4HUJA

Crystal structure of a hypothetical protein sma0349 from sinorhizobium meliloti
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
204
Chain Sequence
NLYFQSMTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRFGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPRDLGGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQVAELISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein SMa0349 from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Structural genomics, unknown function
total genus 56
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hujA00
4RO0A 1P9LA 1F8FA 3BMOA 2J8ZA 4CODB 4E13A 4FFOA 4B3IA 1E1LA 1U7HA 3RUIA 1H6DA 1SEPA 5COQA 5TSDA 2JAPA 3KYDA 3LT1A 5CPBA 3RAJA 2G0TA 1HE2A 3U0BA 2H5LA 3KV3O 7ADHA 2GGSA 1B8VA 2AW5A 3ZHZA 1ZK3A 2YQ4A 3AY6A 2QX7A 4EEZA 4UVIA 3KRTA 2GN4A 1YKFA 3CZMA 4WJZA 4BO2A 1H9BA 5CP8A 4JXKA 1I36A 3ZCXA 1R37A 3U5TA 1IPEA 4QFCA 1BXZA 1X0VA 2PZJA 1JA9A 2O3JA 1DLIA 4B4WA 2BFPA 3GPIA 1K6XA 4BNFA 1Y8RA 3JD3A 4ZICA 3FR7A 4D0RA 2C5EA 5JO0A 3GEDA 4XWYA 3H5RA 1MGOA 4N5NA 5AQ1A 3S1LA 2D0IA 2W2KA 2ZYGA 2X0JA 3TNLA 2NVWA 3FRJA 4JJFA 3OEYA 3EY4A 3BIOA 1R12A 5I7EA 3U09A 1GCUA 3L4BA 5JY6A 1VRWA 4MVJE 1SCUA 3K30A 1ADGA 3WJAA 4CQMD 3ROKA 1WDMA 5I8ZA 5A5EA 2Q4EA 5JMPA 4IDFA 3Q6IA 3R3SA 3BMQA 1P44A 2HK9A 3S55A 4RVGA 1SB9A 1O8CA 1ZSNA 3I9MA 4PLCA 1WNTA 1DB3A 2HMVA 1LSSA 2BF7A 4URFA 3Q11A 2HRZA 4XKJA 1E3WB 1DJNA 1VE9A 5FF9A 5HS6A 3E8XA 1C1XA 2B4QA 2R6JA 3OJEA 4L8VA 3RC1A 1R4MB 1T26A 2POQX 2NVUB 1TT7A 2X8LA 3NTOA 5AXCA 2GERA 2NWQA 3FNEA 3VTFA 3NT4A 4B7UA 1B0AA 2RBEA 3BA1A 4GX0A 4JX8A 4ESOA 1E0DA 3A9WA 2E6UX 5G0TA 3HN2A 1OC2A 2W98A 2EV9A 3RUAA 4IQGA 4RJTA 4PIVA 3WMWA 3I9LA 2OBYA 3OIGA 3TZCA 3ZHXA 2NUAA 3L6EA 3W8DA 4LSWA 4XR9A 1QP8A 4A2CA 2PNFA 3H9JA 3ZDFA 1TXGA 1DDOA 4ZQEA 5JYDA 3M1AA 1DC6A 1PGQA 3AFMA 2Q50A 4PLWA 3S2IA 3E5MA 4PCVA 3AI1A 3OJOA 2B37A 3NDIA 4O59O 3GFBA 1ENPA 3JYNA 4RLHA 1DLJA 1GFSA 1G6KA 2AE2A 1R0SA 4IMRA 3G17A 2HMWA 2IEBA 2ZQZA 5AXBA 4AJ4A 4W6ZA 4UVGA 4Z6KA 5I9MA 5KTKA 1P1FA 2D5AA 4UAGA 4AJIA 4BO7A 3SJ7A 1A9YA 1XEAA 3JQ9A 1J49A 5DF1A 2Q45A 1EFKA 3KEQA 2O2SA 4RCVA 4E2YA 3WIDA 1QV7A 1PX0A 1XLTA 2FY8A 5F1PA 1QLJA 1GZ6A 3MOGA 4MKRA 3PVZA 3PJFA 4WKGA 1Z73A 4D79A 1U1IA 3PQFA 4RV9A 4K1LA 4CM5A 5EESA 2OGUA 2IXAA 3G3EA 3MZ0A 5H82A 5KJEA 1YQXA 3X2FA 1QYCA 2RHCA 4ALJA 1A71A 2VUUA 3B70A 4YACA 2I65A 4ZD6A 2AXQA 2ZJ0A 2JFFA 2B83A 2Q1SA 3H9QA 3RBXA 1YRLA 1XELA 3H7AA 1PJLA 3O38A 2X0RA 3JQEA 3AFNA 5TX7A 2Q1TA 1H6BA 1P1JA 3KHUA 3DZGA 1SNYA 1WPQA 2HSDA 4EJMA 1W73A 4I9NA 2QW8A 3GG2A 1M75A 3JQGA 3EUWA 4II3A 3ONDA 4MIOA 1K6JA 1U4OA 2BD0A 1BRMA 1UXJA 4BUCA 1VC2A 4BKOA 2VYNA 5JY1A 5B12A 3Q9NA 3Q3CA 4R16A 3DHNA 2OL4A 2H63A 5KWEA 1YVEI 5BNTA 1VKOA 3DDNA 4ZN6A 1DHTA 4Q3AA 4AJPA 2BI7A 3I9OA 1UUFA 2V6MA 4HXYA 4BO5A 3P19A 1JN0A 1YE3A 5KVQA 1DAPA 2EERA 2AQ8A 4IBOA 1GEGA 1MX3A 2O7QA 1QORA 1JDJA 2R2GA 2DFVA 1V8BA 4BNJA 1WLYA 2UDPA 5HRUA 4JBHA 3PHLA 1QR6A 4Z0PA 5T67A 1WMAA 5G4LA 1QSGA 1EBUA 3MJSA 1LBEA 4IGFA 4UUNA 3RFVA 1EE9A 4CR6A 1YDEA 2J3KA 1JVBA 3NT2A 1E6UA 3E9NA 3ZWVA 1BWSA 1KVTA 2ZB8A 3ABIA 5A9SA 4W4TA 3TJRA 4DYDA 1ZSYA 4TRNA 1BMDA 2Q2VA 3N58A 3HHPA 4CM6A 3BMCA 1IZ0A 3VDQA 3UVEA 4E5YA 3F3SA 4ND2A 2C82A 3ZWMA 2Y0CA 7MDHA 1NAHA 4UEOA 3RFTA 2EJWA 4K28A 5JPIA 5K9ZA 2VWPA 4NJMB 3KM0A 4MVJH 5CFZA 4NJOA 1Y6JA 3CSDA 1L7DA 4MVJD 1KBZA 4YQZA 2LDXA 1GTMA 1ZXBA 1E7RA 3M1LA 4WOJA 1D3AA 2V65A 2XAAA 4DTIA 5ER9A 2VZ0A 3W8EA 1ADBA 2C20A 3TZKA 4D45A 1UZLA 1PU2A 4RF5A 4BO0A 4B7CA 3TSCA 3WSWA 3RQSA 3VKUA 4I8XA 2QRKA 4QECA 5TQVA 2FR1A 5B37A 1GZ4A 4IDBA 2P68A 1KVSA 4ALIA 4BNYA 4IXTA 1Y1PA 5DN9A 2JAHA 3LU1A 5JAZA 3QA9A 3DBHA 1NWCA 2I99A 2A94A 2X0NA 3BYZA 2X7HA 1Q7GA 2IZ0A 3VH1A 4YXFA 5EN4A 5FWNA 1YQDA 4ND5A 1EVIA 2HDHA 3B6ZA 1NBOA 5JC8A 1XU7A 1BHSA 3CIFA 3GR6A 5L7WA 3QVTA 1ZFNA 1U5AA 3PZBA 4OSOA 4BGVA 5I9NA 4HFRA 2X86A 4YJHA 1ZJYA 4ALKA 3GH3A 3QLJA 4B4VA 1LI4A 1MG5A 2DAPA 2OZPA 1QMGA 2C59A 3PXXA 4J4BA 4PG4A 2EP5A 1PJ2A 4GPD1 3K9QO 1KEVA 4Q3BA 1ZW1A 1Y9EA 1H2BA 3FTNA 4UREA 3JQ8B 3KB6A 4CLEA 3W4KA 3JQ9C 2CDAA 2BGLA 4Y6PA 1PJ4A 3T7CA 4TWRA 4UVEA 1M2WA 5IDXA 3LT2A 1LNQA 2WD7B 3FD8A 1YB4A 3M2TA 1BGVA 4JLWA 3GDOA 4CMEA 1PWXA 2HUNA 1NFRA 2X9GA 1RJWA 4MKXA 4MDHA 1U8FO 5BNIA 3WBBA 1M76A 2PA3A 2B5WA 2X23A 2G1UA 3AJRA 4IZIA 2AMFA 2PR2A 5THKA 3OJFA 2ZB4A 4IM7A 4ZHSA 4CLOA 4FFPA 3BHMA 4RF2A 3W6UA 3KYBA 4M86A 1MP0A 3A28A 3D5TA 1NWHA 2FZEA 4MPDA 3IUSA 4MOWA 3SXPA 2OFPA 3PFWO 2PKQO 2YV3A 1A7AA 4WEQA 1H5QA 4GGPA 1U28A 5GMOA 4DRYA 1C0KA 1G1AA 2PD6A 1V35A 4EUHA 3NEPX 4FC6A 5JCJA 3DFZA 3TRIA 1ZUD1 1EDZA 2FR8A 2YQ5A 3LF2A 4RPLA 5CHEA 5A03A 1M6HA 2AG5A 3AUUA 1F8GA 4IMPA 1YBAA 1ENYA 2A9FA 2RH8A 2OUIA 4IDAA 1U2DA 1HSZA 1O5IA 3JCZA 4ZQFA 4ONEA 4GX5A 2PGLA 3TL2A 3SLGA 1HDXA 1PGJA 1V9LA 2O3QA 1NHWA 4B3HA 3GUYA 3C7DB 4OGWA 1D7OA 3UCEA 2UV8A 1LEHA 3UAGA 4A7PA 2W2LA 1B8PA 4IJUA 4JNKA 4R1UA 3WQRA 3KVOA 1H93A 2CFCA 4E2ZA 2ZTMA 4XQEA 3V8BA 4A0SA 1P1KA 2P4HX 2NSDA 5DBFA 3CUKA 2GD1O 4J9UE 1LRLA 4DIOA 4NNJA 1NQ5A 3DMYA 2E82A 2ILTA 4I5GA 2IODA 4S1VA 1NR1A 2JCXA 2FPIA 1JKJA 4GL4A 