4ICIA

Crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
NSKILVAYFSATGTTARAAEKLGAAVGGDLYPIAPAQPYTSADLDWNNKRSRSSVEMNDPKMRPAIKSKKENIGTYDVVFIGYPIWWDLAPRIINTFIEGHSLKGKTVVPFATSGGSSIGNSATVLKKTYPDLNWKEGRLLNRTDEKAIRAWLDVIAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative flavoprotein
publication title Crystal structure of a putative flavoprotein (BACEGG_01620) from Bacteroides eggerthii DSM 20697 at 1.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Flavoprotein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iciA00
1FLDA 3FJOA 2QX4A 3NHJA 4PTYA 4PTZA 2ZKIA 2Z9BA 3B6IA 2V5UA 1H69A 3LCMA 4HEQA 2X2OA 2BPOA 3NHLA 3OX2A 1FLAA 3EDOA 2V5VA 4F8YA 1AKVA 2KQUA 4NULA 2QX6A 3HA2A 4PU0A 2FZVA 5EAIA 2XOEA 2Z9CA 4QOFA 5LLDA 1J9ZA 1YCFA 5LMCA 1CZOA 2FCRA 3O73A 3NHKA 3GFRA 2OYSA 3NHYA 3P0RA 3QFRA 4ZVKA 3TEMA 2Q62A 3FNIA 2FLVA 4YALA 4DY4A 4DIKA 2HNAA 4NLLA 4QOHA 1D4AA 3N39C 4J8PA 4XDHA 1ZWLA 1J8QA 1RLIA 2B3DA 1FX1A 2QWXA 3KEGA 4QOIA 1D04A 1DXOA 4QOGA 3UXEA 1CZHA 2MWMA 4D02A 3K1YA 1WSWA 4M0CA 1CZUA 1YKGA 1XYYA 1SQSA 5ULLA 1QR2A 2FAXA 1E5DA 1TIKA 5NLLA 2MOKA 1QBGA 1KBOA 2Z9DA 5TGZA 4CETA 2QR2A 3KLBA 5F4BA 1J9EA 1RLJA 4C14A 4BMOB 5BUCA 2RG1A 4R81A 1VMEA 2FX2A 3LT5A 1FVXA 4N82A 4U7HA 1D03A 3G5MA 3ZHOA 5A4KA 3B6JA 3NHPA 3ESXA 3FW1A 4H2DA 1FLNA 1AHNA 2Z98A 1C7FA 2KLBA 3NHWA 5B3KA 2QX8A 3OWXA 5LVAA 1AMOA 1AKRA 2HNBA 2BZSA 2QMZA 1AKWA 4Y9UA 2AMJA 3RPEA 3HR4A 4C0XA 1X77A 1I1OA 2BN4A 2D5IA 1J9GA 2FDXA 2BF4A 3JSXA 3TZBA 5LJLA 2N1MA 4YAOA 1AZLA 3OX1A 3U7IA 1XT6A 4GR9A 2QMYA 4ZVNA 5LBUA 1JA1A 2FZ5A 1C7EA 1AKUA 3R6WA 4U7FA 5FA6A 3U7RA 5EA2A 5LJIA 3ESZA 1CZLA 4BMPB 1T0IA 2M6RA 4QOEA 2QX9A 5B3LA 4U7GA 1YCHA 1BU5A 4C76A 4CF6A 1OFVA 1DXQA 1CZNA 2OHJA 3W78A 2FVXA 1F4PA 1AG9A 1QRDA 2OHIA 2WC1A 4GI5A 1T5BA 4FGJA 3QFCA 2M6SA 4YAFA 1YCGA 5EMNA 4OXXA 4GQIA 5F51A 3EYWA 4DILA 4LTMA 4ICIA 5FX2A 1RCFA 2MTBA 2W5UA 4HS4A 4Y9RA 4ESEA 3OWHA 1FLVA 3OJXA 3F2VA 4YAUA 1AKTA 4YQEA 1QHEA 1FUEA 2FOXA 4LAFA 3SVLA 1WSBA 3OVMA 1JA0A 5FUQA 3S2YA 3NHUA 1CZKA 1TLLA 3N3AC 1ZWKA 1DX9A 2X2PA 3NLLA 1KBQA 4FGLA 3K20A 4QOJA 1YOBA 1XYVA 4XDGA 3W79A 6NULA 1YDGA 3HLYA 4Y7CA 3NFRA 4LTNA 3W77A 1AKQA 3F90A 5LBTA 5NULA 3FX2A 1H66A 4H6PA 2F1OA 3QE2A 1YRHA 2GSWA 4FGKA 3L9XA 2BMVA 3B6MA 3GFQA 4S24A 3NHFA 4LA4A 1RTTA 1XI2A 2ARKA 3NHRA 3ES9A 4C0WA 3OX3A 1B1CA 5F12A 2R97A 3D7NA 3KAPA 3KAQA 3OJWA 2R96A 3GFSA 4LTDA 4N65A 3B6KA 4FX2A 3UXHA 1FTGA 3W7AA 2HPVA 1BVYF 3ESYA 3TE7A 2OHHA 3F6SA 3O2NA 1CZRA 1NNI1 3GAMA 2A5LA 3FVWA 5JROA 2Q9UA 4ZVLA 2XODA 4QODA 1GG5A 1ZX1A 1OBOA 2V9CA 3L9WA 3N3BC 4ZVMA 3F6RA 4YAWA 1V4BA 1SG0A 2MT9A 1OBVA 4N9QA 3NHSA
chains in the Genus database with same CATH superfamily
3LDFA 4DADA 1Y6GA 3I8SA 4HWRA 2REBA 4G5XA 4BNTA 3U09A 4FPXA 3R3WA 3NHLA 4IHJB 1LVGA 4M98A 3S2EA 3VGJA 1PR5A 4F11A 3Q0IA 5KQLA 4RMHA 2G76A 1Z8NA 2QTFA 5I7WA 1HL3A 2RI6A 3SS7X 3F5DA 3Q7TA 3O2JA 4GVXA 3VVMA 2OO3A 3MWEA 2QK4A 3ZE8A 5D3ZA 1DBPA 1L8QA 3RBZA 2VNIA 3HVRA 3LKBA 3ZDFA 4F8JA 4OHBA 1H4SA 3AHHA 3GJZA 3AIMA 1PTJA 4WKPA 5JSZA 5BW5A 2GERA 5JXIA 5I7OA 5J4KA 4QBIA 4IHJA 2B3DA 2X0JA 5SYAA 1JYSA 4V1CB 3EOBI 1WP9A 3ZHRA 4KQWA 4CCAA 1ZDMA 4IJ6A 1Q0LA 2PUDA 4E5UA 4B6RA 4JKYA 3DLPX 4LI3X 5K0NA 3OMWA 5C34B 4PLTA 2DOKA 4X7BA 3BD6A 5KVVA 1SVNA 3DGEC 4HUQB 5IC6A 5DGDA 1E3LA 1VOTA 2FWAA 4TSKA 4J0GA 3R9KA 3L7KA 1X0XA 2OLEA 4N82A 2YS7A 2XBLA 2IZOA 4M6WA 1PK7A 2AEEA 2VSYA 2ZUUA 3Q8KA 4GP9A 4G1FA 1HNZB 1JQBA 3R4VA 4KFUA 4NHOA 1E1LA 2JDID 1M1YE 3BGIA 4RK1A 4A0GA 3UMSA 3PGA1 4KXMA 4BNDB 3A4LA 4GNKA 4AIRA 3TSCA 3PK0A 2QW1A 3WICA 