEZA 4EG7A 4DUZB 1CZUA 5E9AA 2ZOSA 1S9HA 4EY6A 3GD7A 1XTSA 1JW9B 2D1YA 3C8UA 4N9QA 4Q7QA 4AMVA 5LWQA 1QWOA 3RVPA 2I2DA 3ZNPA 1XD8A 1J21A 1UJ5A 3GT0A 3H1TA 4S1VA 1EP1B 4K9KA 2ID7A 1S2GA 2DETA 3NIWA 2VXOA 3LECA 5F76A 5C1DA 4TS3A 3I5XA 5CK5A 2J3JA 4Y9RA 5BR1A 3JZAA 3L6BA 2CMDA 3GG2A 3AQIA 5DX0A 1OIVA 2ZYRA 4QREA 3H65A 1H4TA 2R48A 1AKWA 4BKMA 2XUOA 1E1QA 2M6KA 1ZC4A 1I94B 1ODFA 3CKMA 4GQBA 1CETA 1Y9EA 2H6EA 4LE1A 5BWOA 1K6MA 4PZ9A 1VPVA 4QGSA 2CK3A 2HXGA 1QF9A 4XIFA 4XX0A 5DNEA 3TD2A 1JL3A 2OV3A 4HCJA 3RUEA 4CN9A 3K8YA 2PMWB 3JZFA 2ZRQA 4RCVA 3DL2A 1E9FA 4PO3X 1MORA 2I65A 5D1NA 4B75A 4C03A 5GADl 3UCFA 1QHEA 1M6HA 2Q6LA 3K9WA 3MTBA 1R6BX 4LXGA 4UCWA 4UHBA 1ZMRA 3RS2A 1YJCA 3PP8A 4XCXA 3TIFA 2IUYA 3DYVA 3H1PA 3QHQA 5HBRA 2AH5A 2XYRA 3UAVA 4DYDA 2PTGA 4WL0A 2QGZA 3WK8A 4J0KA 1DG3A 4CR7A 2EHJA 1AK2A 2XB2A 1C9DB 4IH9A 3H6HA 1YVEI 3IMKA 1KVSA 3ENKA 5HMMA 4LJSA 1TKBA 1T4CB 3G0BA 3AONB 3DFIA 5BO5A 4E12A 2DXIA 4MUHA 2IH2A 3U9TA 2WA2A 1G6KA 3A70A 1LTHR 1NGSA 4TKVA 2YN2A 3DDNA 3HZRA 1N2CB 3Q2IA 1D2AA 1U7TA 4MR8B 3LF1A 4S24A 5BR8B 5KEIA 3U26A 3HPQA 2HJRA 1TMYA 1HM5A 3CLRD 1BU8A 5YASA 4QA9A 2MYPA 4GLBA 2UDPA 3KQUA 1JECA 1XEXB 4GG1A 4D9HA 4H16A 1E0AA 2QW0X 4C0SA 4KUHA 3P2JA 1D4OA 5I7EA 1IPEA 1E2NA 1VC2A 4JHLA 4Q4JA 4XYEA 1LSOA 1G64A 1O94D 2ZIVB 4MUXA 1HL7A 1B1CA 2O52A 2Z4RA 4R6XA 1P31A 1SAYA 2AOXA 4PBRA 2FSVA 4LVUA 2QLFA 1DOZA 5JXGA 1EFVB 3BWDD 1TCCA 1Y6RA 3Q8WA 4A6EA 1G0OA 3T99A 4BJ5A 3CG0A 4JUCA 1NRWA 4TTJA 5FOSA 5JNVA 4TRJA 2XIJA 2A67A 3EPKA 1CUGA 5G0UA 1WEHA 2G8NA 3RADC 2EJVA 4EMTA 4C88A 3I37X 3Q11A 2DKOA 4O08A 4TMYA 4RBNA 1RKVA 2ZUSA 5FIUA 4AS3A 2YWBA 4WY2A 4BNVA 1CK4A 1AF7A 4Q3BA 5FOWA 3QX3A 2HOQA 3HXQA 1DRWA 