1WXDA 4INAA 3DR3A 3P5SA 3RJ9A 3GFGA 5DP2A 1OBFO 1LA2A 4GQAA 4IY1A 5DDIP 2CVQA 4AICA 5JDIC 1XGKA 1UAYA 2SCUA 3JD0A 3F5SA 5JDIA 3PWZA 4RDHA 4L4RA 3PPIA 1DFGA 1ENOA 4J49A 1VJTA 1YH3A 4R3WA 4KUHA 2GSDA 3ZWOA 4BKPA 3FTPA 3FI9A 3TF5A 1R66A 4YJFA 3WG9A 3ZU5A 4GMGA 1SO8A 1QYXA 2DU8A 3PYXA 3LF1A 3VTZA 1ADCA 5K0ZA 3INRA 3RUFA 1P77A 1I01A 1Q0LA 4PVCA 1HWYA 4MIYA 4RPKA 1FDTA 3U4IA 2FPGA 5JYEA 5DCUA 4AJEA 5ER6A 5C7OO 1BW9B 4PFJA 3QHAA 4A26A 1ORRA 5JNLA 1B14A 3ONEA 4IZHA 4JJGA 1RM4A 4Y6SA 5L7YA 4FSHA 2VOJA 4Z9FA 4JCOA 1J6UA 5AYVA 1HEUA 3I23A 4LCEA 4RVUA 3U62A 4YRBA 3A06A 3G1TA 2VTEA 3W4IA 4GAEA 4BO8A 2NACA 4NU6A 4N54A 4CMBA 5K6AC 1ADFA 1RYDA 4R9SA 2B4TO 1EFLA 1R0KA 1ZJZA 1Q7CA 4GX1A 3S2EA 4OXKA 2D59A 4WOKA 2ZKLA 3DOCA 3I3OA 4N18A 4TQGA 4O6VA 2PK3A 1DBVO 3EYWA 1PS8A 2O48X 2WYUA 5DOZA 1I8TA 1IB6A 4DPKA 4IIVA 1K3TA 1XR3A 2Q1WA 2E4AA 2CY0A 3R1IA 3PI7A 5G0WA 4AJLA 3HNPA 4YTEA 5C3MA 3TWOA 1J5PA 4CQMA 1WMBA 2WWRA 4CMAA 1U3UA 3AM5A 4I5FA 3SC6A 5THQA 4ZQBA 1A9ZA 2F1KA 3OIFA 1NTOA 3O9ZA 3D4NA 1OZAA 1D1TA 1DJQA 4F6CA 3EAGA 1MXFA 2CVZA 2VZ9A 1I10A 2VUSA 3D5QA 5GY7A 3FR8A 3HB4X 1N5DA 5JS6A 3OA2A 2FPPA 4KQWA 2EGGA 2PZLA 3DWFA 3JYQA 3EC7A 3WICA 4D43A 5FYDA 4BO1A 3DEYX 1HDCA 4R5MA 3DZBA 4JBIA 1TLTA 4Q3EA 3VPSA 2P9GA 3MJCA 2P91A 2X5KO 2JFHA 1CWUA 4AJ2A 4BV8A 1GYQA 2GO1A 3OICA 4P4NA 1MA0A 1G0NA 4FQ8A 4IDCA 5AOVA 1YJQA 3IAHA 3WQSB 4CUJA 1UR5A 5TNXA 3UHAA 3I9NA 3ROMA 3ZV3A 1F06A 4HADA 1LDGA 4NBWA 3RASA 1LSOA 2WE8A 4ZRNA 1KERA 1PL6A 1KETA 1YOVB 4OKIA 3QWAA 4XIYA 4Y98A 1PZHA 2WMDA 3QQPA 4FOOA 3V1TC 5U9CA 3E5RA 1JAXA 2C07A 1LRJA 1EUDA 3NDRA 2BHLA 1I30A 1HLPA 2DBRA 4BNXA 5JW6A 3D1LA 3ICPA 4B3JA 4MVJA 4W99A 2PH5A 4RQUA 5TJ9A 4XQ9A 1JLLA 2H9IA 3KYCA 5JMWA 1CJCA 1R6DA 4IUYA 3IIEA 3VAZA 2GF2A 4EITA 3B1JA 4GX2A 1PS0A 5J23A 1N9GA 4CPDA 1I24A 3IOYA 3NDJA 4G5HA 4K6CA 3K6JA 4BNTA 1LLUA 4R4JA 3KEOA 3PGXA 4HFNA 2EW8A 2QHXA 4GI2A 2AQKA 3DBLA 1X0XA 3QV1A 1ZXLA 1BXGA 2P5UA 3OQBA 4NJMA 4NHEA 4P22A 3WTBA 2VRBA 1P31A 1MXHA 2EKQA 2WYVA 3ZWPA 4EJ6A 1IPFA 2IZZA 4NI5A 3C1TA 3F47A 2DLDA 3ZNPA 4NBUA 5HWSA 4ZQHA 5KOIA 2JL1A 3JQCA 5L51A 5EERA 4C4OA 4J1TA 1RKXA 3SJUA 3VPGA 2D8AA 2X5JO 4W9NC 1N9GB 2O3RA 2Y05A 4HV4A 3RKRA 1ZIDA 3BTUA 3PQEA 5KKCA 4RVSA 4CV0A 1B15A 5IAAA 1SAYA 1PJ3A 1Z7BA 1T25A 5EQFA 1TA4A 1B26A 1XKQA 3WGTA 2IDZA 2CF5A 1SEVA 2JD0A 1ML3A 3BTSA 5EPOA 3Q0EA 5LCXA 1X7HA 5LDGA 3PP8A 1T4BA 3JYPA 4TZKA 2O4UX 1PZFA 2D5CA 1H6AA 6LDHA 3AM4A 3EZYA 3HDQA 3EMKA 1VI2A 2J3HA 4BS9A 3PEFA 1EVJA 4K9DA 4CMJA 2BFAA 5IZCC 2GZ3A 5G4KB 2IE0A 3UFXA 4CMKA 1WAMA 1I5RA 4U8GA 3SX2A 2CUKA 5HTOA 2RCYA 4BNLA 3INTA 4KOAA 3JQ6A 4CMHA 1FXSA 5L4LA 3G49A 2FSVA 4BIIA 2V6FA 4HFJA 1UXKA 3INGA 2Y99A 1N7GA 2PY6A 1ISJA 1ZK4A 3BXXA 3VPHA 5CEFA 4FD3A 4PG7A 5CDUA 3OBBA 4IINA 4OH1A 1PTJA 3ST7A 4KTVE 2ZCUA 4AJHA 3IJRA 1VL0A 1WDLA 3R3JA 4AVYA 1PJCA 3D3EA 3E1KA 4DBZA 2UYYA 4I5EA 2D3TA 3PHGA 4DGSA 1HE5A 4MP6A 3RUDA 5H81A 5JCXA 4GSLA 3TZHA 4BNKA 4E5MA 3AM3A 3HUDA 4BGIA 4ILKA 5KNLA 4I9UA 3RI3A 4CR7A 4LSMA 1ZBQA 3ANNA 1XG5A 3T4XA 4E5NA 1VPDA 5F21A 1ZO8A 2IRWA 3PHIA 4FW8A 4LISA 4MVJF 5AXDA 3QWIA 4F46A 3E18A 1K5HA 2AQIA 3ENKA 3WBFA 5A9TA 1AHIA 1AXEA 3GZNB 2NQTA 5I9LA 4OL9A 1CEQA 1DIHA 3FNHA 3TN7A 4YAGA 1GPJA 4WNCA 4DPLA 3C7AA 4H3VA 2BH9A 3H3FA 4IDGA 2YHIB 4RQTA 3LC2O 1UXGA 1JWBB 3ITKA 3KBOA 1OC4A 1ID1A 3P2OA 3PZRA 3K96A 4PLZA 3GN1A 1AN9A 1ISGA 3V2GA 4CLHA 1B8UA 1HDRA 1M66A 4CM4B 3AOEA 3GAFA 1PZEA 1NHGA 3TFOA 2VRCA 3GF4A 4OQYA 3NTRA 4K6FA 4O1MA 3V2HA 1R16A 1GY8A 3EZLA 1EQ2A 1PJTA 2X22A 4J1SA 4KTTE 1Z45A 1SZJG 4WGGA 2XPCA 4CMIA 3BZUA 5EQDA 4Q3DA 1BDBA 4KWHA 1YDWA 3ZWCA 3F46A 1CQIA 1PZGA 1CYDA 4DQUA 5JDCC 3DAGA 5H83A 1I3LA 4YT4A 2X4GA 1GUYA 4L9RA 5G0VA 4CL8A 4KUGA 3WQQA 1IOLA 4EYEA 3GGOA 2HKIA 2IYOA 3DTYA 2ZB3A 4Z9YA 2NV6A 2YUTA 4A73A 1IUKA 4DXHA 2P9CA 3UCFA 1BDMA 3R0IA 4WNIA 4JP2A 1ZK1A 2DKNA 3WGHA 3GHYA 4WK6A 2C2XA 3DQPA 1GV1A 3QY9A 2OO5A 3UKOA 2EG9A 4P38A 2C7GA 4XEHA 3ZU3A 4CM8A 5CDTA 3JQAA 3FNGA 1O9BA 4J0FA 3KXDA 3OFSA 4HFMA 5DOVA 1Z82A 1Y5RA 3VH2A 1F12A 1E6EA 2VYVD 3DC2A 5EINA 4EZBA 5TC4A 2UVDA 1DHRA 2Z1NA 3I6QA 1A27A 3V2UA 3ZV5A 1D8AA 3OIDA 4ND4A 4C7JA 3WIEA 2UAGA 1EK5A 4GMFA 4GLOA 5KJFA 4K26A 3E48A 4OO3A 3U4HA 2Q46A 3VC7A 3IP1A 4HNHA 4R5HA 1KVRA 4B4UA 4Z3DA 1B2LA 3FN4A 4EUEA 5DNAA 1EBFA 1ZMOA 1N1GA 4F45A 5ICSA 1LTHR 3PLNA 1GD1O 5ADHA 5DULA 5ES3A 1OAAA 3BMNA 1DC4A 3GMSA 4PG6A 1KC1A 4CV1A 3BMOB 2ZTUA 1YL6A 3VVBA 5A1TA 5KVCA 4XJSA 3A4VA 4ALMA 3GVXA 5BR7A 3NV9A 1DRUA 1UDCA 4XRRA 4IDEA 1D4FA 3JQFA 4LGVA 2ZYAA 3I1JA 2VZ8A 3ORFA 2HQ1A 4XGKA 1U8XX 4MP8A 1DEHA 3VPXA 4CUKA 1UJMA 2X6TA 4BKUA 2CNBA 3W4JA 1Y9AA 3RD5A 4JQCA 3JYLA 2FRDA 4E31A 4J6FA 2G5CA 1JAYA 2UUOA 3GHHA 3H3JA 4XYBA 3PQDA 2PWZA 1MC5A 3GC6A 4WPGA 4BGUA 1ARZA 3D4OA 4TVOA 1ULUA 2C54A 4IIUA 4QX6A 3CPSA 4UUOA 1LLQA 5EIOA 5KJ6A 5JAQA 4M87A 1GADO 5F1KA 5IZ4A 4UULA 4C7KA 3K2BA 3EDMA 1YB1A 2OBNA 4YYZA 4IGEA 4I9HA 2VUTA 3D4PA 4D3SA 2FZWA 4CLOB 4PLHA 4L76A 4WCFB 3VH3A 2VQ3A 3D3WA 4OM8A 1PEDA 2J5KA 3GGPA 4KDEA 1TVEA 3GN2A 3QRWA 3CTMA 2G76A 2WE7A 1YL7A 5L9AA 4P4GA 4D3DA 5COAA 4CV3A 4KMSA 1HDOA 