1THTA 4GDFA 3PVCA 4RVFA 2IWRA 3SN6A 1VKHA 2HHCA 4B3JA 1XC7A 2JI6A 3F1LA 3MGGA 5I5EA 5JASA 1RD4A 2GHQA 1T9BA 4PYLA 3W34A 5B36A 5FEUA 2YHBA 1PR3A 1ONBA 4PVCA 1AT1A 5FWXB 5LOVB 3WYEA 2UZAA 2GPYA 2QORA 3UANA 5DTRA 1F4LA 4BDSA 4GPBA 1FLVA 1NBMD 2FX5A 3D1LA 2YNMC 2R6ZA 4M8KA 3ZJUA 1PO7A 3AESA 4PC1A 5H68A 4DVGA 5CLLA 3RC2A 3WG9A 3QJGA 4IR7A 5EP4A 2OHOA 2M6LA 1N5LA 1L1QA 2XVZA 5ICCA 5CM2Z 5JS1A 2VTVA 1MO5A 1R5OA 2X2PA 4JB2A 2XHEA 3HKCA 1C2YA 3P9PA 4JFAA 1JH9A 2A7QA 4AO6A 2G25A 2VPTA 1HH4A 1EWKA 3IIEA 4YC7A 2I8AA 2FTKE 1QHFA 1LQ2A 2X22A 1X7WB 3B3JA 4IOMA 4PGHA 1JIJA 1CPYA 3CEMA 4GMFA 3R23A 3GEDA 5IBRA 4YJFA 3B3AA 4UHJA 1XVUA 2C0CA 5AK6A 3GB9A 4DQ0A 2OK8A 2EWWA 3DR3A 1RBQA 4IEEA 3N2YA 5TVKA 2C4MA 3LQRA 1JDPA 2FR0A 3EH2A 3ETGA 1M66A 1N5KA 2REOA 4M9QA 2REXB 4EY7A 3LQ1A 3QE9Y 2H06A 2VC2B 4UUBA 1J5XA 1ISGA 4OQXA 4Z86A 5H59A 5HFJA 3L7IA 1N1EA 4P3PA 1DEOA 1SWVA 2W0SA 3VZQA 1R9MA 1W29A 4R0VA 4H27A 2CBGA 2WHQA 5TPZA 3WK5A 3AWIA 4ZVLA 1MT0A 3INTA 5A6SB 5K0ZA 4PC6A 1A9ZA 1COWD 1UJNA 1ZESA 4HCJA 5J9FA 1Q3TA 3GFOA 3HABA 2IQ5A 1U8XX 3THWA 3T4EA 2DQKA 5EVJA 4JJZA 4KZKA 3UWPA 4L4UA 2H29A 3HDTA 4JIMA 4DNFA 3PE4A 1T13A 3QPCA 1N32B 2PRZA 3H6KA 3L6UA 3QX9A 2Q0SA 3D4IA 5IM4A 3KEMA 3D8UA 1LVHA 1QIIA 2C9ZA 3K1AA 1KXZA 2O0KA 3DBLA 3KQYA 3PR1A 4DLUA 2O5CA 2NMVA 3LLMA 3ZBTA 1FJ2A 3SHVA 4YJ3B 2J3QA 2R4QA 1VCNA 4C7JA 3FZEA 3GROA 1FUKA 1OTHA 4FNOA 4W8GA 2XDWA 2QXYA 4G5QA 1AGNA 5ICFA 5CAEB 1CY7A 4IUBS 3FJYA 3HU1A 1J9EA 3OOJA 2CYAA 5EY5B 4IZIA 4F84A 1B1AA 1VI6A 4FK8A 4CDGA 3HBLA 3WRVA 2FX3A 3NBAA 5BRAA 3AUYA 3HP1A 4J7CA 4RKFA 1IZ0A 1SKUA 3GRAA 2V7QD 1Y3AA 2HNBA 3G2OA 2GA8A 1EJ6A 2QE7A 5TXGA 3KSZO 4M22A 2PYDA 4DSTA 2K7ZA 3AVTA 1G64A 2QLNA 1RQNA 4G0MA 2J9XB 2ID9A 3RO7A 3AZQA 4DJ5X 1E58A 2PD3A 1GN8A 2H2IA 1BDHA 1RE0A 2V6MA 4B8YA 4PZZA 5B3LA 1JQLB 1X38A 3R40A 4OMFG 4U7JA 5FOVA 1F7VA 5TLSA 3PD1A 2HQOA 2Q28A 1ZN7A 3OQVA 2YMMA 3CR3C 4L9RA 4OQQA 1QTNA 2Q1SA 2NVUB 4BGDA 1DKRA 3ZDCA 2FQWA 3OZWA 1II9A 3VX3A 1Y5IA 3I1YA 5ALHA 1X14A 2GS9A 3NJ8A 4AF8A 4D9JA 3VSDA 4E4YA 4RTKA 3SEFA 1FSSA 2QL5A 3AG6A 3AFGA 4ZKDA 3JU3A 1N5IA 4TWZA 3FNBA 2SBTA 2HM7A 4AVYA 1NN1A 1DP4A 1ULHA 2J30A 2ORED 3SJCA 1APBA 1T34A 4CMIB 3CO5A 2H2DA 2WZCA 1VG8A 4HMQA 4OEHA 3EPRA 1TEHA 2Y1CA 4V0MA 2NPIA 3OZIA 3IOMA 4IXMA 4YQFA 2H7CA 3RKUA 3I12A 2PUFA 1UOPA 5DWQA 3FGPA 4L2IA 3ND9A 2B1IA 5D3QA 2DY1A 3TOXA 2ZSEA 5KNLA 4DQXA 2HQSA 3DW1X 5HKOA 4EQ6B 2ZDGA 4Q3EA 1J4AA 4HATA 4M60A 4M49A 1ZGGA 4M0LA 1BDJA 4FE3A 3OU6A 1EX1A 1OFHA 4UMEA 3UCEA 3FHOA 3U9LA 5I45A 4HWGA 2GN9A 4EWLA 3GJXC 2IGBA 2SKEA 1JJVA 1GKLA 2PD4A 2ZB2A 3DQQA 3K6KA 2PFKA 3H6GA 4TXNA 2Z8XA 1CZRA 2OGWA 5HBRA 3TR6A 3R8CA 1J90A 1IAQA 4QODA 5CTJA 3IP9A 3DAYA 3VFDA 3ORHA 2A57A 2ZI3A 5ABPA 1G3MA 1PNQA 4NFHA 4A8PA 1IBMB 3O31A 4N41A 2W93A 3QXHA 2OGTA 2V97A 5HYVA 1YVDA 4X1IA 4YHHB 1W8DA 3C3AA 4Z99A 4Q1BA 4RPKA 5KNBA 3PTAA 3E23A 5LZ5A 4EP1A 2GETA 2WJAA 1P9OA 1BJKA 4ZT5A 3OPNA 5FO0A 3ZN2A 5BR7A 4UBLA 1GGHA 2HU5A 4DC1A 4E21A 4P2BA 3RUHA 3RV3A 2ZS9A 2Q5EA 4M55A 1E2NA 2Q62A 5CW1A 3UAYA 2JH3A 4J0FA 4LJSA 1K2VN 5DBHX 4FUTA 3QI7A 5LP6F 5ICGA 2C8VA 3R6GA 5KU7A 4UVGA 1Z6GA 4G01B 1Z5OA 1FYEA 4LUCA 4XYBA 2D5AA 5TMDA 1OPXA 4DLAA 4RORA 1OH8A 1CUZA 3Q5DA 2C5AA 3O38A 4M1YA 4M9UA 1RQ2A 4CVNA 1GXSB 2P4HX 3GGJA 3OM8A 1NKVA 3BMOA 4NP6A 3SNHA 1PVOA 1HLPA 1Z4OA 3KLBA 3VPSA 3THXB 3HP4A 5E6RA 1HTTA 5IZCC 4LSZA 3G5UA 3FI0A 1CDOA 4D1YA 3BORA 4DMKA 3WGOA 3F6BX 1FW8A 1E2EA 1F14A 1KEPA 1DQPA 2C9CA 2XLBA 3ETDA 3KPWA 4FHGA 2Y1LA 5IVIA 4B46A 4BCBA 3CX3A 4QBHA 4WOKA 1RKQA 3SIWA 3SU8A 2YHUA 3CZ9A 1G6Q1 5CT5A 