3QFFA 4U3JA 3LVQE 1N5DA 1GQ2A 4UUPA 4D5GA 2O8BB 2NO9A 1O95D 4RTLA 2R6R1 3H8WA 1G4AE 4EECA 3SQMA 2AWOA 1VIVA 3KLPX 2EKQA 2I1LA 1R6UA 4IFEA 4HPJB 2V7EA 1KS9A 3B9PA 4QDUA 4C7XA 5ECYA 2GDZA 3OQNA 1WKBA 2OKGA 2RHDA 1UT8A 3BORA 4NHOA 2QRHA 3IEUA 4OHBA 4QU5A 5I8ZA 3ZQKA 4K05A 2QSJA 1PWXA 1QGUB 2HU5A 3L4JA 3T4PA 5ER9A 3MQFA 1V5WA 4PTLA 2W2TA 1U81A 1X9HA 4BB5A 3ZWYA 1AT1A 3ETGA 2DH6A 2F3QA 2QE7D 4QXRA 4Z4IA 2XDWA 2C4HA 2WJVA 3ZJVA 3EPLA 2CLEB 2ISQA 3QXCA 2YTZA 4UHDA 4M53A 4G0OA 5BQ3A 1SU8A 3DWFA 4HKTA 3L8CA 2R62A 4ISCA 4L95C 2BGMA 1TM2A 3G89A 3GLTA 4FNMA 4M7RA 2PUEA 1QNLA 1U1CA 1YVRA 4D57A 3I61A 4WUTA 3WTCA 1Z07A 4OP2A 4UU1A 4NMXB 3D3WA 1NYQA 2WG1A 2OTCA 4J4HA 1M7BA 2HA0A 1G7TA 2B5VA 4AN4A 4MITA 1O9BA 4TZ0A 1X0VA 3VAYA 4ICIA 5HQJA 5G0SA 5LJIA 3VKHA 2V4ZA 2ID4A 1G21B 3H42B 4KMOA 1P4GA 3CXUA 3NANA 4KTTE 1BE6A 5A5GA 2OO7A 3UHJA 2A1UB 3U7GA 1U31A 2RK4A 1QRAA 2C7BA 1ZCJA 6YASA 4QGHA 1AS2A 2DWUA 1IY1A 4H7JA 4PHTA 5C5DA 1AK9A 1TJPB 3EQ2A 4JY7A 3T8YA 4BNWA 3EF1A 1GV0A 2Y68A 3UB3A 4C4YA 3MJCA 2OP1A 3B9BA 4UZSA 5AVKA 1U28A 1JLSA 3M4ZA 1O94C 2PBZA 3UKDA 1CJVC 2NSJA 2PMKA 1IBMB 3ERCA 1ZI8A 5DF1A 4P3PA 3HKCA 1QO0A 3IQWA 4HXYA 2TYSB 3UFBA 1UFOA 3FWPA 1QH1B 2OBBA 2WWXA 3AO0B 1TVEA 2GJKA 3L07A 5FOVA 1WMAA 5TS3A 2OCBA 2YIVX 4LF6B 5T5QA 3KU4A 4CEHA 1E2HA 3F3SA 2FPPB 1Z18A 3GD5A 3OTQA 2BFCB 3OAAD 3CYFA 3C3YA 4CKCB 4RV4A 4EWLA 2RG1A 2H8GA 2QSYA 4HAIA 4JIMA 1KSHA 2AI3A 3DKVA 3DZJA 2AFRA 4C4OA 5DX8A 3VYUB 5K6AA 1RHJA 4RVCA 2Z2YA 3P4XA 1FFEA 4KLAA 4EQ6A 1J8FA 4EB6B 1XDDA 3MRXA 1DLIA 3SKYA 3HA5A 4L72A 2A86A 3OTGA 4F3RA 1FYWA 3EDCA 4R51A 1XD2B 5AHKA 3UA4A 4H1WA 3DVSX 4BO0A 1SXQA 1IUNA 4JUAA 1F60A 2AJCA 2A9KA 1W0KD 2D4HA 4AG6A 5ALVA 