3CE6A 4CJXA 1MLDA 1E92A 4Y67A 2VCYA 3FWNA 3JQ7B 3RIHA 3UW3A 4CLXA 4PG8A 2WD7A 3ZZNA 4CLDA 3U49A 4LN1A 1QKIA 2Q49A 4DUPA 2ZIZA 4GWGA 1C1XB 4A10A 3S2FA 4YR9A 1PS9A 1Y5MA 3ANLA 1U2GA 1C14A 2I6TA 4J43A 2NVUA 4L74A 4XYMA 4ZVVA 3Q2IA 5JE8A 4NG5A 1QG6A 4J1NA 1Y8QA 2IZ1A 1EK6A 2PD3A 5JCJD 1TB4A 2WYWA 3QW2A 3MJVA 2YYYA 1C3VA 3PWSA 4PZCA 4EBFA 4LW8A 4XR4A 1CRWG 4GGOA 4OOFA 2NQ8A 2Y1DA 1X1EA 1PQPA 3O8QB 1DFHA 3SVTA 4D46A 3CEAA 1WZIA 3PRJA 1QV6A 2CVOA 1PWZA 3V5NA 4BMNA 3OJ0A 5KKAA 4W7IA 1G0OA 3CINA 3DAFA 3LVFO 4LK3A 4BNNA 4ZU3A 2NU9A 3DZKA 4DLAA 2ZK7A 4QTZA 1B7GO 2CF6A 4PRKA 2YW9A 5KIAA 4FFRA 3D0OA 1J4AA 1P45A 1YQGA 5F3RA 1N2SA 1BXKA 4OMUA 4U6SA 4DC0A 5EL0A 3DZFA 1I2ZA 2YFQA 3H2SA 3PDUA 5IFLA 4BNWA 3CXRA 4PVDA 1R0LA 1JQBA 4RVHA 3ZWYA 5JO9A 4DL9A 3LT0A 4B8ZA 3PLRA 1EUCA 3UOGA 1LUAA 2O3TA 4J4HA 4FFNA 3DMTC 3IQDB 2GASA 2PKRA 4JK3A 2VYVA 4NBRA 4GVXA 2P2SA 3F5QA 3IMFA 3IS3A 2NM0A 2QRJA 3C1AA 4FBGA 3UUWA 3VPFA 1MG0A 3GY0A 4MKZA 4M54A 3V1UA 4CMGA 2BKAA 1T2DA 3LC1O 2PTGA 1QLHA 1GQQA 4AFNA 1EEHA 5B1YA 2R00A 1GAEO 1GPDG 1K0UA 1YXMA 3NTQA 3G0OA 5GZ3A 5A02A 3EHEA 3AW9A 4HY3A 3VVCA 4E5PA 3UCXA 2YV1A 4PLFA 3WGIA 3PIIA 1HYGA 3ZHYA 1H0KA 4BNZA 4YDRA 1HT0A 2JHGA 4KQXA 2HJRA 4RF3A 1CIVA 5EMHA 3WTCA 3JQGB 4YVFA 4M55A 4NQZA 1YBVA 4ROSA 4DMLA 1BW9A 4NZ9A 3ZWAA 1NVMB 4AJOA 2XF8A 4E32A 5F5NA 2B5VA 1UZMA 4EGFA 1HZZA 4IS3A 4Q39A 2EWMA 3RWBA 1LC0A 3F1KA 3JQBA 3JD4A 1LSJA 5BSFA 3IKTA 3OHSX 1N92A 4H16A 3ASVA 1E1KA 3GGGA 1KEWA 3I6IA 3DBLB 1V3UA 4R54A 5B4UA 5C7IO 3ROPA 2WTBA 1LU9A 2P9EA 5FFFA 4TVBA 4WCDA 1N1EA 1LDMA 2ZQYA 3IUPA 3VHRA 4F3YA 3IC5A 1E77A 2FMUA 3RUCA 3WMXA 4XGNA 4I08A 1WW8A 4Q3CA 3H2ZA 5JXWA 4A27A 5GZ1A 3GNTA 4L0QA 1E7QA 3I9JA 4UUPA 1PJBA 3RC9A 4LMPA 4G81A 5DT9A 1PIWA 2W2KB 3GAZA 2VWHA 3NRCA 1XYGA 5ILOA 3ZV4A 3OP4A 4CV2A 2XXBA 1MC4A 2CD9A 4NBVA 1ULSA 1CQJA 4BKQA 2VYND 4DA9A 5FI5A 1HETA 3GEGA 3ZU4A 4OOEA 5BT9A 3ZWNA 4TKLA 5L4SA 1RWBA 1E3EA 2Q99A 1A5ZA 1UP6A 1F0YA 4UEJA 1RM3A 4YJDA 4YBZA 1S7CA 3ZNQA 4DQVA 5A4DA 5A9RA 2HLPA 4J7CA 2J6IA 3JQFC 1EVZA 1LDEA 3IDSA 2RIRA 4A03A 2QG4A 1E7WA 4EEXA 3GA0A 3VOSA 4NFYA 1SOWA 1U9JA 3QJ5A 3L9WA 4E4YA 2PGDA 5LDHA 2E48A 2AHRA 3F4LA 4HWKA 1GL3A 1I33A 2IXBA 2NU6A 4Q3NA 1GYPA 1VSVA 1I3MA 3IL2A 5I8WA 3WLFA 1ZEMA 3CH6A 2VWGA 3GK3A 4FFLA 4TRRA 1NAIA 1LC3A 3WWYA 3AI2A 2DC1A 1Q0QA 1XQ1A 2Y1FA 4U0JA 4J2HA 2AEMA 5JDCA 1NR7A 1YL5A 3AWDA 4MIEA 4N7RA 1FF9A 4G65A 1C0PA 3ITDA 3ETEA 1XIVA 1VLLA 4R69A 4B4OA 2HRBA 1V3TA 4BNVA 4J16A 3QSGA 3ONFA 3SLKA 3RJ5A 1KVQA 1NVTA 1DIAA 3GVIA 4L4XA 2EW2A 4CMEC 2GR9A 4FFMA 1HDYA 3W6ZA 2AEFA 5G0SA 1NP3A 1NPTO 1QRRA 2YV2A 3Q9UA 1JWAB 4TZTA 3ZN2A 1CERA 4YQYA 3E9QA 1UAGA 5A3VA 4BNIA 3PIDA 4YT8A 2XOXA 2BGMA 3F1LA 4ITUA 2VTDA 4HP8A 4PLPA 2I76A 3C1OA 4ZA2A 5G0UA 1PGPA 2I5PO 1HKUA 2YDYA 3NUGA 4P4LA 4L75A 4WE3A 1ZK2A 3FNFA 2HMUA 5A9SB 4R1SA 3MOIA 2VWQA 1V6AA 3VDRA 4R1NA 1GQ2A 4UVDA 1EMDA 3RVDA 3FBGA 4U6QA 4JP3A 5HM8A 3CZRA 4BO9A 4ZRMA 4R41A 5CEEA 4N5MA 4WLEA 1NNUA 4CM7A 4WCFC 1YO6A 4W7HA 3DBVO 1C0IA 4Y6RA 2YHUA 2GZ2A 3IP3A 2EKLA 3K2EA 3MJEA 5IJZA 1UDBA 4DVJA 3HG7A 4GVLA 1P0FA 3FPCA 4XGIA 4J2OA 3W1VA 3KZVA 3ADPA 4M8SA 4Z0HO 4BO4A 3DOJA 2HO5A 3DO5A 4PLYA 3AUSA 2LDBA 1TT5A 4ALLA 2C7VA 2QZ9A 2NTVA 3AY3A 1W0CA 1X1TA 4Q9NA 4O0LA 3OH8A 3LK7A 4TRMA 3MWDB 1AUPA 4XIJA 1EDOA 1R4NB 3P2YA 5JC1A 1OMOA 3LSYA 3PFFA 5L3ZA 4RL6A 3RUEA 4MVJG 4H7PA 4IS2A 1RYEA 2X5OA 2DPHA 3MTGA 4NU5A 4YEDA 3WXBA 1WWKA 4ND3A 1LRKA 1T2CA 3NT5A 1NPYA 2W4QA 4BKRA 4QUKA 3T7EA 5G2OA 4LMRA 1CF2O 2Y68A 3SC4A 4BO6A 3JQ7A 4AJJA 1PQUA 4U0KA 4E21A 1Y81A 4J7XA 4DLBA 2AE1A 3AK4A 4E2WA 3KLMX 4YT2A 1NFQA 2FOIA 2FSSA 3GRPA 4J4TA 2B0JA 4E12A 1UDAA 5HS4A 4MP3A 4FN4A 1QYWA 1BG6A 3TPCA 2PLAA 3HDYA 5I7VA 1E5LA 1R4NA 4B7XA 1BSVA 1MV8A 3DONA 2I66A 1KEPA 1CETA 2TMDA 2E37A 3TL3A 3ANMA 4J7UA 3JQ8A 3ULKA 5CEJA 2ZYDA 5BSHA 1DIRA 4OAQA 4RGBA 3PYMA 3AU9A 4WECA 2PZKA 2B4RO 2DT5A 1C0LA 3BHIA 3BTOA 1GUFA 4RORA 3K92A 1MFPA 4JIGA 2IYPA 3KSZO 3GLQA 5C37A 5KJ1A 2Y1GA 2I3AA 3F9IA 4YWJA 4B8WA 5KJCA 1HE4A 1JTVA 3WWZA 1ISMA 1NQAO 2J5RA 3PYLA 8ADHA 3RU9A 4H15A 4P8RA 1HLDA 4WLFA 1A72A 3ENNA 4IXWA 5L45A 3WDSA 5CDYA 1GU7A 3TDKA 1LXCA 2OP1A 1AHHA 4BNMA 3UGKA 4A5OA 1N8KA 2O23A 4NFSA 3IJPA 3O26A 3ZU2A 3C7CB 5GZ6A 1YJ8A 3WSVA 4YJGA 2NU8A 1P1RA 1KC3A 4AJNA 3HN7A 4WLNA 1W6UA 3QVSA 1A7KA 1I0ZA 2GYYA 4CMIB 5A3JA 1T2EA 4D41A 3K5PA 1H6CA 2A4KA 2QRLA 3KO8A 2TMGA 1LQUA 4XX0A 1NX6A 2WD8A 4NFHA 4AL4A 4XQGA 3M6IA 4FB5A 1ISIA 2X0IA 1EUZA 3QVOA 1HXHA 4IJKA 4DMMA 1JKIA 5TLSA 4J0EA 3WYBA 1E7YA 4FIZA 2DTEA 5U4QA 3GUCA 1UXIA 4HBGA 4YJHB 3KUXA 2CSUA 1UXHA 3PJGA 4CL3A 2GN9A 3MEQA 3UN1A 3JD2A 4EDFA 1Y7TA 1ONNA 3PK0A 1SC6A 4MO2A 3PGJA 3COSA 4AG3A 4FCCA 4D3FA 3CMMA 2EF1A 1T2FA 1GUZA 4CM3A 3N74A 3VZRA 1E6WA 3DMTA 2BGKA 4EW6A 5IDQA 4OJNA 3DB2A 3RFXA 1B3BA 4N5LA 3WJ7A 3OF2A 1HRDA 1XWFA 2GCGA 5IDWA 4EUFA 2AEJA 3L77A 1BVUA 1AXGA 2HMTA 1KEUA 3H5NA 3OMLA 1E1NA 4W9NA 3WNVA 4ALNA 1XCBA 4AJKA 1HDGO 1NVGA 3CMCO 3GPDG 3HFSA 4MINA 2VHWA 4R68A 5A04A 3MJ4A 4CQLA 1KOLA 4YJFB 1DRVA 5T8KC 1Z6ZA 2J3JA 3ZWWA 3QE3A 3H8VA 4RZHA 5HA5A 1XDWA 1E3JA 5TGDA 