4BLTA 1YZQA 1DIOB 4LISA 2RCYA 5HQTA 6CHYA 1P75A 1RHJA 2ILVA 3CZQA 1E7YA 3PP8A 5HUQA 5JCOC 1LY1A 5AP9A 4ID9A 4RGBA 4L5JA 1U98A 4PNPA 2ROQA 4RENA 3Q9SA 1Z36A 2AFIE 4X6XA 1SBNE 1WUKS 1LPSA 3VDRA 3V9PA 4ARIA 3AG5A 5T3UA 1ZLYA 5FQNA 5EA2A 4D4GA 3SJBA 5FAKA 1JR3E 5GONF 1ICIA 2DHEA 2JIZD 4JBNA 1BKSB 1XMPA 5IJ9A 2XCIA 1EWQA 3AMVA 1QRRA 1SQ5A 5K3BA 3ZNPA 3UT6A 3T5PA 1DDIA 3DPSA 1RT9A 1Z5GA 2BGJA 3FFBA 3Q9LA 2D54A 4KN9S 3RH0A 3STTA 1CUSA 2VH5R 1Y7TA 1NZFA 2YQ5A 3A1UA 3NIBA 3VR6D 2Q5QA 3MINA 3M1LA 1DINA 5B58C 3K6RA 3TLGA 2A2ZA 3T7JA 4BVKA 4BRUA 3NPMA 1ISIA 1L6RA 1YBVA 5I7AA 1PEKE 3T1NA 5JSFA 2ZZMA 3PUYA 2A5YB 2KMLA 3DOOA 5AKGA 1RRMA 5FFFA 4DUGD 3GGSA 3NHUA 1L7PA 4YQEA 2HEIA 4IEIA 4FDLA 4RTRA 3B51X 1U3WA 1W9MA 4PM4A 2FVYA 4TLLB 3AM4A 3FKSD 1BN7A 3SXPA 1QH1B 2ZBPA 3I9OA 3KC2A 3KR9A 1JQJC 4PYOA 4TM7A 4O25A 2VJMB 1HPLA 1SC3A 2NSYA 1U02A 2WJPA 3QE3A 2PBZA 1D1SA 4FOSA 1ONSA 1ZVKA 4Q9NA 4NYMR 2B69A 4E2WA 3CR7A 1HSZA 2HJGA 5EWLA 3WMFA 4FN5A 3K70B 5BMVA 4OK6A 4EYQA 5KNBH 1UKBA 1VJTA 3DMGA 5EJAA 2OCKA 2G0NA 4D9KA 4E1AA 4ZQCB 8ATCA 4UREA 4GYKA 1J20A 2HMTA 2EF1A 3OJ0A 3ZS8A 3FRIA 2VPXA 3N3BC 4CKZA 5DHTA 4F5DA 3T3EA 3LUHA 4PSKA 3KKMA 3V7UA 1GDHA 1UEXC 1WUYA 3OU7A 1WQ1R 4MMZB 5F21A 3FSRA 1Y8RA 4BFZA 1B14A 1PK8A 1HYBA 1ZYUA 3B7PA 4O6VA 4AMVA 1DU4A 1PFKA 4CM5A 4DXAA 1ZU4A 2AN1A 1SCKA 4P2GA 1W36B 1QQ6A 2QTCA 2ZRHA 3PUIA 1W96A 5IYZF 3T5BA 1GG9A 8ADHA 1V39A 1J56A 5DM60 2HR1A 1A5ZA 4FFBB 1WF3A 2HTFA 2AIRA 3FYUC 2PMBA 4KU4A 2GZ1A 1E2MA 3MWDB 1TPZA 2GBGA 4P22A 1ACLA 1QIFA 2D5LA 4RETA 3U9TA 4XYLA 2VQ3A 4I1IA 4ZEXA 3OQHA 3ZHQA 1RLIA 4C01A 3WYBA 4AMBA 5AHWA 1NPDA 3QM1A 4KYUA 4XZ3A 3ETHA 4MS4B 4Z7JA 5JARA 4LG1A 2V4UA 3FPFA 4MW4A 1CLEA 4RIFA 4L75A 3LCVB 4WL0A 5KPDA 3U3KA 5FBLB 1LSJA 4LXTA 3REQA 2BDUA 1KBZA 2XE4A 3E5MA 2WV7A 8OHMA 3BE6A 2QBYA 3C8DA 3KSDO 5G4KA 4MXDA 5I5GA 5JNRA 3HCEA 2OGZA 3DKPA 2YV2A 1OHHA 1S1CA 1KK0A 1WHTA 3OETA 4I0WB 5LD2B 2XBMA 3VYVA 1W5AA 3I9FA 5GV8A 5REQA 1K7SN 3HA3A 3UMRA 2P11A 3FHLA 5JAMA 2NVBA 1Z6XA 2OFWA 1U7ZA 4M8SA 4ZRDA 4BBAA 4XLZA 2VP2A 2OAP1 1X6VA 2RDMA 1FXUA 3FN4A 1M0SA 1G66A 2ECFA 4II7A 4M1KA 3KQPA 4LPKA 4S3MA 1ZR2A 3QU5A 2G77B 1KDPA 1C7EA 1RW4A 3WMEA 4J16A 2CHEA 3V4OA 1N7GA 4B3HA 2V7VA 4KH0A 4QFMA 4BJ3A 3RG8A 1MFPA 4ZCRA 1AE1A 1F4PA 1Q11A 4X3OA 3RYIA 1MW9X 3K6SA 5KO2A 4CG3A 1TO1E 3CH6A 4KV9A 1JQAA 5K4GA 4AROA 4TRMA 4IDGA 1EWTA 2HRQA 2VZEA 3ELYA 3EXG1 3J81k 3URKA 1C30B 1QVZA 1BHJA 3N8GA 4Q37A 4DJDC 2YWFA 3MJEA 3HSKA 4QDTA 5LXTA 3RIXA 4Q1DA 1ZOIA 3BK1A 1J2UA 5BT9A 4EF4A 4NG4A 4MRVA 4KJZA 1P0IA 3S4YA 5JSZB 2BHRA 4QNRA 4YO7A 1XEWX 4LXYA 3DEHA 2OQVA 4AMYA 5GV7A 2GJKA 3RVOA 1FP7A 3GCDA 2C5HA 2PGDA 1FQKA 1BZYA 2W00A 4H6VA 5IF9A 3ZQ6A 4PZPA 3QPBA 3GLIA 3DAFA 4LMPA 2XDAA 1YF3A 1SM4A 1YZNA 2FFHA 4RZHA 5T64A 1V2GA 5JDIA 2IRWA 4KWHA 2P3OA 1G18A 1FFGA 3MS4A 3ET5A 5KYTA 3T5TA 4C5AA 4DDVA 1OQAA 1XZJA 2X13A 2P77A 3DP9A 3AKCA 3MGKA 4HX5A 4XWTA 1X80B 2B7CA 2FETA 2RARA 3SD7A 3UG6A 1HKHA 2Y68A 3AW8A 3UB4A 1HXHA 1Q0UA 1VCOA 4ZVUA 4DBLE 2Z2XA 1O7JA 3HKEA 1FQJA 4WESB 3WGGA 1GAWA 4KV7A 1FFXB 2E85A 2IYVA 3BGVA 3D2BA 3OO0A 3O8OB 1LDGA 1GRCA 1NLMA 1L7XA 1BRTA 4NDZA 5C1BA 13PKA 1LV8A 2ZKIA 3PUHA 4RD2A 2OCAA 3TVTA 2AMFA 3B3FA 1TZCA 5KHLB 5LD2C 1JDZA 3WC4A 3FUVA 1L7NA 1F0YA 3Q88A 1T8SA 3IMCA 1J9ZA 4OYHA 1DRUA 4R8VA 1TMYA 3KX2A 2VTKA 3LHIA 4F1JA 2HHHB 4C6TA 4G2NA 4XW2A 4EG1A 3H2BA 1CEYA 4Q7MB 3IUPA 1U7DA 1RMQA 3ZV4A 1G5FA 2D1FA 1OT5A 2GNPA 4R69A 6PFKA 1Z8HA 5L51A 4PHFA 1OROA 1JR3D 1PL0A 1I14A 4URWR 4MOWA 3H2JA 5E1MA 1T5TA 2B3TA 1H5UA 1CJUC 3M5DA 4AURA 3U1BA 4H4EA 4HGNA 