2BGRA 4OBXA 2HF2A 3N2IA 4OYRA 1ZBDA 2QMHA 2ILVA 2VDWB 2CE7A 3FVTA 4WPGA 2GO1A 5CNIA 1M1XB 2VYVA 1R6AA 4ZQFA 4XZ3A 5FADA 3KC2A 5U4QA 3WK7A 2PH3A 2ZULA 4FGZA 1ANKA 3HBMA 4YQFA 4IEFB 3CSDA 4K9NA 4BBAA 1MLDA 3IPCA 2CUNA 4GQIA 5K0FA 5DSXA 1IHOA 5AP9A 1UFRA 1FFAA 2BFBA 1IHYA 4RHTA 1TMKA 1BN7A 4JBWA 4D4HA 3E5RA 5TGZA 1N9GA 4TGLA 2RGAA 5KOJA 2QSZA 1R6TA 2H16A 4Q7EA 3HCRA 3F9IA 3M2TA 4X00A 4UMDA 3NC4A 2HMVA 5JH7F 4N9WA 4RE5A 3G2QA 1AC5A 3NV7A 4UNQA 4XD7A 2IEZA 4M9UA 2M6LA 3VR4H 2I78A 3OTOB 2VSQA 1E3EA 3HZOA 1M2JA 2FUNB 1N0VC 2NU6A 1XIVA 2RGGA 1AKEA 3M3PA 3CJQA 2M9MA 5CCDA 3D4IA 2ZE5A 3DZGA 4P3NA 3TQIA 3B7WA 5G1OA 5TSDA 4ARAA 1OROA 2J33A 2V4UA 1TPZA 4PRYA 1NURA 1Y1KE 3Q1KA 3AEUA 2WWGA 4KSBA 2P7HA 2V03A 1WZCA 3WMRA 5TPZD 2JFNA 4AJ1A 4AUKA 5BWCA 1WPQA 2ZBQA 1H8ED 3PPVA 4K88A 1NMZA 1J6UA 4L0QA 1Y7PA 4RK1A 3NIGB 2CXPA 3G17A 3GT3A 3TG2A 3UCXA 5H16A 4X71A 3R09A 4P31A 1IULA 4JBNA 2H4HA 3SHWA 2HK7A 4P82A 5FI1B 3KR2A 3K35A 4II3A 4RJTA 4XIGS 4URFA 1YS2X 3SP1A 2AS0A 2C00A 4NE2A 2CL0X 3CH4B 1FUKA 4IR7A 5EAIA 5FR2A 3AP2A 4QOSA 3OPNA 5JNWA 3L8HA 1JT2A 3L6UA 3OOWA 3PHBE 5CA0F 3W5BA 1VE1A 3SF8B 4ZV4A 5CNJA 3LUAA 3PLRA 1D1TA 5C4IA 1J0EA 2W2LA 1AKQA 1GYRA 3LKZA 2HU8A 4Q21A 4BBPA 4FXOA 2P35A 4OTZA 3EGXA 2QTHA 3AY0A 3ZHVA 2HSGA 4PSAA 2XNSA 3LUFA 5G41A 4YJKA 3IEVA 2HDWA 2PRJA 4GM1A 4XUDA 5J4LA 4KVAA 5A6VA 2XWPA 1WIWA 2PDAA 4C78A 3EFHA 5AXAA 1C9MA 2GYWA 3EHDA 4H7KA 3L8FA 3SEFA 1GAQA 1HEYA 3O94A 1FZTA 1J07A 2RIPA 3GUUA 3K0FA 1ADFA 1W2GA 5CXXA 3NBMA 5BW8A 3DLHA 3ASYA 1P29A 3TCXB 4P0QB 2YFHA 1Z7WA 1FJHA 1L6IA 1VLHA 2HMUA 3M9LA 3Q8XB 4NZZA 4P4GA 3T7JA 3X3HA 4BVJA 4URWR 3NYRA 3D59A 1U2PA 1Q1NA 1ENOA 1RLOA 2ZJZA 3FBGA 1TLTA 4O5AA 4XB1A 