1QYVA 1ZZEA 3QWBA 5JBIA 4XA8A 2NTJA 3DTTA 4MVJI 3RC7A 2GNAA 4BL5A 4R9RA 4RZIA 3O8QA 5DP1A 3BMNB 1LX6A 1YGYA 2ET6A 3RBVA 4QO8A 1ONPA 5A05A 3TOXA 3OA0A 4OXYA 4QQRA 2BRUA 1X13A 1MUUA 2AA3A 1Z7EA 2B69A 2NVBA 4RDIA 4YA6A 1E3SA 4MVJP 1ZKMA 2D2IA 2CMDA 3ZNOA 3DXFA 3MJTA 2PKQP 4KZPA 3CKYA 2C0CA 3O4RA 3PDJA 1DOHA 3TQHA 1DIBA 5DBGA 1U3VA 1AE1A 1SBYA 3OSUA 3WGGA 4IJWA 1NYTA 5JFOA 3GVPA 1DAOA 4RVFA 5CPFA 8LDHA 1KVUA 2NNLD 3JQAD 1DSSG 3NJ4A 1IL0A 1UP4A 1VJ0A 3AU8A 4J3FA 4CQMB 1M67A 3WS7A 3OEWA 3WLEA 3HSKA 1Y8RB 4CM9D 4AJ1A 1FDSA 5JLAA 5T5QA 1IHXA 1U4SA 2O50A 1PQWA 2VHYA 3OQ6A 2NLOA 2Y1EA 3DBRB 3KYDB 4BGEA 2A92A 3G1UA 2G17A 3QIVA 4TROA 1I2CA 1VJ1A 2H6EA 5ENDA 2BMAA 3ETDA 3FHLA 2GN6A 3B20A 3U4CA 1M6WA 4XRGA 1PR9A 3L4BC 2V6GA 4L73A 4D0SA 2NADA 3JD1A 4BQPA 3DZJA 5I7FA 4QXMA 3JV7A 1SOVA 3V1YA 1K2WA 3D3WB 1X14A 4YRDA 1P1HA 3SEFA 2X58A 3BMQB 4QT0A 1NASA 4PLTA 5CDSA 1DPGA 2DM6A 2H1SA 2HU2A 4NR0A 4YCAA 3N7UA 4PZDA 5FEUA 5FI3A 1P74A 5ICMA 1HL3A 3KYCB 2J3IA 4FPXA 1E3WA 4JN6B 4BNGA 4XZ3A 9LDBA 2G82A 1IYZA 4YAEA 3AUTA 4XCVA 3AUAA 2WSBA 2YFHA 3AOGA 3HJAA 4DPMA 5C7LO 1DXYA 3GVHA 1GYRA 2C5AA 4WLUA 4DREA 2WM3A 3NX4A 2GRAA 4D44A 3WGOA 1RM5A 4KP7A 4WLOA 3ROQA 1GCOA 4XB2A 1XHLA 3JQBC 4TKMA 4HX5A 1IHYA 1NQTA 2O7SA 2JD1A 5IXYA 1YONA 4YPOA 2J5QA 1BXGB 3C8MA 1LDNA 4O5OA 4BV9A 2Q1UA 5IN4A 3E9MA 2VOEA 3MTJA 4U7WA 4O63O 1C1DB 3WNQA 2ZTLA 3STHA 2B36A 2VRCD 2O2YA 4CLRB 3QVWA 3C3XA 4OYRA 5B4TA 2BFOA 3WYEA 3M2PA 5ITVA 4FJ2A 5MDHA 2QYSA 4PZEA 1R4MA 1T24A 3PHJA 4DQXA 1KY5A 3L6OO 4IJVA 2EHDA 1VM6A 1YS4A 5BSEA 3ZH2A 4YAKA 3WR5A 4EI2A 3GEMA 4BMVA 2Q2QA 1NXQA 5TIIA 4ZQGA 2WDZA 3HB5X 1PGNA 3Q1LA 1L1FA 1X7GA 1JVSA 4QFDA 4XD2A 3T4EA 1W4ZA 2VHVA 2VN8A 4EJ0A 4RPHA 3AI3A 3EVTA 3G79A 2EXXA 4KWIA 4HNGA 4CLRA 4LVCA 1GV0A 4XDZA 2C29D 4CUZA 1UP7A 4M49A 3GQVA 4J91A 4W82A 2VNSA 1E5QA 3H65A 3TOZA 4TRJA 1TT5B 5JAIA 4UVHA 1H94A 1KS9A 4XQCA 5G4KA 2FP4A 4L4SA 3VZSA 1B3RA 1WP4A 3PJEA 1DC3A 1SMKA 3WFIA 3AY7A 1MB4A 3ADOA 2W8ZA 1R15A 3OJLA 3ZGYA 2GPTA 2CDBA 4YAIA 2VHZA 4NIMA 1GDHA 4LVUA 4NK5A 1U3WA 4R3NA 4RPJA 1KYQA 1FDWA 2B35A 3ZWBA 1KY4A 2DBVO 3DOOA 3QWFA 3NYWA 1YOVA 2JKVA 5TRTA 4TSKA 5BSGA 4GH5A 2NTNA 3FF4A 2F00A 5U1PA 3VZQA 2UUPA 4DLLA 1LSUA 1EVYA 3D7LA 5CDGA 1PR3A 3UXYA 4PLVA 3A1NA 2QYTA 4XJTA 1U7TA 5HBRA 4BNHA 4KUEA 2ZATA 1DRWA 4TMFA 1V0JA 1ENZA 3EVNA 5TT0A 2FR0A 1EQUA 4DBVO 2DFDA 2Y1OA 3VKVA 4BMSA 5T64A 9LDTA 4CR8A 4JBGA 3I4CA 4FGSA 3LC7O 1LDBA 3ICCA 3OQ1A 2Z95A 2VT3A 3MWEB 2RAFA 3LYLA 3QWHA 1T1RA 1S6YA 5CG2A 2OHXA 2BELA 3I9KA 3SBOA 1ISFA 2Z1MA 4MVJM 4ZJUA 3TZ6A 1T2AA 5KVSA 1O94A 1A4UA 3U4DA 3WYCA 4E0BA 1NFFA 4OKNA 6ADHA 1MFZA 4D7AA 2RH4A 2V7PA 3OETA 4NMHA 1A4IA 3ON5A 4ID9A 1HF3A 4BOYA 1XU9A 3GRKA 5COBA 1JW9B 1Z74A 3DZHA 4GWKA 2QZZA 3QP9A 4RPGA 2Q4BA 3E82A 1I3NA 2DQ4A 3ASUA 2O3SA 1LLCA 3HQ4O 3FSRA 3ZI0A 2DUWA 1QYDA 1IZ9A 1U5CA 4DC1A 2FHSA 2QQ5A 2YHIA 1T4DA 1JU9A 1AGNA 3GZ4A 4E30A 4CM9A 2DBQA 4CM1A 1ZSVA 5IN5A 2P5YA 2A35A 4M1QA 1X7DA 3DL2A 3RSHA 1FDUA 2D1YA 2HMSA 4HUJA 4YRAA 1WZEA 1ZK0A 4OXNA 3I5MA 2GLXA 1ISHA 1TI7A 4GSKA 5ITWA 4OQZA 3DHYA 3K31A 3HZZA 1LLDA 2EEZA 3WOHA 3GDFA 3WX0A 3ZV6A 2E49A 3K8ZA 2JHFA 2WEKA 3UH1A 4JGBA 3X2EA 4BNUA 2Y93A 2X1HA 2I3GA 3ZWXA 3DBHB 1NM5A 4YAJA 5AXAA 1B16A 1I32A 1LQTA 5DZSA 4OHUA 3GDGA 5TJHA 1P33A 2ZJ1A 1Q7BA 3HWRA 2JCVA 2GN8A 3EK2A 2JFGA 5L53A 5TT1A 3DFUA 1JKFA 2QIOA 5LC1A 2Y1CA 1GEEA 3LT4A 1EE2A 3KTDA 1GQYA 3OECA 4XDYA 3JYOA 1BVRA 3EGOA 4OIMA 1WVGA 3GMDA 1Q0HA 3I52A 2O4CA 4II2A 4FDAA 3HFGA 1H2HA 4HKTA 4BO3A 1IY8A 3RU7A 2GUGA 5C5IA 3R6DA 2DPGA 2FWMX 3NGXA 1HZJA 4X54A 3HADA 1DIGA 5JSFA 4GKVA 3JQAB 3QVXA 2DVMA 4XB1A 4QO7A 3L4SO 1YWGO 1Q1NA 2AG8A 4XYGA 3KSUA 3HDHA 1V3VA 1O89A 2AQHA 3DZIA 4J1QA 4LRSB 5TF4A 3NGLA 4BB6A 3KLPX 5F5LA 1VKNA 1E7MA 4RVDA 4YT5A 3VZPA 4FJ0A 1Y8QB 2D4AA 2PV7A 1XA0A 3JTMA 2HJSA 2JJYA 2W90A 2HAEA 3BMCB 1HDZA 3RCBA 4UEKA 3ETGA 2OOSA 4FJ1A 3DHEA 3A14A 3BAZA 5ENVA 3S2GA 3F4BA 2CDCA 3GZNA 4S3MA 4FGWA 4R51A 4QSMA 4YJGB 4PN3A 5BQFA 1VL8A 2PGJA 3JSAA 2CZCA 1X15A 4GBJA 4Y8VA 2EJVA 4Z3KA 4MJLA 4WLVA 3L07A 4J90A 4XYEA 4E5KA 3DBRA 1PSDA 2VT2A 4FS3A 3EW7A 4BVAA 4PGFA 3C85A 3ZW9A 3L9XA 3PHHA 3E03A 3RUHA 3WGZA 1F17A 3H9UA 3RBZA 2PZMA 3FPLA 4IDDA 4ZGWA 1GZ3A 3LDHA 2JCYA 5T57A 4CM4A 3NKLA 3B1KA 4NDNE 1P0CA 3KSDO 1J0XO 2X9NA 1E3IA 3NAQA 1HYEA 1RM0A 1SB8A 1VSUA 3I83A 2ZTVA 3LLSA 4Y9DA 3RKUA 3UF0A 1UZNA 3NJ8A 5IDYA 3W8FA 1I3KA 3ZHBA 5L95A 3GOHA 1OI7A 2V6BA 1XQ6A 3TZQA 4DIBA 5JAMA 1D1SA 1FJHA 2DBZA 2IEDA 2I67A 1I2BA 3TFQA 2OORA 1LJ8A 4NBTA 3GNSA 5EJ2A 4FR5A 3GNQA 1GR0A 1U3TA 2XXJA 1N7HA 2ZCVA 3F6YA 4OSPA 3LLVA 4WCFA 3H6KA 5T6BA 1CDOA 2EP7A 2Y0EA 2HK8A 3ZNNA 2GDZA 3PTZA 4R1TA 2R00C 1PJSA 4JROA 2YY7A 3I4FA 1DFIA 3P7MA 1Z75A 3FCOA 1RPNA 1OOEA 3H4VA 4WASA 1C1DA 1IE3A 4GLLA 1ZH8A 3H5AA 3DAPA 1VL6A 2BFMA 2JD2A 2EGHA 4PLGA 4CMCA 1OFGA 4CM8B 1HYHA 5IZCA 5IF3A 1O6ZA 1ZCJA 4JJIA 3WGYA 2HCTA 2O3UA 2Q2WA 5L4NA 5K6AA 3B1FA 3RC2A 3L0DA 4IQ8A 2DTDA 4FOSA 3GT0A 4M89A 2YDXA 4QEDA 1K89A 3AOEC 4WUVA 1UH5A 3U9LA 1E1MA 5F1OA 1ZNQO 4YB8A 2PD4A 2Y67A 2X9VA 1EZ4A 4Z9XA 4E2XA 3OM9A 1FK8A 1PGOA 