5E0OA 5AJXA 4MQEA 1I3KA 4H59A 3D0OA 3QU7A 3LT2A 3AUFA 2JZOA 3X1WA 4CQLA 1WM1A 4OH7A 1Z4IA 2QM3A 1AM4D 2QIOA 2H1OA 2AN5A 2HO4A 4HLUC 1PT5A 4YP7A 1IN5A 4KVZA 2D62A 3LT5A 4K7JA 4PLYA 5DCUA 3WKCA 4QEKA 2EVWX 2RHLA 2PD6A 3SHFA 1ZVMA 4J16C 3MYRA 5JRDS 1UMKA 2Z98A 1J09A 3DLAA 1XD9A 1JSCA 2BGKA 4LHVA 4F9FA 1DTEA 4AF7A 2IYAA 3TG2A 2WHRA 3EDMA 4DJJA 2P2SA 5EXDA 4ENPA 2Q1XA 4FN4A 4IJ5A 2LDBA 4L4YA 3CCBA 4H1UA 5JT1A 2O54A 5IAAA 1CUWA 3RE1A 2QENA 4LBVA 4H7JA 3MAGA 4UAVA 2Z0MA 3A1FA 3REOA 4U4AA 5CAEA 5FBKA 4Z3DA 3V48A 1ZMXA 1M34A 1YRAA 3JQ6A 3PC3A 3KOOA 3AI2A 3WB2A 5DP2A 1YB7A 4M0EA 4WINA 4O08A 1X42A 1MRZA 3ER6A 3G5AA 3LLCA 3JQBC 3UT5B 2CV1A 1Y3BE 2XNKA 4PLZA 3SJAA 3ZH2A 3F78A 4OFBA 2CFRA 4FFMA 3AB8A 3I2JA 2CLCX 4GXNA 4J1NA 3G17A 3PIRA 3ZS9A 3L1JA 2H07A 1HDYA 2IXDA 4Y2PA 4L5YA 1IFXA 2YXNA 5L3RA 3BB1A 3TMYA 3WLIA 4MWTA 4KR2A 1QOZA 1JNYA 2I62A 3LU1A 4JJGA 4II2A 4UDNA 1BGWA 3SBXA 4BE4A 1ULAA 3P0FA 4KUHA 2YFHA 1L5SA 2IPMA 3EJ6A 1QMGA 3B89A 3HE3A 1DIAA 2HHJA 1HUQA 2JIDA 4NEQA 2XMSA 4PHCA 2C78A 2NQ8A 2FSHA 4S1NA 3VSCA 1M6HA 3BL8A 5J4YA 1OFIA 4HAOA 2OV8A 3KBOA 4TKUB 3V7NA 4EFNA 1UCFA 4R7GA 5A71A 3KKNA 1TMOA 3L0IB 3DC2A 5FWDA 4DR1B 1XCMA 4NPCA 4BVHA 2CHVA 4RNCA 4F4JA 1I7LA 4JEUA 1UPCA 2A9FA 3IEIA 4QFBA 3VV2A 4XPIB 2PUAA 1M1XB 3NDIA 3O2NA 4DLNA 1UM9A 1P9NA 2J3EA 4Q4JA 3ED1A 3QVUA 4EECA 2BFAA 2CJYA 4TV8B 3LRTA 4MVXA 1FFHA 1SELA 3KJGA 4NE7A 4MJ3A 1NVAA 3ZHSA 4ZI5A 3L07A 4UEWA 3U7EB 1P44A 1FLDA 3QUTA 2WINI 1SPBS 4N3NA 3Q3HA 1YFKA 5HS6A 2V54A 4P8RA 5C5IA 2BMAA 5DM4A 2IHTA 3KELA 3EX7C 1G8JA 1DBSA 1JBKA 3LIPA 3NBXX 2WNSA 2YV4A 3K5PA 1GJRA 4QU0A 3UXMA 4EW2A 1KA9H 4B34A 1J8FA 1Q3KA 2WWHA 5IJZA 3X0DA 1S3GA 1DKUA 3CB4A 4TWBA 1I6WA 3WNQA 2POQX 3H0EA 1CZOA 3O73A 1EAYA 4TTVA 2Z2JA 1JKMA 4GECA 5AI8A 4KXXA 1FTNA 5FPSA 1U3TA 2BEUB 2WKWA 3AR5A 4NBKA 2X7HA 1VL5A 4PTLA 3IULA 4YRRA 4TOIA 3N39C 3I2KA 1M2HA 1T36B 4JIGA 4DLLA 3C1OA 4OBEA 2P2YA 4F6RA 1F9AA 1PTKA 1JR2A 1NNEA 1D6JA 1NNSA 2NO1A 1GPNA 3OFNA 3OLCX 4RJTA 3GJ0A 1GUDA 3IDSA 3KD3A 2CXHA 1E2FA 3UMBA 1QZTA 1UKYA 1GGNA 3JQ9C 3U4QB 5LFAA 5DXFA 2YASA 4B83A 1RPTA 1FYWA 2O2IA 4Q34A 5HIAA 1NY6A 1Z25A 2WTXA 4FYPA 3RM3A 4JJEA 4OK5A 3V2HA 4RH1A 4NYIQ 1FE8A 4M0DA 3HKDB 2ZJYA 5CA1F 2XUZA 2C59A 5J2TF 4BC0A 1IM2A 3PNSA 2K6GA 3DO6A 1AKRA 2GI4A 3CNLA 1U2QA 4WMLA 1V7QA 2VDOB 3CXUA 3JRWA 5FBWB 3WIUA 3KXLA 1YDEA 3MWLA 4CKEB 3K9FC 1E7QA 3HY4A 3ABIA 1FRVA 1YHNA 4MCAA 1MW8X 4S1WA 4PRYA 5AVKA 4ND8A 2F3UA 1U94A 3OBBA 1R0SA 1TVKA 1RWOA 2GR9A 2QGFA 5ALMA 1TO2E 5A6VA 1EK6A 4I55A 3N7TA 1JTFA 2ODBA 1E5TA 5SZIA 4CHGA 4S04A 3ONDA 3H2ZA 1JEYA 3V3KA 6REQA 3IOYA 1ELOA 3DUFA 4I8DA 4B3IA 2Z4RA 3V2UA 2WAAA 4ZOQI 1EBFA 4E12A 4RTPA 4PC2A 1MJGM 2ZK7A 4F5YA 4OGGA 4QRDA 3HO1A 1RZRD 3QUQA 4LYJA 3A1VA 3EZFA 3HBNA 3D2CA 4ITUA 4KN8A 1PSWA 4JH0A 4TV9F 3IKVA 2OT3B 1GIAA 2GHTA 4NZZA 4UEOA 3PITA 3EIUA 4KPUB 2AG6A 2DPGA 1JA0A 2IPXA 2PRIA 1M72A 1YR3A 4OBXA 1C7JA 3OOHA 4ZKEA 2Q2NA 2NU9B 2FW0A 3OCVA 1DIBA 1JG3A 3P20A 1NW9B 2OBMA 4ND2A 1YZGA 3I5XA 1P7CA 1SBTA 3K53A 4MB2A 4CIVA 1P2DA 5KOHB 1NHWA 4H6PA 5E95A 4C2BA 2NIPA 1UBJS 2FSFA 2PY6A 3MT8A 3SM9A 3QLVA 3G7NA 1R6DA 1XCOA 2GK6A 1QQAA 3N0TA 3RUFA 1JG1A 4GHWA 4K9PA 3Q6MA 1WPGA 1U2EA 1XMIA 3T3NA 5EIWA 3W5UA 4HVLA 1W36C 1CEEA 3CPEA 1Q15A 3CRRA 4P93A 2BAGA 1DUSA 5DCWA 1PX2A 3QA9A 3FAKA 3GEEA 1YZTA 2FEXA 4ZVOA 3X1YA 4RTMA 1UOQA 2I80A 3JYOA 3QWHA 4MGIR 2H31A 2YUTA 1EA5A 4KTVE 3NHSA 3MTDA 4XIIA 4NMWA 1MTZA 2CNBA 4KG7A 4FW8A 4LRUA 1KI4A 1MBZA 2C2ZA 4ZCQA 2G06A 1YQTA 3H1AA 1CRQA 3BKWA 1MX3A 1M6VA 1UDXA 3ZCXA 4D3XA 1K75A 1TA0A 1FNCA 1M6YA 