4C2UA 3PXUA 1YS6A 2CC2A 4K81B 4QBGB 3ZQJA 2PZAA 5CX1B 4ZHSA 1XQ9A 5EJ9A 3MJHA 3N39C 4N01A 2D0IA 2PKXA 2NSYA 3KT0A 1AUQA 1ZCBA 4H7HA 1YR6A 1PDOA 3Q3IA 3UF0A 1ZAYA 4KXUA 4HDMB 4EG0A 3E48A 4B3SB 4AK9A 4GX0A 5C7LO 2F1HA 3AI3A 3RVJA 3UAGA 5DMHA 2PUAA 4KPUA 3BRQA 2RHGB 2GMWA 2QYOA 2WTMA 2P2ZA 2REXB 4OQXA 3HXLA 1AXGA 5LD2C 4FZ3A 5MGNA 3N8IA 1Y7LA 4BDSA 3D5QA 4EY4A 4H27A 3X1WA 2E5WA 2XBLA 1ZISA 1Y3BE 5HPYB 1DBPA 4W5RA 1XDWA 4MGIR 2IP2A 3T7KA 4PZCA 1KGDA 2J5KA 4AQYB 5ULLA 4PIMA 1T2NA 3D6NB 3OFKA 1YRWA 2BZGA 4ZC8A 2GVZC 3GDHA 3HEMA 2ON6A 3P5BA 3PJDA 4L1KA 4QGFA 4LTNA 5EESA 3I73A 3OHPA 2DULA 2G1KA 4UPDA 5CUQA 3DKRA 4QE3A 1QFSA 3PSHA 2R6ZA 1QHNA 2FK7A 2VBCA 1DADA 3F9CA 3NDPA 2HUPA 4YJHB 3B3FA 2JGFA 3WWCA 3O2NA 4CU5A 3FIUA 3REQB 3K71B 1T35A 4IQGA 5GP1A 1KMCA 3USZA 4ZU3A 1KK3A 1JXQA 4I4TF 1E9BA 3W2EA 3EDOA 4OQZA 3CZ5A 3K53A 3DV0B 2OCDA 1Y3AA 4ZOLF 3U3OA 3E23A 4L9AA 4LPSA 1TIBA 2RGUA 4Q37A 4J1TA 3I05A 5EWJA 4NAHA 1RWPA 3PEUA 5D7NA 4YONB 3U4QA 3C70A 4JK3A 3U0VA 1YQWA 2Z4TA 10MHA 4FXPA 4NQRA 3K1TA 1JG2A 4GH5A 4QOHA 4IM7A 1H66A 1Y80A 4YI3A 4LRTB 1T5BA 4H0NA 2B2XA 3PQFA 4PSCA 2J9GA 3VJRA 5DNAA 1Y42X 2REOA 2P9BA 2NYRA 2ZT8A 5FQOA 2JI4A 3PVZA 1ESZA 3E8XA 3DA8A 5DLQC 4D81A 1Z16A 3NWEA 1WB5A 2WV9A 4RPCA 1EM8B 4MKGA 5KDLA 3RIMA 3IMFA 1BFUA 1PR2A 4ZI3A 2ZWVA 5JR3A 4EKDA 4V0SA 1SQ5A 4DYVA 4OHKA 3SBDA 2J31A 1GITA 1HFEL 1W4ZA 3K2EA 1L7QA 4ML3A 1TZJA 4LFCB 1XZIA 2ATVA 3K2BA 2HADA 1IMJA 1KEWA 2NQ2C 3H04A 2V9CA 5JECA 4O02B 1IN4A 4E1AA 2J3HA 3I6IA 4YRRA 2I6UA 4RPJA 3H11B 2QD4A 3QSGA 4LOLA 2JLYA 1MIOA 4EA6A 3D7LA 3O2QB 3VO2A 2ZTUA 2VHEA 4NJEA 3W8RA 3GPCA 2QV7A 3OY7A 4M54A 1VE9A 2CHFA 2OUIA 1JKJB 4DS3A 4IHJF 5EGSA 3WK9A 4PNPA 