4RF4A 1HSOA 3WFJA 4NPCA 5B4VA 1P3DA 4BHTA 1DC5A 4PRLA 4E3ZA 3Q2KA 4XYLA 1O95A 1E7SA 3BHJA 4RLSA 1QXSA 3LZ6A 4IQ0A 5BNFA 4BB5A 5A06A 3JQDA 4I1IA 5ILGA 1PL7A 3ZW8A 2VHXA 1XSEA 2BI8A 1H9AA 1ONOA 2HK7A 2ZB7A 1K6IA 1WDKA 1KIFA 1HTBA 3IKVA 4J9VA 1FMCA 2GZ1A 5MGBA 1BTOA 3GVCA 3FBTA 4D42A 5IXSA 2OMEA 2EIHA 2NU7A 2PH3A 4FC7A 3PWKA 2OXIA 5IG2A 5L40A 2FN7A 5DCWA 3UICA 3O03A 4PG5A 1NPDA 1ZVMA 3KOUA 1O0SA 1LDYA 3U3XA 3KETA 5DBIA 4DIFA 4DYVA 1DO8A 2RHRA 4WEOA 4CQLB 3E6AA 3H9GA 1TEHA 2I9PA 2DUUA 4I5DA 5TS3A 2Y66A 4F6LA 4IPTA 1IULA 3S8MA 1F14A 1T1SA 5CAEA 1L7EA 1FDVA 2YJZA 2Y0DA 3PJDA 4E6PA 4NK4A 5CG1A 4KDFA 4UUMA 3WGQA 1W8DA 3D64A 3L6DA 3C24A 4LRTB 1NQOA 4G2NA 3RROA 5DCYA 2OP0A 4Z0TA 4BQRA 3HE3A 5KVVA 2DTXA 4R01A 3FWZA 4ND1A 5KCZA 3HDJA 4B79A 1PL8A 2YZ7A 4U5QA 3K73O 1SPXA 2WJPA 2Q3EA 1ZEJA 1YBMA 1YB5A 4E33A 4DWVA 5AVOA 1Q2XA 2C2YA 1ZMTA 2Z5LA 4LCJA 5T8KA 5A5FA 2PFGA 1P1IA 3BTVA 3WB9A 5I7SA 4NH4A 2P4QA 4GKBA 2VNAA 3H9EO 3MCVA 1PJQA 1E3LA 2EKPA 2BLLA 3LQFA 2W2LD 5L7TA 3GG9A 3VH4A 1HE3A
chains in the Genus database with same CATH superfamily
1ZN2A 2FWIA 4CI0B 3DJYA 2QV0A 2XTNA 4LDQA 3NBXX 1F8FA 1T8PA 3D8UA 4AU1A 4HJXA 4B8YA 1JWLA 4B3GA 2GD6A 2ZAIA 4E13A 4FFOA 4GQBA 4ZEWA 2GN0A 4MW4A 1CV2A 4X94A 5KAPA 1U7HA 3FZYA 4DQDA 2DCUA 5IWAB 1FYDA 2OLJA 5E6RA 5EWJA 1K8QA 4FYWA 3OHPA 4DCVA 4C4TA 3OQNA 1AUOA 1NQUA 4Y1RB 4QBHA 2H5LA 3W90A 7ADHA 4KQCA 2CFIA 1MABA 5C31A 3EAQA 4Q21A 1TUBB 1WTAA 3SOPA 2YQ4A 1WW3A 2FZKA 3A9UA 4E3WA 1K86A 1VPWA 3D6JA 2FW8A 3KRTA 2GA8A 3O83A 4BO2A 3OZBA 3HKBB 1Z0AA 1E2JA 1H9BA 1YUMA 2HIMA 4D9KA 4XCXA 2O20A 2WNHA 3E2PA 1Z4IA 1NVFA 1CY0A 1VMDA 3ZD6A 1Z5WA 3FPEA 1BXZA 5E0KB 2BONA 3V4VB 3WO1A 4RY2A 2CUTA 5FDFA 4FIDA 4IMJB 4K9MA 4FB4A 1DLIA 1GLNA 2CEAA 2REQB 3QTBA 5DXJA 4ASUD 4B4WA 2G70A 3VOBA 5I47A 5CB8A 3K0FB 3SSOA 5ED4A 3JD3A 5DSTA 2OWEA 3FR7A 4EG0A 3LWZA 4D5EA 4KJXA 5LMCA 2C5EA 4FYKA 3LP5A 3SZRA 1IAVA 3KQYA 1YK1A 4N5NA 4MYRA 5FHQA 3GFTA 3RVPA 4B32A 1AV7A 1QZ3A 5AQ1A 5AVUA 3FRJA 1JA0A 2O2XA 4JJFA 3DLTA 3CVOA 2P5SA 5LZ8A 3BIOA 1GDTA 1R12A 3EIEA 1GCUA 1NI4B 1VRWA 2ZU0C 1CJMA 3FJ1A 2YJ5A 3C2QA 4AIIA 1ADGA 4CQMD 1IWOA 1TRHA 4NEQA 4GKJB 1WF3A 5D00A 1KAEA 1WDMA 1YQEA 4PBRA 2Q4EA 3BGWA 4N6NA 1SIWA 3H5TA 2QL6A 2IPOA 3LVQE 4IOMA 3QOFA 4B6RA 2HK9A 4B5KA 2OWDA 2LP4Y 3DV0A 3SFTA 2V0GA 1ZD1A 1O8CA 1G98A 1GPAA 3TQQA 2HMVA 4ZCPA 1LSSA 2BF7A 5LJIA 3PSHA 4URFA 2QU8A 2HRZA 4MJ7A 1YIDA 3L05A 2IWRA 1M0WA 4RVNA 2ORED 2WUDA 3CBQA 3HB1A 4KIFA 1AQLA 1ZGAA 2B4QA 1GQRA 3MRTA 5BRJA 3ZR4B 4QXQA 3U4MA 1TU0A 1NZDA 3NTOA 5AXCA 3VVMA 2NWQA 5EE0A 5FORA 3VTFA 4F3KA 1D0SA 4IIJF 1GL6A 1R4ZA 2HBZA 2O2CA 3DYIA 3BA1A 4IWYA 1EEXB 2M6KA 1E0DA 1XQXA 3A9WA 3IO5A 4QULA 4WY8A 5BVHB 2JAUA 1OX6A 2IYXA 4M2LA 2QF7A 5BVGB 3M1YA 1OC2A 4PQRA 4CG1A 3HVUA 3VR3A 3JAKA 3CPJB 2I6SA 3IBCA 3TOSA 1CS4C 2ODQA 4MMZB 4ACBA 2NUAA 1KMNA 3CJTA 1NM5C 3ZQKA 2QL5A 3OT5A 4Y3UA 2JLAA 4E2FA 1SWVA 5P21A 3VZCA 4BMOB 8GPBA 5KYUB 3L7IA 1QP8A 4A2CA 5AD1A 2JGAA 3ZDFA 5AJHA 1SUPA 3DEJA 4B81A 1DC6A 1PR0A 3H1TA 1FFEA 5GGXA 3TLCA 5CBKA 1OASA 4PLWA 4D6YA 3EZ9A 4RK1A 3FCEA 4TLCA 1ULBA 3E5MA 1RJ9B 1UANA 4EAQA 3CCBA 3HJTA 3NDIA 1B42A 3P71T 4GZ6A 1R2QA 3GFBA 3N76A 5LMUB 3VKHA 2F64A 2DHEA 1NBIA 1RMQA 2JVJA 2JW5A 4RLHA 4E88A 4IKEA 1GFSA 3BVPA 2NZVG 2GKGA 1KYIA 3CISA 2FEMA 4WUTA 2FWNA 3AEYA 1NZFA 2HMWA 2IEBA 5EZ5A 2XR1A 3ZCSA 5AXBA 3O9VA 3PEEA 4W6ZA 3RPEA 2QP4A 3G2JA 2O0KA 2D5AA 3ZG6A 5FQNA 4B83A 2DUNA 2YZMA 1KJWA 1TM7E 4BO7A 3QEMA 1M6YA 1OV4A 1E6LA 1RAGA 5DF1A 1SELA 3SJAA 3LZCA 1CQJB 2Q45A 3SPXA 1O96A 1BOFA 4TZ0A 3LNCA 3WIDA 1XLTA 1Z0UA 4G4SP 4V0QA 1NVDA 3QM1A 3B9BA 3IV6A 4RXUA 3PVZA 3OZAA 2H29A 3X1DA 4D79A 4YY3B 2PGAA 4RV9A 3PQFA 1NDUA 1OA1A 4KG7A 2X1VA 2LXNA 4ZHQF 3N28A 3R7SA 1XJ5A 2IYUA 5LKRA 3ZDXB 2K7ZA 1QS0A 3A7EA 1YCGA 5H82A 4L5IA 3KKQA 1YQXA 1QYCA 1QKJA 2RHCA 5K8LA 4LYJA 3EZ7A 3VNRA 2I65A 5EJ6A 1O08A 4DT1A 3K1JA 2ZJ0A 2PXHA 3D02A 3B1WA 1H4VB 1KH1A 3I8OA 3ZQ6A 2H57A 3RBXA 4GI1A 3WI7A 1F2DA 2YXLA 1C50A 3HJFA 2BIFA 5GWXA 3Q7EA 4P0PB 1TF5A 1Q50A 4LQ4A 3JQEA 1RZVA 5TX7A 2GO7A 2OD9A 2NO0A 2QLJA 2ZRKA 3E7WA 2AD5A 3H0CA 4HPXB 5LQCA 1IM5A 3KHUA 4C4PA 2QYOA 2XDYA 4EJMA 3FX2A 4F9GA 5KOYA 2P78A 4ZVOA 3GJQA 3GG2A 3T5GA 4AS1A 3OCWA 4FZJA 1IJKA 4II3A 2NO9A 1AGPA 3LNTA 4BLUA 4LY9A 5IJAA 3I5AA 3WMEA 3Q88A 1P0MA 2D1RA 4HEHA 4MIOA 4Q03A 3WP0A 4EL0A 1PFKA 1Z12A 1ZHFA 3OWOA 4E1AA 4M37A 2XBUA 1GPUA 1ZM2A 2VYNA 1NUHA 3BH7A 3HYTA 1U2ZA 3Q9NA 1T2UA 4QOFA 3Q3CA 2OL4A 2GEUA 4REMA 1AO0A 4JT2A 1OKKD 1DHTA 1FDRA 4Q3AA 1CQIB 3I9OA 5AOAA 1QK4A 4HXYA 4AJPA 4BO5A 5JZMA 4KZKA 2EJBA 3VNBA 4B85A 1YE3A 2VPXA 1DAPA 5I01A 1YASA 3K9WA 1XZBA 3K4HA 3BAFA 1JDJA 2DFVA 1CQZA 2G09A 1P8JA 5J4KA 4U63A 2UDPA 1A8QA 4LMBA 1AZTA 4JBHA 4X6XA 4U2GA 3WYFA 4HWOA 2OB1A 4Z0PA 5G4LA 5GONA 4MQEA 1P4HA 1EBUA 4IGFA 1IZYA 3RFVA 4EVSA 3BS4A 3EXG2 3NT2A 1E6UA 2TS1A 4RDXA 1PK8A 3ABIA 2JFXA 3KVYA 2XKKA 2PRKA 4OU5A 4BFWA 2GS9A 3UC9A 3U3RA 2Q2VA 4ZYUA 1HFKA 4Q9AA 4MKIA 1V5EA 2D62A 2X0FA 1ZOOA 5K51A 2BBOA 2IIQA 1SGWA 3VDQA 3SEZA 3B1XA 2HA6A 1U5BB 2VJMA 3F3SA 2I71A 4ND2A 1MKYA 1OLUA 4TYYA 2BFFB 