2VDLB 4Y2XA 5A5FA 5K0EA 4FR0A 1I0ZA 2HUPA 2ADFA 1YBHA 1Q0HA 2AFRA 2BFFA 3F5QA 4RV4A 2Z8YM 3VR3D 1GNTA 2HDNB 4C9BA 5F9HA 3JQGB 2ISSD 1Z2PX 2PIDA 2D1YA 2IH2A 2XWJI 4G1MB 3R9XB 1DC8A 2P6NA 2AW3A 1BMFA 1K89A 4M99A 1CR6A 1WBJB 3FAZA 4LWPA 3O8QB 2HPAA 1M8KA 1PDOA 4WLUA 3JVUA 3MWEB 3W1EA 5C8YB 2PZLA 1Y7HA 2HYDA 5DHRA 2O8VA 5ALFA 4D8XA 4ZO4A 1KJWA 1XVAA 3JVIA 2D3TA 1LK5A 4BTEA 5H83A 2O4CA 1HZJA 4IXDA 2YNMA 5BV2P 3VDNB 2MIIA 1KVQA 2WUGA 3CT4A 9LDTA 3VNVA 2DWOA 1EP3B 2BISA 2PZKA 4PV7A 4BVFA 4QBFA 1YS1X 4BS9A 4UTXA 2BFCB 3NTUA 4JJAA 3NKFA 2D8AA 3CGWA 4QYMA 5H4HA 3JTEA 1NRJB 4REQA 5E2AA 4UTZA 2WTBA 5IS2A 1USGA 1P73A 1JAHA 1WE2A 4FU0A 1ORDA 1NQOA 1K98A 1FFEA 2G8NA 1K3UB 3KPJA 4QDZA 1RC8A 3FUWA 3OJLA 1C1XB 4DEYA 4NCXA 3AR4A 5JXGA 5CLIA 2DSNA 1AO3A 3H1TA 3LFHA 4HN9A 4KQCA 5IT5A 1NI5A 4JZYA 2VAVA 3NHMA 2A9PA 5CHYA 2AFIB 5IEBA 3I6MA 3MZ0A 3SFTA 3F4KA 3SJZA 4LV5B 5JO0A 1DMRA 5T4HA 1VRWA 3AR9A 5LM3A 1TZJA 2V9ZA 2N47A 3CG0A 3QF4B 1OU4A 5CW2A 2AUMA 3U7JA 5LYJB 5C35A 4ZI3A 3NC1C 4E5YA 1EWYA 1Q91A 4CMAA 1DV1A 2HTEA 5AYVA 4MWBA 4EKIA 5E3HA 5FUQA 3BC1A 2HHAA 2V0GA 1JR3A 2NNLD 4PX9A 2C61A 2BGRA 2QVYX 1PGQA 3H5WA 4I9NA 2VJOA 4JUBA 4WZ6A 3EW9A 3C5HA 4TVOA 4Z8YA 3WL6A 5AOBA 3I39X 3NI2A 2KI5A 3D4PA 3KZOA 4RZUA 2JAPA 2X1LA 1SIBE 3HXKA 1KYYA 2RAPA 4X20B 3WQSB 4I50A 5GINE 3NKLA 4UM7A 2HSWA 1N7HA 3KJFA 1W1UA 2BP7B 3MAAC 5KOYA 1HNNA 4NONA 2QX7A 4FDAA 5EUBA 5DYNA 4B7UA 4HAYA 1TO6A 2VAXA 3U7QA 4RWZA 1S8OA 4UHBA 4KWTA 2O2CA 4MGEA 4NBRA 1XEFA 2PH7A 2Q4TA 3NALA 3CVUA 4D98A 3O4VA 3G0CA 4NOJA 1IULA 4GWGA 3UYKA 4KLNA 3KSUA 1OGIA 5CPBA 3OQ1A 3PUVA 1PG5A 2K4MA 2VDNB 3DLHA 5LMZA 5JH7B 3FVWA 3J81A 1MABA 4A15A 1J25A 1V48A 2OAQ1 2GFIA 4BQPA 3KOYA 1RQ7A 5EKSA 5FBQB 5F9MA 5DJ5A 4W7HA 4UHKA 3SFVA 1VMIA 2IXTA 2YL2A 3PA6A 4IHAA 2VSQA 2CVHA 3OZAA 3WISA 3LCMA 1E9AA 4HDRA 4FC7A 3WGUA 3H3FA 4Q9HA 3ZTYA 4W7IA 2P67A 1LDNA 4EGCB 3AHJA 3PIIA 1T3HA 2ZXUA 2OKCA 3K6SB 3F8WA 3QE0A 3U61B 1NFRA 2A9QA 2JGIA 1COZA 2R2AA 2B25A 3SEZA 4IJUA 1XQ9A 4CN9A 2PANA 3SLGA 3BMXA 1EXMA 5DOVA 3VNQA 1JLSA 1L7DA 1IXKA 1WCYA 4OHWA 3R0IA 5EIAA 1G5TA 4YPOA 4ZARA 3TZLA 4B0OA 1PR6A 4IYRA 2OV2A 5DLDA 2EZUA 4ZHQF 4K1LA 2I3ZA 4G23A 2WY2D 3G5LA 1A88A 5AJZA 6AT1A 5MN6A 1JSRA 2V59A 2YZNA 3PRKE 1BFKA 2OBLA 1I4OA 4PHTA 3B60A 4CGYA 1LI4A 2J6IA 2EV9A 1L5YA 2J0VA 1CR4A 3EGWA 1VGQA 4DCGA 4RK7A 2IYLD 5CLFA 2JGAA 5SZHB 3TGWA 3UPTA 4HF7A 2BM9A 1KWKA 3CR8A 3WVNA 2Q6LA 1C4WA 1L4NA 2OL4A 3A6GA 4GBJA 5BN1A 3GJ4A 4HAVA 4Y9UA 3CINA 4EITA 3VA7A 4YRJA 3RSQA 1C4KA 4Z0HO 3THWB 3F3MA 4BRSA 3OPMA 1MT3A 3HDVA 3P7MA 3TZHA 2YBDA 4KPFC 1S02A 4AKTA 3RYFA 2GJ8A 4N5IX 2CHQA 1TCVA 1KAEA 3L4KA 1WXQA 3LPCA 3G2NA 1WVGA 4DZRA 4JYMA 2BFDB 2NSHA 3RLIA 1FQWA 5MN5A 2WF6A 5DH9A 5JO9A 5J2TB 2R1VB 3PWTA 1JHPA 3Q2KA 3RUCA 4XWOA 1GEEA 3I8OA 3IUBA 3N2EA 2P41A 3E9DA 2X0IA 4AZ0B 2ZI4A 3DXYA 3GJ7A 3RROA 5JIBA 1OXTA 1UXOA 5L3ZA 4J43A 1O94C 1TJNA 1QANA 2VHXA 2RFLA 3EN0A 1YQWA 2X8JA 4NBTA 5T4EA 3WO0A 1I10A 2NZVG 3FB1A 1AXGA 2GPWA 3HLKA 4HJXA 2A94A 2QG6A 2QLJA 3W06A 3AVPA 5CUQA 3I5YA 1AKMA 1BCSB 1P1JA 2J5BA 2IUYA 3U44B 1SVMA 5KNCD 4DA9A 1QHIA 4PFJA 1UKEA 1ONPA 4PVDA 3A7EA 4BO1A 5BVHA 1AB6A 5KMGB 4B2LA 5HMMA 2JA2A 3WGZA 5T41A 2EFCB 3EZLA 4R2IA 4LC9A 4V3CA 4HTFA 4KFTA 3RSFA 4WK4B 3SAJA 4HN4B 1MAUA 1RAAA 3CRVA 1Q6ZA 1T5LA 3VDQA 1AK1A 4XIGS 4EHAA 4FI3F 5AH0A 1KO7A 4D4MA 3KUDA 5GZ3A 2WVAA 4I1YA 1YHZA 4KR7A 2QA5A 4MB6A 2BSAA 2ZYGA 1SCDA 1F38A 2PAAA 2M98A 1S3FA 4R3WA 4WAUA 2ZB3A 4LQDA 4B17A 1VI5A 1PZMA 2MSDB 3GNSA 3AK4A 4HDMB 2BEKA 1MJNA 1CVIA 2EX1A 2Q50A 3NM4A 3OJFA 2FMKA 3ND8A 5ISMA 