3V42A 3S5UA 3WLIA 1NDHA 1YZKA 2X0KA 3DBRA 2PLRA 4GBGA 4CV2A 2VUHB 2Z9BA 2WJHA 2I4RA 2W6QA 5BYJA 4EGSA 1AIPA 3AB8A 1QLHA 1XCBA 3S7ZA 2I7DA 2JH9A 3PUKA 4FZRA 3U4GA 4TYPA 1QZXA 2C7QA 3N8NA 2X0JA 1UKZA 2Q1TA 3A1NA 1ZYUA 3DEHA 3LY7A 1TVMA 1I8TA 1LBIA 3QA9A 3VZPA 4KXMA 4B3GA 3K0CC 1VG9B 2AZ4A 4Y6OA 2EAUA 4BNHA 1E8NA 4Z1MA 5AKIA 2PVCA 1Z13A 4ZGWA 1EVQA 2OY0A 3NOOA 1XG5A 4LDQA 1NVVQ 4QBIA 3WWZA 1L7VC 1Y37A 4ZEOA 1IB0A 4M49A 3I2IA 1C7QA 2CHEA 5DDIP 4R9UC 1RI2A 2OZPA 4DIMA 4F85A 2HNAA 2XXBA 2XEDA 4H77A 5A4KA 4FU0A 1IMOA 4FYHA 3AMVA 5DCLA 3KEMA 3IP9A 2Q8QA 2XMGA 2Q3BA 1NBWB 4GOJA 4JI8B 3PGA1 1FCJA 3PU6A 5FTKA 3ABQB 3KE9A 4ETIA 3LX5A 3Q0TA 4FOTA 4JJFA 2IOQA 1GYQA 3KOZA 3O2SB 1W4BA 4IS2A 4ZOEA 4B0PA 1QGED 1WQ4A 4L5AA 4IVQA 4WBNA 3IAXA 3HKDB 2Q49A 1T8YA 4IIJF 2ORYA 4PFQA 1QHYA 3TR0A 5KOYA 1J8MF 4GD3Q 3HABA 1Q83A 3HCDA 3VSDA 3KJFA 1N9KA 1MO5A 1NT4A 3A9UA 1OBFO 4JNCA 4NCJA 4B7XA 3GLGA 2B4AA 4MJ7A 3V5NA 4XA8A 5JBQA 6GPBA 1NFRA 3ILHA 4TN5A 3U4HA 3OM1A 4TQ9A 1XTUA 5BOVA 4ESVA 2EGGA 3K8ZA 1ZGAA 4JLKA 3C5VA 3RTEA 2JKVA 5FFFA 3L0OA 3GCDA 2KI5A 4RGBA 3V8QA 2GAIA 5JAOA 3EQ7A 3QELB 4OM8A 3FZEA 2GPSA 5L51A 2VZ9A 2Z6QA 2G0AA 4C07A 4JB3A 3E81A 3INTA 4YRJA 2XMSA 4BFCA 1N6PA 3IRVA 2QJFA 1BGXT 5EUCA 2GZ2A 3TNJA 4ZAVA 4HEJA 3B6MA 3RVNA 2WZCA 3R6WA 1WP4A 4G5SA 1BHSA 3GOHA 2II6A 1ENPA 3T3OA 5TT1A 1J24A 3RFUA 4N65A 1Y63A 4EB3A 4RJKA 1F5NA 3ITKA 1NBME 1P2UA 1QIKA 2WICA 1MDFA 2FA9A 2H1VA 2OHOA 3EQZA 4MIOA 4MHOA 2ANCA 3KKOA 2H1FA 3WLMA 2ZE7A 2FW1A 4LQDA 3U1TA 3UAZA 3H99A 3LKDA 4FI3C 1XNQB 2Q2QA 4MV0A 4DHEA 4DRXA 2H4WA 2JFBA 2XZLA 4AZSA 1NP7A 4ZJUA 3RRBA 1M2HA 5B3JC 2DX7A 3UXMA 3SZRA 2VQ6A 3WGYA 3PA8A 5FI3A 4HHEA 3VFDA 3PG5A 3A27A 2C3PA 