4IVNA 2Y0CA 4TV9A 4B2PA 2QY9A 2Z2YA 3DHVA 3GXOA 4KIJA 5L3QB 3FDFA 2VP5A 1P80A 4ID3A 5IU6A 4HHEA 1LTKA 3BC1A 5CXUA 4MVJH 2NXWA 3LWDA 1OE0A 3CSDA 5IEBA 3H16A 3LHSA 4NXMB 4A1OA 4TN1A 1E7RA 1C3OB 4WOJA 3CM0A 3V46A 3P8ZA 2BEWB 1D3AA 5CLLA 2YWGA 3VZBA 1K7SN 1YIAA 3H4TA 4N0QA 3TVDA 2FMKA 1ADBA 1P7ZA 2WU3A 3BM5A 4Q7LA 1PU2A 1V8FA 3TZKA 2BGRA 4RF5A 4CCWA 2WNSA 1TTQB 4MUGA 1CNMA 1AZSC 1LB1B 3WSWA 3QU4A 2R4QA 2FKAA 4MQMA 3OTHA 1QZUA 1W6RA 2B61A 4RACA 1GZ4A 1M0TA 4L8FA 4TLMB 3RT1A 3HM2A 1XLUA 2QOEA 2EFYA 2P68A 4OBXA 5FEMA 4AWBA 1Y1PA 4BYGA 4GMXA 4WZAA 5C1BA 4MI9A 3QA9A 3KWMA 3HWSA 2A94A 2X0NA 4QBFA 1AURA 1NUUA 1Z83A 1V8ZA 2XHEA 1K8XB 4RHTA 1IWPB 2G36A 1N2BA 4KQ9A 2WK1A 2HDHA 4TM7A 2QR3A 4IJQA 3QU5A 4RPIA 1NBOA 1UBNA 3GR6A 2X14A 1XWWA 3W6OA 1Y3DE 5K0GA 4JEIA 3VX4A 5I9NA 3KJIA 2CEKA 4HFRA 4AXBA 3ISJA 4QGHA 4FEYA 4JBYA 1NBMD 4B4VA 5CD9A 5EJ7A 4K86A 3C3EA 4EJSA 3W5DA 3AF0A 2GM4A 1ORVA 5EE1A 2WU0A 4PG4A 2XQKA 1UDXA 2LIVA 3OZCA 3FETA 1IFXA 4RH1A 3KUDA 1Z5VA 2KB0A 4WNAA 4E70A 3Q5EA 1BMTA 3S81A 1M8PA 3RADC 1D6NA 1E4VA 1V4BA 3JQ8B 3ZWQA 2IS2A 2RGDA 3W4KA 5HOEA 4JJAA 1XK7A 4HB2A 2X2FA 3T7CA 3IKMB 5LZ9A 1TM1E 1M2WA 4JKYA 4Q4HB 1AJEA 1LNQA 2YASA 4C4RA 3RSOA 1PNVA 4ZGGA 1ODKA 4JLWA 5DNEA 3GDOA 4C04A 4CMEA 1DQPA 3CONA 2RI0A 4YALA 2HUPA 5FCDA 3DBIA 5JJIA 5J43A 3SZLA 1NOIA 3KAKA 2G1UA 2O52A 1L9XA 1D2GA 1ZQ1A 2PVCA 2FN3A 1S96A 2W93A 4IZIA 4RL4A 1W5EA 3BEOA 3R20A 1KBQA 2RAPA 4IM7A 1JHUA 5HIJA 4CLOA 3BHMA 3W6UA 1QX3A 3KYBA 3MJFA 3HKEA 4M86A 3VYWA 4LBVA 1X7ZA 5JI3E 3S2UA 4GL2A 4GP7A 4MOWA 1GNQA 3MAAC 3PC4A 1A7AA 2C31A 3I8XA 1NMZA 1DKRA 1OFUX 2ZBRA 4WEQA 4X7PA 1FX1A 2KBEA 3DE4X 1E98A 2HLNA 3D0RA 3WJ1A 5LLDA 4WGFA 2C2HA 1S2OA 3GZJA 2EL9A 3W05A 1HO3A 1JEYA 1WXIA 1E1CB 4FC6A 5JCJA 5EXXA 2HFJA 1IB0A 1ZG3A 3DFZA 4WNYA 4CKBA 1FPMA 1EDZA 3U31A 4XEUA 5I7WA 2AG5A 1Y1TA 1EFPA 5LOVF 1ENYA 2NZ8A 3EGDB 2OUIA 4EENA 4LZOA 2EEPA 1YACA 3D7MA 3RSLA 3C6XA 2PGLA 2WT9A 1X39A 1HDXA 1TCCA 3CNOA 3FOZA 4G36A 4JJ4A 5IYZA 2H7XA 2RH9B 3B1ZA 4B3HA 4NENB 1D1QA 1XZGA 4Z4EA 3CUTA 1X19A 4JNKA 1IBRA 1WPRA 3KVOA 4E2ZA 1F3LA 2FGKA 2LR0A 3KBBA 2H1VA 2QLLA 4H7IA 4QOJA 3C4JA 5ECGC 2NSDA 1L4KA 5AJZA 2R6CA 1CS0A 1N0HA 2GD1O 4J9UE 1CE8A 2AUNA 5FT9A 3E4CA 1NQ5A 2E82A 4OQ4A 4M0UA 2IODA 3L7CA 1IZ8A 1NR1A 2FPIA 2HLDD 2F62A 1IN1A 3NTUA 5LOVB 1D03A 3WBJA 3OD5A 4WH0A 1NE7A 5CFOA 3FUWA 4Q6WA 1VBKA 1Q20A 1EWRA 4GQAA 2Q0QA 3VHXB 1XRSB 2KM1A 3KTAA 5DE3A 3EG5A 4YRKA 3ZY2A 2FOXA 2J3LA 1XGKA 1UAYA 3IV9A 2ZS9A 3KQOA 4HC4A 2R6DA 3VR4A 4DCPA 1Z38A 3G7SA 5JMOA 1YDFA 1NUQA 3K0CA 3CU5A 3UKJA 4PX9A 4ZWNA 3FWYA 1RZ3A 1ENOA 3FOWA 4J49A 3NVAA 3UJ7A 1KORA 4ND8B 4HOYA 4JU8A 4TL7A 3ZXIA 3WG9A 2Q9BA 2QTAA 4QUDA 1T36A 3LF1A 2NUAB 4LF8B 4KE6A 3RAEC 4KGVA 5K0ZA 3PU6A 3D8TA 2WP0A 5DKFA 5TARA 1JT2A 3SAJA 1VTKA 1JKJB 4PVCA 5AIBA 9ATCA 3MAGA 2VF8A 2P90A 1WV1A 5KDDA 1HWYA 2YY5A 4OUKX 1P2DA 4X1YA 5IWCA 1RXEA 1J25A 5HUQA 2H59A 5JYEA 5CT6A 3ZDYB 4QJBA 2QRQA 5ER6A 4AJEA 5C7OO 5KTMA 4K3VA 4CF7A 1HBJA 4XARA 2H4WA 5BMVA 1N3LA 1RM4A 5L7YA 2GOYA 2IDJA 3MNFA 4FSHA 4Z9FA 4NJEB 3RTCA 2GFHA 3D43A 1HEUA 3PF9A 4PPYA 5BSWA 3I23A 4J29A 1G4HA 2JHCA 4GSYA 2B2XA 3Q40A 1J8FA 4D74A 4YCDA 1XPJA 2QVLA 2CKMA 3TRDA 1E66A 5IAJA 2B4TO 4QPJC 1RPJA 1D2HA 2OLKA 3IHLA 4GX1A 3S2EA 3UFBA 4A8PA 4AECA 2ADOA 2R5FA 1LBIA 3HEBA 4YRRA 2C99A 1MHPA 4N18A 3A2NA 3W9SA 2PK3A 4AP5A 2XQVA 4BX0A 1PS8A 2WYUA 1IB6A 5IX8A 4IIVA 1K3TA 4PTLA 2E4AA 3OI7A 2CY0A 4A9AA 4E15A 3L0SA 1Q7TA 4UMDA 3AVPA 3UGTA 3PI7A 1CY6A 5G0WA 5LQUA 2PLFA 1DS6A 4YTEA 1CXZA 1DC8A 2WAOA 2IA5A 2ZSFA 4M9CA 3TWOA 2PSEA 4GU5A 1B0PA 4HN2A 4YLEA 2AOXA 3SNKA 3HL0A 3FDIA 4QHYA 4CMAA 4DE5A 4I5FA 5ICCA 2C3YA 4LI3X 4WN3A 1JZTA 1U0RA 5E3JA 5E4YA 4KJZA 3PGKA 1ZUHA 3O9ZA 5EWMB 3D4NA 3BCSA 5IAEA 1DJQA 1T34A 4OYLA 1E32A 2GN1A 5ESDA 2CVZA 2Y6UA 2ZXUA 2W42A 5GY7A 1JAHA 3DEIA 3FR8A 1HQYE 3HB4X 5JS6A 1PD1A 1KDVA 2FPPA 1KHHA 4MW0A 2BKEA 1HA3A 3I72A 4J0DA 1OLSA 2PZLA 4OATA 4P93A 3JYQA 3WICA 2J1LA 4D43A 1OD6A 1F4PA 5FYDA 2Q5FA 3A4YA 3CN7A 5FPPA 4URVR 3PUJA 2VCHA 4B44A 1W0KD 3DZBA 1UKZA 3S44A 4AWXA 1TLTA 1X7XA 2AXEA 3M82A 1EUQA 4E5VA 1CY4A 2P9GA 1EUDB 4UHBA 2X5KO 1T6YA 3K7EA 4N7JA 2JFHA 1MRNA 1PD0A 2IYYA 1N36B 2XB8A 3ZJTA 5LYJB 2PPVA 4FQ8A 3WWDA 3G5UA 1VSTA 5AOVA 5LP6C 5LZ5A 4EQZA 4TX1A 1DAHA 4BLTA 2WR8A 3V9AA 2VHTA 3I9NA 3JQRA 3WK5A 3ROMA 3ELUA 1VHQA 1V6CA 1WXGA 3KCQA 4F56A 3QBDA 3EMVA 4FEGA 5BOSA 4CEHB 2Q3MA 2VTKA 4WKPA 4DMUB 1R0RE 2W4MA 3ESDA 3NFYA 2ZIXA 3X1WA 2O8FB 1K1EA 1KBOA 1OBOA 1JNYA 3SR3A 3ZZMA 2XCTB 2GILA 2XSZA 1ZH2A 3QQPA 3GEPA 4FOOA 5FPSA 3SQXA 5U9CA 3SKVA 3HO6A 4UOZA 1FTSA 2C07A 4MCHA 1LRJA 1E4EB 1GGNA 3GBVA 2BHLA 3IYLW 1UC5B 4R81A 3ZWDA 1Z2PX 1QH1B 2X0EA 5B3AA 3D1LA 4Y6GB 2HU7A 3HZRA 1AKQA 1NDQA 2PH5A 3AB8A 4HMOA 4RQUA 2RKOA 4WZBA 3E1GA 4F4HA 4W5NA 2PJRA 1DTWB 4YYEA 3AR5A 1T5LA 2JS7A 2WTAA 2XZOA 4S1PA 1FFXA 3N05A 4LRWA 1OF1A 2OV2A 2ANBA 3PFIA 3P4XA 1U0LA 1JU4A 1P6UA 1V39A 2XWBF 3C6KA 4Y0NA 4AX4A 1LPOA 4F3RA 4MXDA 1IY0A 4TTQA 1Z3IX 1PS0A 3QKRB 1VIMA 4EB8A 5J23A 1P73A 4KBGA 4CPDA 3K20A 1I1OA 4EKGA 3NDJA 2H0RA 3DE6X 3K6JA 1R5NA 2JAQA 