2G9ZA 3PQFA 5KYYA 1ORTA 3QEJA 3CJTA 1E9VA 2VJNA 2G08A 2Y2VA 3R5KA 4PGAA 5E4JA 3E22B 5JZBA 3ZJVA 3IUSA 1ODIA 3BMCB 8AT1A 5F98A 4EX6A 221PA 1B16A 1S2MA 2ZTSA 1XTQA 3BS4A 1N3YA 3T1QA 1L4BA 2WFLA 1BGXT 3RS4A 5BNFA 1OB2A 5JPIA 3ZV5A 2VT3A 1OSNA 1XLTC 3C5CA 3BDAA 5JCZA 5TS2A 5HKAA 1IJEA 1XA3A 5BSTA 5LSAA 4JGGA 2DPXA 3DE3X 5EKTA 3DOJA 4MUHA 4G2TA 5DX1A 1RXCA 2JGFA 3DDUA 5DHFA 2PMCA 5HMLA 1W7AA 3HVJA 4QE3A 5FLYA 2ZS8A 1QYWA 3I9LA 4B3XA 4D02A 3RIEA 5BR8B 1JEEA 3ZNOA 2IIVA 1KEWA 3MGCA 4QGGA 3BULA 2VF8A 5IN4A 3GAZA 2FUKA 4R0MA 2BHLA 4JUFA 1ZBQA 3TQCA 2P0EA 4FUQA 1WB4A 1KC3A 1D09A 1W88B 2XX3A 3HJHA 4OL9A 2Y3IA 2R7AA 2JKVA 4V0SA 3UFXA 4YJ2F 1USKA 2AD1A 2Z09A 1CR1A 2A0WA 4TXJA 3A4YA 3OWXA 1Q77A 4PC3A 5DT2A 1N78A 1MCZA 3CN7A 2GVNA 4M0UA 5HGXA 4P83A 2CNKA 3ICQB 3V4LA 2QUIA 3KSMA 1JU4A 2JKZA 4HNTA 4UMFA 1POWA 3H42B 4GMGA 1YZUA 4URYR 5KINB 2WIJA 5EIOA 3ZBUA 3AETB 4ZK6A 4HGRA 1KMHA 1H4TA 3EGEA 4P5DA 4BE9A 2NNWB 5HE9A 5IAJA 2IX3A 2XMZA 2C3UA 3DKKA 4BMPB 4EHIA 3EGVA 5CYFA 4ZQEA 5HBGA 4HH4A 3O5AA 4X63A 3CUKA 1PWXA 4C4TA 1G3QA 4ZYYA 5LPNA 3KR0A 2YRFA 1KOLA 1UZLA 3R9WA 5B1SA 1CEQA 2JVIA 3EMDA 5FORA 1C81A 5THXA 1B6RA 1ND5A 4S12A 1UK6A 2WUDA 3VNSA 1D2RA 1NVXQ 2YR0A 3GHHA 2A4KA 1IUKA 2PGJA 5HRCA 3WHKA 3WMRA 5EE0A 2AQKA 5I9MA 1Y5NA 4R84A 3BWMA 4CIYA 3N2GB 4LJ5A 1OYYA 1H1LA 5AKZA 2EJVA 1G2QA 1TM4E 1Z38A 3RVKA 2FGKA 1GSIA 2WTNA 4HXFB 4P7BA 4XDGA 5ALVA 3FHTA 3NNSA 4YMLA 3LPDA 2WF9A 4QLOA 2QZPA 5KWVA 3FR8A 4V02A 3AIKA 5AK4A 2DXIA 2OOKA 2FEAA 2Y66A 2Y0CA 2ZWPA 1NV9A 1YJCA 4S24A 1ZIOA 1J5PA 1C9JA 2J41A 3NP9A 4PBRA 1NF3A 5A2GA 1ZH2A 3K31A 1ZUWA 2XXJA 1S6YA 4CEHB 1U3DA 2TECE 3GFFA 4C7BA 3LX6A 5K8TA 1UZAA 4JKIA 3WK4A 2VP3A 1H5QA 2F3QA 2NO0A 1U0RA 3ESAA 1V8DA 1IY9A 2Q6VA 5A04A 4BZZA 3DEAA 4BX9A 3FIUA 1EGQA 1NC1A 1WX1A 5JV5A 4F5WA 4TL7A 1P9WA 3B20A 2CXQA 3LPAA 4HT3B 4ZGGA 3G0IA 1N36B 3KKQA 1D1QA 1KP2A 2BMDA 2AJCA 5E1DA 3G9TA 5CB8A 3KTDA 4R3UC 4P54A 1IPEA 1H2YA 2NTJA 1SUPA 3DONA 2X2OA 4F71A 1TJ3A 5JHHB 3KQQA 1UIMA 4OI2A 5K8JB 2H0RA 1CIVA 2PX4A 1F4VA 3MIIA 3RT7A 1SVUA 4EUNA 3CH4B 1JFSA 3MS2A 1Z37A 1KPIA 4LWOA 2HCJB 2VRBA 4F8EA 4ZHQA 8ABPA 1A8HA 1Q1GA 3O4JA 3QF7A 1DSSG 2IUTA 2FSUA 4IY1A 4MGYR 4MZDA 5CT9A 5CU7A 5JJCA 3F47A 3QHQA 3GJ6A 1Q7EA 1XAIA 4U2FA 3MILA 4U5QA 5EE5B 3G2QA 3T9BA 1TMKA 1F6WA 3TN7A 5BSEA 2J87A 3K8OE 5EJ8A 1UK8A 4GH5A 2FQXA 2ZU0C 3UC5A 5CM9C 2BSXA 1X1AA 2XJ4A 3S7TA 4YRZA 4DIEA 4E1BA 4EJMA 1X1EA 1PLKA 4GBMA 3DE4X 1KVSA 4H0FA 4CQMD 1RZ3A 1UP7A 4WCFC 1FSPA 1EESA 1AZWA 2PT6A 3EWIA 2IS6A 3PI6A 1JVNA 2YCBA 1U2DC 3P0JA 3EIXA 2X8BA 4IFTA 3G2KA 3P71T 4PY2A 5LQJA 1NG9A 4MQ6A 1DUVG 2UXDB 5EWJA 3ZHOA 3DGFC 3G0GA 2BTQB 4M38A 3RWMB 5D1HA 2JLBA 1BJTA 3ESXA 3OJCA 2PPVA 2ZPUA 3LFTA 3E2PA 4EO7A 1LNZA 2GBLA 1GCGA 2RI0A 5IBQA 1Q57A 1ZIXA 5GJBA 4XIFA 5HFAA 3DTVD 2IOFK 2KB0A 3H7AA 2HPHA 3ZV3A 1WD5A 5J40A 4KWIA 4FILA 2R4UA 1HYHA 4LE0A 3U4MA 4A8TA 1RP7A 1N6OA 2XWPA 2V98A 3IE1A 1VP9A 2IPNA 2II6A 5AHXA 5BWCA 2QL9A 1QO0D 3DL0A 4RDIA 1MR3F 3B52X 5B30A 2W2LD 4CM1A 3ICOA 1YR1A 5KAMA 4D9CA 1NR5A 4YRNA 2VAPA 3ZCVA 1I36A 1EFUA 2ZRLA 1JGTA 2W0MA 3Q6IA 1ZN2A 4PXSA 4EG3A 4LJ8A 1JECA 2O0JA 3T52A 5IPFA 3MJCA 3M81A 2IOHA 3OTWA 3IQDB 3T9EA 2H16A 2Q5JA 2RONA 3LAWA 4RS3A 1IQPA 4WASA 3WWEA 1N33B 5IULC 3FTDA 3DOEA 2XF8A 1HWYA 3IPRA 3GL9A 4FWTA 3P9CA 2F59A 3DVAB 3OLZA 4L0QA 5JUWA 1Y7IA 2ZTLA 1I2MA 4BNLA 2FOLA 2YIDA 4ETNA 2B9VA 5DP1A 3IOCA 2JGEA 2IIBA 2QPAA 3ZI0A 1P0PA 3RS8A 2GPNA 3BK7A 2WYVA 4KR0A 4Q47A 1Z0FA 2ZEJA 4G07A 1U90A 3BCUA 4R6XA 1MG5A 5BURA 2QSUA 5JY1A 3FFXA 3MJTA 3PFHA 1Y8ZA 3DLTA 3I1FA 