4C14A 2ZYVX 3I1FA 1JG1A 5FOXA 3ZLVA 3C97A 1KFJB 4JLVA 5KQSA 3FIJA 3CEPB 3WP0A 1NBOA 1M9NA 1YDEA 3IIEA 4DEVA 4C7KA 3RC3A 1DEKA 4DSOA 3E2MA 4H6VA 4XDYA 1TM4E 4KQJA 3V80A 4IIYA 1EDBA 1F14A 2HC9A 1WB4A 3G6WA 3PITA 1JKXA 2NUPA 4GOMD 4DQUA 3BMQA 4PN3A 1QO7A 3EGOA 5E1MA 2JD1A 3REGA 1E0SA 1S2IA 4L5BA 5KCZA 3K7EA 3HCBA 4DF3A 2LV8A 1YBVA 3H11A 3HVJA 3ELYA 1TK2A 5ALUA 1ZN2A 3DW1X 3CM0A 3UMFA 3VH2A 4E11A 1BFDA 5F35A 1G4HA 3Q9NA 3C3PA 1Z17A 1CY4A 1Y1LA 1MF7A 4K9OA 2COKA 4ZJZA 4F6CA 1A8HA 1LJ8A 2ZXFA 3H3JA 2GEJA 3INRA 3OIYA 4MUFA 5E2IA 5EERA 4ZVVA 3D6HA 4F3NA 3RIEA 4G0UA 4I50A 1GLNA 1X1DA 4BNDA 3K5HA 4DDUA 4FNAA 2YVLA 3E9YA 3K5WA 4RV5A 3ZIUA 5AVWA 2P9QA 3AIIA 5T6MA 3TZLA 2WM3A 2IS4A 1F8GA 1RWKA 3GZNB 4WOKA 4UOQA 1NJSA 4Q9JA 4ZVQA 3WQHA 4IFTA 2ZTVA 4P4LA 2M1ZA 1X74A 4LJYA 4MYUA 2CUZA 3QYAA 1K4KA 4BUCA 5FJJA 2ZCJA 2Q2VA 2AYZA 2PUGA 2X1MA 2NVUA 3AFIA 1M1YA 2PVSA 3Q0IA 4MQ6A 5DNDA 1I5RA 1YWGO 4NV0A 5KYUA 3VKWA 2QX8A 1ACJA 5G4KA 4EENA 1JIXA 3D1VA 3EIFA 4RZHA 2X8JB 4FEAA 4IO1A 4HATA 2WW8A 4FC6A 4RMGA 4D9EA 5JCJD 2IUEA 3BCRA 3DBRB 1RWOA 4RD6A 3VRHA 1JZTA 4IIFA 1GPNA 1SCIA 2GLUA 1DUSA 4Q82A 2PJRA 2EJWA 1WCYA 2DJIA 3SLKA 1S3IA 4OHOA 2R6FA 4IIJB 2ODPA 2P68A 5HKOA 4IIDA 4OGLA 1ZVVA 3FYUB 4B84A 1MVOA 4F5ZA 2WWFA 1BDBA 2O8BA 1Z06A 1LX7A 4TWAA 1FNSA 1ML3A 2WD9A 3OEHA 3PRHA 1WM1A 4K40A 4TLAA 3EYAA 4F71A 2GESA 2IP1A 4M1TA 4J1SA 1J56A 3TLZA 3NLLA 2PMFA 4E7PA 2IPMA 1L5WA 1TYEB 1MAUA 1MOZA 1DCKA 1UOPA 2Q6IA 3B3QA 3EDQA 5A2GA 3A11A 3PCTA 2UYHA 3BKXA 5EE0A 3ZK7A 2O9JA 3HLTA 3ZWBA 2J3KA 1NU6A 4CTMA 1R8XA 1G3MA 1SA0A 1F51E 3QE2A 1T5LA 4XWYA 5D85A 1XK7A 2FEMA 3BAZA 3S2SA 5JAHA 4Y1RB 4C20A 3VDXA 4X84A 3E1KA 2NG1A 3WISA 1FIUA 5BVGB 1G19A 