4DARA 1UM9B 4RQAA 3BICA 3U44A 5CA1A 2WMYA 1GVHA 1T15A 2QT1A 2YJGA 1X0XA 3QV1A 2B1QA 3CRQA 2B3TA 1KIMA 3OQBA 1E6MA 3ZGNA 4B35A 2C0PA 1H2AS 3FVRA 4HAWA 2GK7A 5EYPB 2HRRA 2VRBA 2EKQA 2ZJYA 3WTBA 4LBZA 5FTWA 4EI9A 1JFSA 2ZSJA 4A0GA 2IZZA 1L7MA 3AC0A 3K8OE 3VBEA 3KALA 2EARA 2BEWA 2CXNA 5DISB 2DLDA 1ORTA 3ZNPA 3FLEA 3KVRA 4NBUA 1QPZA 1ECJA 1CEEA 4DWOA 3CC8A 3N8GA 4DLWA 3NAZA 1DJOA 1MENA 2XGGA 3SGLA 4J1TA 3SJUA 4IV8A 4BV3A 1W0JA 4JVOA 3JARB 3OMXA 4C89A 2CD7A 4QEKA 2H31A 4EA7A 4YR7A 3T7TA 2ZRLA 1M2VA 2FWRA 4R1OA 2OK8A 4JI1B 5IAAA 1Q15A 2BL4A 1PJ3A 5F23A 2ZITA 3IAXA 2WUWE 4E30A 5LIRA 2DPLA 5EQFA 1NMXA 4YNBA 2AZDA 5KC8A 3UAZA 2ZAGA 4MQUA 1ZNYA 4LNAA 2MCFA 3Q0EA 1KXJA 2H5EA 2JGLA 1U7PA 1W5AA 2J6BA 1T4BA 3IE0A 3JYPA 3PP8A 2QV7A 4U3JA 4BLSA 1PZFA 1W7AA 5F9FA 1SC1A 4PPGA 3V9PA 3R5XA 4LRUA 2QRPA 2Z6AA 3LQ1A 4I55A 2BBSA 2J3HA 4BWYA 3KIPA 1EUCB 2W5UA 4RWZA 5FPHA 3HXLA 4CMJA 3R0VA 3R7WA 2GZ3A 2J4DA 5G4KB 3MWDA 3TRJA 1V2HE 2QSYA 3A6HA 2DX7A 4M0CA 4B40A 1PEYA 2GM3A 2PS1A 2QRNA 3C16C 4IDQA 2J67A 4ITVA 3MQ2A 1WAMA 4GYKA 4Z86A 4UD2A 4CZ2A 1DCTA 4MWGA 1CFZA 3DXXA 4V0KA 5A0FA 2A33A 3SDBA 2CUKA 5E2AA 3AG6A 3OP1A 3QU2A 3JQ6A 4QOGA 1FXSA 4KFUA 1Q0UA 4M9QA 2J31A 4PPNA 3Q7RA 1Z88A 3NV7A 5F9HA 3ITNA 5FBHA 2VZEA 2ICAA 2QTHA 3DUFA 1Q22A 5CDUA 4HGYA 4PFSA 3G2QA 4TXMA 2YNMA 4IINA 1J2RA 2E4YA 1UBKS 3NC1C 1L6RA 2E85A 2XYQA 4YI3A 4AVYA 2WJVA 3NM4A 3R3JA 1UBRS 1N75A 1QQ7A 2H2GA 1DXOA 2NPOA 4O4HB 2IHYA 4DGSA 1M73E 3CFYA 1YS1X 1RLUA 3G2KA 4KGXA 1XCMA 4MP6A 3RUDA 4BAZA 5JAIA 4BNKA 1UJ6A 2BR5A 3GFVA 5H7XA 5KNLA 2PSJA 4ODIA 4Q12A 1RBZA 2CJWA 4E5NA 1ZUWA 2AYXA 1VPDA 5F21A 1ZO8A 3PHIA 5AXDA 3WVNA 1BX1A 3M4ZA 4AKSA 1T9KA 3B89A 1F8UA 1Y6FA 2YIMA 2YMLA 3QWIA 3L0ZA 2QZPA 4GM1A 3ZK8A 4AZSA 3V8RA 3L4KA 3G68A 2F3QA 2KE5A 3GEEA 3N0RA 2C1ZA 3IXLA 5I9LA 2NQTA 1OZGA 4OL9A 3IUYA 1GPLA 4KPFC 1DIHA 2PX2A 1P0IA 5BWNA 1MB3A 3J81k 4XIIA 1EFHA 2X3UA 4WESA 4Y9TA 5FYQA 3W5IA 2XDAA 1A82A 2FW6A 3E84A 4B0OA 4EF6A 1UWVA 3FDZB 3FF1A 4D3YA 1E1DA 3REOA 3RW9A 1EH5A 5K4HA 1UXGA 2ZJAA 2J32A 3I01A 4YRCA 2GPAA 4RTNA 1DNPA 1Y33E 3ITEA 4FCTA 1MW8X 3HJCA 3HR4A 4D9EA 1J2JA 3IEIA 3K96A 1DQSA 4PLZA 4C21A 4HDRA 1HDRA 3UYKA 5ALUA 4FOLA 3BGOS 1LPPA 3INYA 4NENA 3KTOA 3OE4A 4H27A 1Z56C 3UTDA 5KYGA 3HA5A 1WABA 2GM5A 1QS0B 3QFTA 3V2HA 2XOEA 1EQ2A 3QG5A 4RAOA 1YOBA 4KTTE 1UMBA 2L69A 5JR3A 1SZJG 5JT1A 4WGGA 1A3CA 5DK4A 2WHRA 3EGEA 3ILSA 5EQDA 2BHRA 5WRFA 3TLAA 3AEQA 3ZXYA 3BWEA 1BDBA 1YDWA 3AETA 4O8ZA 4ZVNA 1IU9A 3WXMA 3F46A 3TH5A 1PZGA 4R9UC 1XZ8A 4NZOA 3R5SA 1GP2A 4C0JA 4HVLA 1P0PA 2R96A 5ADVA 2PUJA 3CR8A 1JIIA 2X4GA 3RRNA 3TKAA 4RHYA 4XWKA 5G0VA 2XYHA 4LBYA 4ZVQA 1WTCA 2GYVA 5D5PA 4BQSA 3FKSA 4KUGA 4B87A 1IOLA 3I05A 5BN5B 3F9RA 1WCXA 2H17A 3OG9A 2AUTA 3IHTA 3K0EA 5AKYA 5DLEA 1K4YA 2HKIA 3F97A 5FP0A 5LXTB 3FTEA 2AFIE 2VDQB 3FLBA 4OEHA 1N3IA 1SKYE 3ORQA 1K7CA 2NV6A 4ND8A 3IOCA 2PV0A 2FFQA 1VE1A 4HS9A 4ZPXA 1LQ2A 2H9YA 1OI4A 4AF7A 1C4WA 1T36B 1FNMA 1YR2A 4CKEA 3EF0A 5JWOA 2AJCA 1ZJ6A 2ZW9A 2VJYA 1GV1A 3M9XA 3G8AA 1NY6A 3ODGA 3UKOA 1EFRA 3HJRA 4P38A 5CDTA 4WN9B 3WLJA 3KOYA 1X7YA 1ZMXA 3JQAA 1KA9H 4Z4QA 3AHEA 4DHWA 1NMQA 2A58A 3C1UA 1O9BA 1TK9A 3IUEA 3L8FA 3OFSA 2Y1KA 4OI2A 4YC7A 1DP4A 1HOXA 3HKCA 4RSGA 4ENWA 3TNFA 1RSZA 4CNBA 1YZKA 3P0IA 1DHRA 3FYUB 3LQKA 3V2UA 1QHGA 2A14A 3ZV5A 3RVLA 1PTKA 2I0FA 1ZD9A 5BW4A 4EHBA 4MGKR 4IFBA 3WIEA 5LNK6 2OT3B 4CL2A 4IICA 2C4VA 1BCSB 1KJJA 4CF5A 2J9FA 2WG0A 2WJWA 3UJAA 1KWGA 3VC7A 3IP1A 2E2WA 1YMVA 4R5HA 1KVRA 5LA6A 5CYOA 1K8RA 4RX1A 4S0ZA 5JD4A 5FFMA 1EBFA 1JG1A 4FMCB 1SY7A 2X3FA 2Z4RA 5ADHA 2CWDA 2Q7XA 1VA4A 1WVMA 2JAWA 1C81A 4W1QA 4MV7A 3KSBC 3ZDDA 3PT5A 5A1TA 2JLYA 1YB6A 2D1QA 2KMLA 1AM4D 1DJLA 1RJEA 3GGCA 3B8HA 3A4VA 1CKEA 3D6HA 1FLDA 3P9IA 4ALMA 1QWSA 4ZCIA 2JF0A 4KHZA 4XRRA 5CJ2A 4IDEA 4LGVA 1MPXA 3JQFA 5KDLA 2JGMA 4QUIA 2GLUA 2R8XA 4DABA 3L6BA 3IULA 2GK3A 3A6PC 1ZONA 3BCRA 3ZCUA 3CX4A 2PRJA 3DA8A 3K2QA 2IHVA 4HAXA 4GKAA 3WGJA 4JYZA 1AMNA 1G4UR 2I2FA 1OLSB 4JQCA 1E9EA 3T6KA 3QUQA 4RK5A 1K92A 4J6FA 5JYCA 2OD7A 3OKAA 3QPCA 3G0BA 3ZE2B 5EUMA 3X2SA 3VUFA 3T0FA 4BGUA 1XKTA 3O4JA 1W85B 1FEZA 3ROXA 1M1UA 4MHOA 2Q3BA 3R44A 4H31A 4RD3A 1QIKA 2DEUA 1WS6A 5KJ6A 4HWRA 4I3HA 1JIXA 3Q9LA 2BGNA 4N5HX 1XQVA 3W2HA 4C2BA 4M87A 3FRHA 5EGSA 4C6SA 1YB1A 4HL6A 1GKLA 5A4JA 4DDVA 1F4VA 2EOAA 4PYJA 2WKSA 5BOSB 2I80A 1XMQB 4D3SA 1TCUA 4EECA 3LUKA 4EATA 2JFQA 5UKDA 2IHNA 3VJRA 1NG9A 3A4IA 1LCIA 3TIVA 4WCFB 4G8BA 1VJGA 3D3WA 3NHKA 1DC7A 3G5TA 4I0WB 1PEDA 5ALJA 1U8ZA 2IJGX 4KDEA 4E08A 1TVEA 2P62A 3RVOA 2G76A 2WB4A 4UPDA 5L9AA 3TLYA 5COAA 4ZO8A 1HDOA 1ORWA 3CE6A 3O7WA 4O4IB 4K6HA 5LR6A 4Y67A 3AJEA 4JQZA 5IAOA 4HQ6A 1RE1A 4E22A 3AFOA 1L4NA 1LVGA 2Q49A 4DUPA 4HDMA 4MRMB 2Q9CA 1Z4PX 2IF2A 3I2KA 4TMZA 2REBA 3VR3D 4OBEA 1GG9A 3OAAD 1AK1A 4UNRA 1M2NA 1Y5MA 4M9SA 4XYMA 2NVUA 2HQOA 1EVLA 1Y4ZA 2J0UA 3T4PA 2IY9A 3FPKA 1C7EA 1FDOA 3ZXXA 2G9ZA 1P1CA 2ZPUA 4QVKA 3SHQA 1FFDA 3MJVA 1AKVA 5TVKA 3S2YA 4UNIA 4KR6A 1WHTA 2V74B 1KY2A 1U04A 5DM70 1JA1A 5AT1A 1GGVA 4J03A 3DTVA 5FPKA 4HVAA 3S3TA 1DBRA 5EYPA 3GLFE 1X1EA 1GNVA 3JQPA 3Q5GA 