3KJXA 5A0FA 3RSSA 4DWVA 1PGNA 1JIQA 3A14A 3E70C 5K6RA 1GNLA 1Y1LA 2PNJA 3ESYA 1PT8A 3FTCA 3GGOA 1KMCA 2GK3A 2R44A 2V7UA 2VUTA 3O7WA 4CE6A 1QHNA 3FBGA 1MEOA 1KJNA 2XH8A 1FRNA 1V8ZA 1IN4A 3ZW8A 1JDBB 1QK5A 5FBRB 3VPXA 4DUPA 3NWEA 2VQEB 5AW9A 3NCTA 1BXGA 2FJUA 2WU3A 2JFYA 3IMFA 1M7HA 2ZYVX 1PKXA 2PQ2A 3VH3A 2ID8A 4OKNA 4YV7A 2DF8A 5INTA 5K03A 4KREA 6REQB 3M89A 2A5GA 3THYB 4QJ5A 3IT0A 3E15A 1D4FA 1G8KA 1WEKA 2XMQA 4ZEOA 3VZCA 3HM9A 2JBAB 1EQAA 2F1RA 3TZCA 5ARBA 1ECLA 4NOLA 1NXSA 3SEQA 4RDCA 1EAMA 5DT9A 5ELXA 2JI8A 2BKLA 3MCZA 4PAMA 3BXOA 4UVHA 3NYIA 4BMDA 2XWSA 3RCBA 1YDMA 1RHMA 3DOFA 2HFKA 4Q4HB 5EZ6B 3VPBA 3BBPA 4OM8A 1AN9A 5EOVA 6GPBA 3E6AA 3KO8A 1NDQA 1NLFA 3RU9A 2NYAA 3RT1A 3EWAA 4XOIA 1GRQA 2VT7A 1Z2OX 2JAHA 2JKYA 4OHVA 2QSJA 4HAZA 1KK3A 1EXNA 3JAWA 4KRXA 4Y7DA 1SVWA 2YJ4A 2PKQO 2R7NA 2XYHA 2XVMA 4Z8XA 3LBIA 3ZVLA 3LCCA 4XCQA 4IG4A 3RLFA 3EMKA 1RLJA 1S9DA 2JCSA 4BMOB 4I50B 3RSCA 5KTPA 2O48X 5J2UB 1U1FA 2QP3A 5SYMA 1U0BB 3KFXA 2SKCA 3WK6A 5HNKA 3SZRA 4H7EA 1C7RA 2IHBA 3K8QA 4BKMA 5BSGA 4DIOA 2P7HA 1A1SA 4QWWA 3SOZA 5CDGA 1OREA 2ACEA 2PZMA 1YVEI 3AUJB 1Z4KA 4KVGA 2NO4A 2PUJA 4QZVA 2A1IA 2DLDA 1H8HA 4G8BA 1C8KA 3AFIA 3ORYA 5IKPA 2IF0A 2JFHA 1GZUA 2JFOA 5KJ6A 4K0KB 2MINA 2DHDA 2X9VA 5BPHA 1UK7A 3DT8A 4B4UA 3A9SA 4I14A 2P69A 3CLSD 1OYWA 3HI6A 3PXCX 2FFJA 1OAOA 2BCEA 4O2RA 1Z4NA 5EZQA 4R31A 2HY7A 1Z9BA 4UU7A 3DE0X 3QYAA 3WZLA 3NAQA 5JD3A 1T5SA 1BQEA 2C5LA 3KTAB 3DOCA 1IZ8A 3H5TA 3PB3A 4R1MA 5BRJA 4HS4A 5ES4B 1SUSA 4ZYZA 2ONZA 4XGQA 1U7UA 1SY7A 1ABBA 1EVJA 3ZE1B 1S4QA 3QV1A 2AW5A 5KQSA 3QQ5A 3GG2A 2QLFA 1OLUA 3SZMA 3OVMA 4M6WB 1MOSA 3SJUA 4JODA 3HY6A 4ZYVA 1KQFA 2F6RA 2CWWA 2X8JB 4FYHA 4Z6KA 4HPXB 4EI9A 5C7LO 1Z12A 1QB8A 1ECCA 5A03A 4LNAA 2A5DA 3TJMA 4MUIA 5EERA 5HHTA 4ESVA 1SRRA 4FGKA 4EPTA 5THKA 2NTNA 5LIRA 7ADHA 1TLFA 2HF8A 1OR8A 3E84A 3IOBA 3Q85A 1FNBA 5DGXA 4L72A 1F9EA 1TYDE 4BBPA 2VEOA 2AEJA 1T2FA 2BFEA 5EI5A 4D3ZA 4UJ5A 1EM8B 5AI6A 4Z4GA 2FSVA 1SNYA 2YVLA 3JASB 2JLXA 3QEMA 2HIAA 1J23A 2W90A 1GCOA 2EG5A 4B4DA 4G9GA 4F96A 3EZNA 2XUKA 2XB9A 3DVRX 4MHTA 5IH3A 5CMLA 4FB4A 5L6LB 1ZX1A 4P3NA 2H0QA 3MB8A 2NPFA 3RTBA 2W2TA 2KX7A 3JZIA 1I7DA 2FNAA 1OZFA 5DE3A 1RHUA 3AHFA 4QYWA 3UMJA 1CQZA 4DIDA 5FTLA 2W98A 4KE9A 1JDUA 3F5MA 3NP7A 4RIHA 2AV6A 1NQAO 1Y4SA 2H4WA 1I32A 1KJYA 4L8GA 3WHLA 1D0VA 4DMGA 3FWZA 5BW8A 3ZNQA 3VZBA 4Q02A 5DSXA 2NTVA 4OJMX 2B5VA 5BYJA 3C41J 2CV2A 1SBYA 3RWBA 3IHTA 3KVNA 2A3NA 4QREA 1COWA 1NVVQ 1KNXA 3FPLA 2GHRA 3ODGA 4IOJA 4IDOA 4L7QA 4NAVA 4PLHA 4WADA 3KSAC 3VTKA 1II8A 1G3IA 2ODNA 1CUUA 3ITNA 2HF2A 2RGAA 1R5JA 1P2GA 1Q12A 1J2JA 1X2BA 1Z6PA 2HQRA 1DKLA 3HPRA 3OIDA 1TL7C 3IUQA 3MTEA 3WNDA 3DTYA 2IHVA 1QG6A 2RAUA 4H6XA 1KSHA 4E1VA 4L6AA 1YFLA 4LZZA 2VCEA 3G88A 4FD2A 3TTWA 1XQVA 1SHZA 3AV0B 4PX2A 4RV5A 2JJ1A 3TTYA 2QVXX 3GZJA 4KTTE 2WVJA 4XM0A 5JVDA 3L18A 4KIWA 4KAJA 5DW3A 1RIIA 1B8PA 4EUFA 4BO6A 1P1HA 5F3RA 3HN6A 3F7NA 3KB1A 5FWXA 3EVFA 1FLNA 4TKMA 4FLEA 3D6UA 4JVNA 3OKPA 3CW9A 4MA0A 2BZSA 3TBFA 4F45A 5JBNA 2BN4A 5CB0A 1E7WA 1B0UA 5KAPA 2J6HA 2J5QA 1O89A 5HF9A 1F8UA 1T9KA 1CVLA 3OCUA 1CF2O 3ZYCA 3ND5A 5G1PA 4LMRA 1VDZA 4E32A 3DQPA 4JCCA 5B2EA 2A59A 1V3QE 4JI1B 1FX0B 2P9BA 4L5AA 4YXFA 3ZCRA 2JARA 5EP1A 4BC1A 2CN1A 4TZ6A 2QN6A 1KYXA 1HFEL 2WUFA 1YB1A 4AT1A 1IU9A 1O3YA 1UKCA 4MULA 3GPLA 5JJIA 3PKJA 4WKGA 1PBTA 4ROSA 3GJTA 5IG2A 3G9ZA 1A2KC 3OIUA 2IX9A 3WWPA 4CIWA 5LQKA 5COAA 4DR6B 4A1OA 5FULA 4KO2S 1T2NA 5JXJA 1V9CA 1OD6A 1JAXA 3KUXA 4KYVA 4TQ9A 1B4DA 2EAUA 3UGJA 3F7MA 2YZGA 3Q11A 2MDTA 5G4LA 4PRLA 3I4LA 3WA7A 4YRPA 3L92A 3IJPA 