5JMOA 3JVDA 5IG2A 5T4HA 3V8BA 5C4MA 2UKDA 3I1IA 2ZWAA 1F8FA 4MI6A 4BO1A 2JBAB 4QVGA 3E5MA 3DZCA 3JYHA 4KCGA 5DK4A 4ZT4A 4E31A 1WJGA 1LQUA 5FTMA 2VQDA 2FN7A 4DJAA 4B6SA 3MYRA 2WV7A 1QZ3A 5KOJB 5D00A 2LKCA 2WLTA 2RAVA 2ZTLA 3BQMB 3DB1A 3GY0A 3IELA 2ZYDA 3E70C 5EKUA 1T6NA 4BMSA 4CPDA 1E5DA 1UDAA 2GHQA 3ESQA 3IJ5A 4WERA 4CMAA 3FNIA 4RJ2A 2ATXA 3BSFA 3ORSA 3HVHA 3L0BA 1I6KA 4J0CA 4BTEA 1U2GC 4UEJA 4O59O 1Y1RA 4HNSA 4R68A 4DR2B 2P1ZA 1A04A 4YRTA 1S89A 4ZU6X 4YJGB 1W581 4B73A 3BK7A 4W9RA 4YT8A 4YCLA 3DNFA 1HETA 1NTRA 1OVGA 1JEQB 1AU9A 2ZAYA 2QG4A 1Z7GA 1ZVKA 4N6GA 2CBXA 3TTSA 3HCEA 1PJQA 5IAAA 2OZEA 2V6FA 2SKDA 3R6GA 1PBNA 4X8LA 5A62A 1XV5A 3VAZA 3TZHA 2R11A 5DVZA 1G21E 1TKCA 5ALPA 2FQXA 1UOEA 3D0OA 5JD5A 1DEAA 4KMSA 1RXYA 2ZQ5A 3GJRA 3LLMA 3QBJA 3QVWA 4ES6A 4C7MA 3BJRA 2HA3A 3GO4A 4NSNA 4M86A 4F8JA 2JS7A 2J0EA 4F2PA 3BMXA 5KYWA 3M3DA 4GI3A 1OT5A 2PQ6A 4J0IA 5IASA 3JQFA 2PG3A 2FPPA 1X3LA 4PR3A 5ALOA 4AY6A 4MVJP 1BE8A 1DBWA 2OCIA 2Y6UA 3KSAC 3FUCA 1TYCA 2CKDA 2XCOA 3IFSA 3A6FA 1K4YA 1V6SA 3K0BA 1TEHA 1VRVA 2B4YA 2V65A 2E1PA 5LMCA 4E32A 4JX8A 3CRRA 2QX7A 1VL0A 4BTVA 4QFBA 5IYZB 1QPZA 1PEDA 2EJCA 1SWWA 1DWPA 1PWZA 1Z8DA 2JJYA 2Z2IA 3I9JA 1UKEA 2BEVB 1SBQA 3FUWA 3GR6A 3KKKA 2OXFA 3QH4A 4MUYA 3DBHA 4RYDA 3T1NA 4WKBA 4DN6A 1JX6A 4FX2A 2XF2A 2VI5A 3OC0A 3COJA 1BHQ1 1R4MB 1ZLXA 2GA8A 3NG1A 2EYUA 3MIZA 4QODA 5KNDH 1ZCAA 3E7WA 2O57A 4PPYA 3PFNA 2P0YA 2HFKA 2WHEA 4HH1A 4XKJA 4C4ZA 3THXA 1ZUNB 4C04A 5JC1A 1XVIA 4YUWA 1X7ZB 4MQLA 3PGXA 2N1MA 1GKUB 3GCGA 4IXNA 3ZV7A 5JWRA 2XSZA 4FOLA 2JJMA 1UPFA 3G1WA 3ZD8A 1KJQA 1DC4A 1CZNA 1HNWB 1U2RA 1J1UA 2PBFA 2VT3A 4US1R 3OFND 4A6DA 1W4LA 3IV7A 4JCCA 4S1OA 2BM1A 2QXUA 3TOCA 2PZEA 