5JQGB 4ABTA 3DFMA 1FXUA 2PS0A 1MTOA 4UM8B 5JAUA 1WZIA 3PRJA 1QV6A 2LUOA 3GJ4A 3AT1A 2PQMA 2CVOA 3K0FA 1QZXA 1LNZA 3OJ0A 3LD9A 4XUCA 2C7QA 1HR0B 2EP8A 1SOMA 3UGQA 3LVFO 1A5SB 3ND7A 4UZSA 3E9CA 4ZU3A 4ZI7A 4EI8A 3I5YA 4DLAA 3RRZA 2PZAA 2XA1A 2WM9B 1JYFA 5HK8A 4QQFA 4ZAVA 1QV9A 3UV7A 1CDDA 4HNUA 1E1RD 4PRKA 5KIAA 2OHFA 1Q74A 1NXTA 1S5PA 1JHRA 2YOGA 1J4AA 3AP1A 1X1QA 4Y2VA 1N2SA 1BXKA 2FVXA 3DLAA 5I4IA 2QPTA 2AOUB 3GIWA 2E5FA 4BLVA 4DC0A 1WA5A 4KWEA 3DZFA 4U3JB 1TZMA 2YFQA 5IFLA 4DSZA 4IX9A 5LD2B 3CXRA 5KWJA 4RY8A 1JDBB 3DVSX 1ECBA 4EY3A 3ZIDA 5FR1A 4B3MB 3ZWYA 5JO9A 3T5BA 4GRAA 3ER8A 13PKA 2RGYA 3KPJA 1CS0B 3LUDA 3LT0A 3DT6A 1EUCA 2XD9A 3PLRA 4QT4A 3BFKA 5IJWA 1O54A 4J4HA 3PUZA 1XVUA 3W3AA 2YXEA 1ZIPA 4JK3A 2AR9A 2FPIB 3B6KA 4JENA 5HF5A 3F5QA 2IS1A 3I09A 2IVFA 1YJBA 4YMWA 1O2DA 4G67A 4AB1A 4JB3A 1VL2A 3JZMA 1F0NA 2VAPA 3DNFA 3V1UA 2C9OA 4NWIA 2BFDA 4QM6A 3HZOA 3OIWA 4Z49A 1U31A 3HWX1 4HQLA 2GXUA 3NHPA 2A67A 3SJCA 1KFKB 4D8TA 1NX9A 1TAQA 2VEDA 3P0FA 1GAEO 1GPDG 4V02A 4GUAA 3VR1A 2W2QA 4KFCA 3TG8A 4EB6B 2JH8A 1ZITA 4B74A 5GZ3A 5A02A 3EHEA 1M54A 1UOQA 3AW9A 4JLBA 4HY3A 1JRLA 1M1XB 4GOND 1PJ8A 5EIXA 4PLFA 3WGIA 2WKRA 1HYGA 4ZVTA 2OCIA 3ZHYA 4H1UA 5KYYA 2AJBA 2HJRA 4RF3A 2ZTSA 4ES6A 1CIVA 3OZEA 1YZUA 4JT9A 4N3NA 4EB0A 2VH5R 1XD2B 3WTCA 1WSAA 2QLTA 2OCDA 4UHCA 2RARA 2CNLA 3ER6A 1VIAA 1XZEA 2JRCA 3HPQA 2I9KA 2FAXA 1YBVA 4DMLA 1TC1A 4YUVA 3DBOB 3E3AA 1VE3A 2HRDA 2XF8A 2JZOA 2FPKA 4TQAA 1GILA 4CU2A 5I48A 3QFFA 3VX3A 2C4HA 2VAVA 1HZZA 3GV0A 2K2QB 3IP6A 3L7LA 4Q6BA 1FS6A 1JTEA 3FCUB 4IILA 3ABRB 3M4XA 2EWMA 3R9IA 3PNKA 3TRKA 1LSJA 5AK0A 4PX2A 2KPOA 3L7KA 4ENVA 5JAOA 3FE2A 3U7HB 2ID4A 1BCRA 1PWEA 3FDZA 3I6IA 4R54A 1G21E 2ATIA 5B3JA 2BDUA 4HNRA 5KOJB 1F2UB 5CVVA 4TMXA 1CQPA 1LU9A 4QUEA 2OORC 3C70A 5FFFA 4TVBA 1E64A 4C7XA 4H2DA 1UEJA 2FPWA 2Q0SA 3T41A 2DB3A 2G7ZA 1TQ2A 3K0CC 3O8LA 1AKYA 4UPVA 4I08A 2YZGA 3RLIA 4E09A 4CEIA 1FP1D 3VGJA 3IIMA 3DPSA 5JXWA 1URPA 3E1SA 2JCGA 3DVQX 2NZ2A 1PJBA 3P96A 4LMPA 4PYOA 1L8QA 4YJ3B 3K9FC 4R40A 4IX1A 1LF0A 1ZOPA 3KXKA 3UJPA 4Q66C 4C07A 5HMLA 2VWHA 1E94E 3JU3A 3NHUA 4QU5A 2H3EA 1B00A 5DLPA 4UMEA 5ILOA 3AQIA 1YZGA 2XQFA 1XBTA 4CV2A 3DQZA 1H3NA 4EY5A 3L04A 3SYKA 3UAWA 2IQIA 4BKQA 4I2NA 3H87A 4BEWA 1N2CA 3RRYA 3BT7A 3MXTA 5FI5A 1VGQA 3GEGA 3GO4A 4R7GA 4K2AA 3IUQA 3PWTA 4G9GA 1E3EA 3IUMA 4BJ1A 3EXHC 1S7CA 3N0VA 3KKZA 3O0DA 2PSSA 3ZNQA 3THYB 4GD3Q 4TM8A 1RLOA 4AKGA 1ZN9A 2HLPA 3T5PA 3ETHA 1EVZA 2QTVB 3MTQA 1W30A 4QG3A 2O2DA 1H2YA 5LP6A 2RIRA 1MHTA 2WV9A 1CR1A 2OBLA 4A03A 3UA3A 4G4GA 1E7WA 1YGPA 3G8YA 5B58T 4EEXA 2I34A 3U3DA 1U7DA 1PQ4A 1JDSA 3PD1A 2P5TB 1SXIA 4MWEA 3FWKA 5HF8A 2E48A 2AHRA 2MSNA 1PBNA 2H16A 4MA5A 3UUEA 1PTJC 1I33A 1S3FA 2IXBA 1XE3A 4C87A 1I3MA 1U8YA 2GI4A 1N77A 5EZYB 2XJ9A 1PKXA 1ZEMA 2QR2A 4XIFA 5LQJA 3G13A 3JY6A 4X6LA 4G5RA 4MUFA 4FFLA 3HKCB 2GZSA 5JSHA 4TRRA 1NAIA 1GCAA 3KAPA 2JLZA 3WWYA 3AI2A 1XF9A 4CF6A 3BULA 3TLJA 4C2TA 2FZ5A 2AV6A 3FGOA 2CXXA 1JHOA 1NR7A 1VLVA 5AKEA 1GG5A 3L82B 4MIEA 5AK5A 5DHAA 3SDSA 1UAAA 5GJVC 4G65A 1KI1A 1YR9A 2Z2XA 1UBTS 1ZC4A 2GCOA 3HP1A 5C8YA 1E3TA 5A4AA 1VLLA 5LPNA 1BWRA 2HRBA 2ONKA 4LZNA 4WDRA 5T3UA 4CIXA 2AN5A 1UJCA 4ENRA 1KVQA 3K6RA 5LA6B 2J08A 3D6UA 3QI7A 5I7HA 3GVIA 3N6RA 2VJMB 3ZGZA 3KVNA 2IPLA 4FFMA 3IT1A 3SF0A 1W5TA 5G0SA 1WKVA 1NP3A 1NPTO 3TZEA 2YV2A 5B64A 3VYTB 2R5NA 3ETJA 2O7RA 3SZGA 1FRNA 3T4UA 5IF9A 3E9QA 4QYSA 4MIKA 3F1LA 2BGMA 4KPUA 5DWDA 3TAHA 4EJ2A 3NHJA 4HP8A 2BFCB 3SLRA 2P0EA 3H19A 3ANSA 4I8IA 3B1YA 4OP3A 1QRAA 4MZDA 1GTSA 1Y3HA 4MV6A 1ND5A 4H3SA 3VOTA 2YDYA 3NUGA 5J63A 1ZK2A 3FMOB 3W9UA 4RTLA 1KDPA 1TM5E 3HUUA 2VDUE 3HCPA 4J1TC 1FTGA 4P92A 4LDRA 3FOAA 1S2DA 1I6KA 3CUSA 2J45A 4RAQA 4LA4A 1UQRA 4FZRA 4MSUA 4YQEA 2Q5LA 2R25B 1ZVQA 4ZRMA 1RRFA 1M6EX 3V4SA 2PUEA 1NNUA 4K9QA 4RVCA 2JA1A 4WZAB 1CUEA 3TSZA 1YO6A 3LXRA 4WZBE 4W7HA 4RNCA 1KRXA 1YV9A 2O8BA 4U9IS 1C0IA 2BZSA 1Y4UA 5GGYA 2GDJA 2YHUA 4Y2HA 4COKA 2C7RA 2ZE6A 5HM6A 4CWAA 1USGA 1C7ZA 5B6JA 1Q21A 1K6EA 1RXSA 4YCSA 1A9RA 1JG2A 1FNCA 1MIOB 1S3IA 1O58A 4XGIA 4A91A 4ZCTA 2BFEA 3LQQA 4LJ6A 5GVSA 1XYYA 2Z3ZA 4UFPA 1DKPA 1NLYA 2AKYA 3CLRD 3D2LA 1U11A 2P77A 3PDIA 3Q10A 2C7VA 4U2BA 4WCVA 2QZ9A 2NTVA 3AY3A 5FA6A 1W0CA 5AKKA 3U13A 3QELA 3RARA 4Q9NA 3THSA 1WE2A 3PJRA 3LK7A 1J33A 4TRMA 1H69A 2JVIA 3MWDB 3ZDRA 5F9MA 1OFHA 2C04A 5DFAA 2HWUA 2A0WA 1OMOA 3A6FA 3P2YA 3VSCA 5BOVA 1W88A 4B6EA 2ZUEA 1CZOA 1V6SA 3DC7A 3OC0A 2VP0A 2WWHA 2ZRQA 4NU5A 3P9NA 3PEYA 1J0CA 1PZMA 1AF4A 1T2CA 1DEXA 2F67A 2J4CA 4QUKA 1AQIA 2Y68A 3IHKA 1KZ9A 1IBSA 2RI6A 5A4MS 3IE1A 2AN9A 4U0KA 3SQNA 4D5GA 4E21A 1GT6A 4PBSA 1F9EA 3TDMA 5CH5A 4ETIA 3SWWA 5J1SB 5KYUA 1PYDA 1NFQA 1RJDA 4E12A 1U63A 2X7XA 4O08A 1TJYA 1UDAA 1Q92A 4MP3A 1XFAA 3DUWA 2VSFA 4ESVA 1MOPA 3GAMA 2FZGA 5E6UB 3WIOA 2QGNA 1R4NA 1U0JA 2IYRA 4KXNA 2XVAA 1UDRA 3DONA 1NULA 1SCKA 1WHTB 3IAAA 3OT1B 2J9GA 1K63A 5BN1A 5A3QA 1VBFA 4POOA 1EB9A 3U7RA 2ZYDA 4CIWA 1N6LA 1A95A 2Q1YA 3DTVB 4OAQA 4RGBA 4WECA 4DWWA 1E9BA 3HGTA 1CZRA 1NW5A 2B4RO 2ZJFA 3RIEA 4Z7OB 3ADDA 2WI8A 5EXEA 2C88A 1C0LA 3BHIA 1JF8A 1POWA