4CXMA 4I1PA 1TYAE 2OQRA 4TXNA 3THXB 3ZW7A 1JH9A 1I1OA 1TECE 1WZEA 2CVHA 1TCUA 3DGFC 1UPTA 3EY4A 5HQ3B 3ABSB 2CBZA 2UXCB 2NVUB 1AQIA 1UBEA 3P7MA 5LQRA 2Q21A 2IE0A 1QCYA 4EVQA 2Q5LA 1U99A 2XE8A 2BONA 4IVRA 4Q12A 3W5AA 3B9RA 3F74A 2JGMA 3MUEA 3R5TA 4LCEA 5B1IA 2ZJ5A 3KRTA 3RC9A 4DCNA 2BLNA 3JQDA 2Q5FA 1D04A 2FZEA 2I3AA 4NK4A 1FRVA 3CZ9A 1VYUA 4GPZA 2G72A 1RYBA 4PHFA 2QKYA 4WEQA 1SCJA 4KW7A 4M60A 4A0HA 2I8CA 4CL2A 2BFDA 4QU8A 2BGNA 4X94A 4EG1A 2BAGA 3OP4A 5JZVA 1EDDA 1NJ1A 3KSRA 1XTBA 1APBA 2R68A 1RPAA 4HFRA 3HN6A 1MR3F 4I4TB 2EP5A 4CT5A 3EASA 4M1QA 1HT3A 1K5PA 4EPVA 2OECA 1N2CE 1NA5A 1YXMA 1LA2A 5AKLA 1UODA 5JSZA 2H5LA 1ISFA 3B1YA 1JTVA 3T1OA 2OZKA 5HTKA 3NIBA 2PSJA 1N2BA 4MLCA 5ALKA 1UXOA 3LC7O 1OC2A 5B3LA 2N3ZA 3IP7A 3RSGA 2CNWA 3LUCA 2B2CA 3AETB 1QIMA 5AM4A 3T3MB 1L3CA 2QBYA 5EMJA 4PO1A 4UAUA 4ZYZA 2Y05A 1X9GA 4D80A 5LNK6 1DTEA 1U0EA 4XQ0A 2DUWA 4V0ME 3NNSA 4ZOCA 3TZEA 3V4FA 4A8JA 4H3SA 4BMDA 4C01A 1OAOC 1JYSA 3T54A 3H83A 1EMDA 3U5TA 2JJ2D 3N2NA 4WUVA 4U7PB 3BG5A 4FGSA 3GFOA 4L3WA 4PRZA 3SEQA 2YZ2A 1EFVA 4QEDA 4AWAA 1CJUC 4LHYA 5TVGA 1V3QE 1Z68A 3RODA 1Z36A 3S7TA 2CCGA 2HLDD 2QUZA 3LK7A 1R3UA 1ULZA 2VJNA 4DAOA 5AUOB 4R54A 2V97A 1EWQA 4B35A 1RXEA 4M55A 5COBA 3AY6A 1VI2A 3DR3A 4U6SA 2UYCA 1IG0A 3VR3D 2IZZA 1T0HB 4HO1X 3TCNA 1DC6A 3K9GA 1Q7TA 4FWIB 3DE3X 5LQSA 2XAUA 1VGVA 3ZQ4A 4IDQA 2X0IA 1LLFA 3KJEA 1KDOA 2JGLA 2HO5A 1AKUA 1CNFA 4KJXA 4BX9A 1V25A 3OVMA 2Z6AA 3PQ8A 5HSGA 3KUKA 4GR5A 4CMKA 3N59A 3I9V6 3A6ZA 3QXHA 4RVOA 4CKBA 2CUTA 3NAMA 1MABB 2EWVA 3DHWC 4BPBA 1W75A 3CZCA 1LQ2A 4D9BA 1CDZA 2YIMA 1GKYA 4Y2TA 1AKRA 4TVKA 2Y1EA 3EPPA 1PZHA 1IH8A 4UFNA 4CMJA 2B7CA 5F64A 1R6VA 2BFFB 1CUVA 1VJRA 1QZZA </