5I01A 3THRA 2BRUC 4OBBA 1R9NA 2P6RA 1JWBB 4DCUA 3O95A 4C3ZA 3IYLW 1M1NB 4OB6A 4E07A 4QHTA 4GSKA 4HFNA 1HL7A 5AR1A 3TCNA 1DKNA 2D06A 5EWJB 5BV0A 1MPTA 1SKAA 4R54A 5DWVA 1A4XA 1EFKA 2XYGA 3DAOA 4KSYA 1GADO 2TSYB 4D9EA 2XUIA 3UJBA 5GIPE 3VI4B 5FNZA 5B64A 2OZPA 3GGPA 1RQRA 2EHDA 4WJZA 1E61A 2RH9B 4HB3A 3HEAA 1NLUA 3PEEA 4NBUA 2QYSA 4YV1A 3CCFA 4JA0A 4DYVA 2VTBA 4D6YA 1E8DA 4NG5A 4YN3A 1S9HA 3BA1A 1WKVA 2WIKA 1P39A 3PYLA 2X19A 3U39A 2GEBA 4BEJA 4DR2B 1QZ3A 2CC2A 4EPWA 4EA8A 4OP3A 1VKNA 5KYVA 2WSSA 4M86A 5BOVA 2ZIWB 4B3DA 1ST2A 4HGOA 3TLKA 2VK2A 1JB1A 1O58A 1PZNA 1E8MA 3X1ZA 3LKZA 1H4VB 3VO2A 4WLVA 5GOTA 3DD5A 3DQZA 4HFMA 4X44A 4UBOA 1EX9A 1FNSA 1LX7A 2DFLA 2HIHA 3B70A 3G49A 1EVIA 3N8IA 3O4HA 1NM5C 2IY7A 5M5BA 1D6MA 2AZMA 4RFLA 2P6PA 3IRVA 2I6UA 2HK7A 1T8PA 2P9TA 5KNDH 4LZAA 2G0AA 5HF6A 1BCSA 3L46A 2FMIA 1AIPA 2C9OA 2GFHA 3CZAA 3ETCA 3LZ6A 1Q1ZA 4LZOA 4COOA 1DRVA 4QM7A 2WE8A 4CFZA 5AVVA 3PXBA 4H7DA 3V1TC 4MLDA 1ACMA 3DL4A 1PGJA 1SUBA 2Y0EA 2ZTVA 5DYWA 5MGBA 1S1MA 5TGZA 1LNQA 5THQA 3VMMA 4OI0A 3R7DA 3P19A 3A9VA 5CBPB 2GEJA 4OH1A 1U6IA 3P27A 4ZO9A 2PUWA 2FX2A 3EFEA 5B12A 1PJ2A 4P4TA 4ND4A 3K09A 1LS1A 2WT4A 3OFND 4X93A 4YO8A 5IH7A 4PR0A 4LEIA 2HCRA 3MLAA 2ZJ7A 1AHHA 3PF9A 2OORC 4IIUA 4D9FA 2GOYA 4DR4B 2J9ZB 2G70A 3PA8A 2V3WA 4L8LA 1P2VA 5J2UF 3TO5A 4GXTA 5ADHA 3PPWA 4KB5A 3U0BA 2JJ2A 2R8BA 3DA8A 1X7WA 3ZJYA 1G5QA 5LJIA 4Z0NA 4QXMA 1QSGA 4CDRA 2VOJA 1DXQA 2XMRA 3TINA 3DYVA 4XEUA 1WVIA 2P8JA 2MYNA 4GBGA 3TH5A 4E5SA 1GZ4A 3B5JA 1LD3A 3QVOA 3NWPA 4GX2A 3DAGA 4Q7EA 4RF3A 1I13A 3M4YA 3IUNA 1E0AA 2EYUA 1DXYA 4INJA 5G0SA 5AW5A 4ER6A 2QJFA 2Q3HA 1TI7A 1MN6A 5BQ3A 4P92A 5E6SA 5JH7A 4LXXA 2BGUA 3UUFA 2R1UA 4NSNA 3EVGA 4CKBA 4C29A 1DEHA 3N2KB 2DWCA 2BH2A 1ISSA 4IH4A 1RWXA 1B23P 2BFBA 4H3HB 2YXLA 3CNBA 2G09A 4CF3A 3PQEA 2O8DA 1G1MA 2VPWA 3M5PA 4OB8A 2IEZA 1GL7A 2BKAA 2FFAA 2Y4NA 3ABZA 2J1LA 4KI7A 3GRZA 1IUPA 4GMKA 4KLCA 4PPNA 5GONA 4DC9A 5DMHA 4IKPA 4J75A 1USUA 4IDAA 4I66A 2DFKB 2EL9A 2FPMA 3R6TA 4QPDA 5TR9A 3UFXB 1AS0A 3H5IA 1GNQA 3RK4A 3KLMX 1UF9A 5A4JA 3IDQA 2HSJA 4LOKA 1EEHA 2P4QA 4WNIA 4AYWA 5I7FA 3AVWA 2CHGA 2XPCA 1GGKA 4BEVA 5F9FA 1FY2A 1RYMA 3I83A 3B1JA 3I6ZA 3EW7A 3A2NA 4JOCA 4URZR 4FM9A 2NU6A 2Q3DA 3ZHBA 3B2NA 4MLCA 4N18A 2A5LA 4YUVA 1O95A 2NZJA 3Q8MA 3DF7A 3NU1A 5BORA 4I8XA 3OLWA 1YUMA 3T4UA 1JHYA 2BZGA 3H04A 2YWRA 3BEDA 1KVUA 3LL4A 5CT8A 3Q3CA 3RAGA 1E4YA 3INRA 5L45A 4PYKA 3ABOB 1SO8A 2YXPX 4W63A 1W30A 1BXGB 1FUUA 4G0YA 4JOBA 4N48A 1EWVA 2O3QA 4BYMA 1MPXA 4RX1A 3K2QA 3AUTA 4BZQA 1NMQA 2GTPA 1GD1O 1Z5NA 4OAPA 2WFZA 4QSMA 3GC6A 4CJXA 1BXZA 1EXDA 2WDPA 1PJQA 2A35A 2UKDA 3C97A 2H8KA 4GLBA 1H8ED 2VF7A 1D5WA 1NVEA 4RFVA 4N47A 2CYCA 3V2GA 1IM5A 1B41A 3QU9A 1G20E 3BAZA 4DTIA 2R8ZA 3EDYA 1H0KA 1WUHS 3EZXA 3NATA 1FTSA 5F23A 3O8DA 3BDIA 4OHCA 1OY1A 2D5CA 3HBAA 5CA0F 1YJ5A 4QIHA 3C3CA 1XN1A 3BBLA 4PFQA 4DUYB 2GXSA 1Y5MA 2QB5A 3DVAA 4OGLA 1P5ZB 3TDKA 2FF5A 3OIGA 2SKDA 2GYUA 4C4PA 1YKFA 2OHXA 2OSVA 1HT3A 4R81A 1J2EA 4UMVA 1V1RB 4C0HA 3WGHA 3HL4A 5IYZA 3O9MA 2QRLA 2R25B 3CTMA 4FTWA 4HC4A 3SHTA 1JJAA 1EINA 3KPVA 5KDOA 2I1LA 3HU5A 5JANA 3HCDA 4GWLA 5KI6A 3LWNA 1FNNA 1JRLA 4I6GA 2OXIA 4NNOA 5LZ7A 4ZO6A 2OD2A 1T5HX 1CS0A 3PFIA 1R0LA 2FN8A 5BN3A 3KHTA 1F6BA 2WTAA 3D6NB 2HDHA 3UCFA 3WXMA 4ANFA 4BU0A 1USVA 3HBFA 4LOJA 1TKCA 2MSWA 5KTKA 2GF9A 3VVBA 1P7WA 1TA9A 1KMMA 1O97C 1ZONA 2L42A 4JJ4A 3UJAA 3BREA 2RK3A 3CLVA 3DFZA 1P3Y1 1AKNA 1Y9AA 4C6SA 4ZHQB 2LNDA 2QTVA 3L7YA 1R8QA 3RK1A 3I2YX 1LVUA 4BP3A 3CG4A 5BSRA 1UKAA 3RB8A 1XNQB 5H1YA 4U9HS 4EHKA 5EWLB 1CUDA 4ENTA 1GV0A 4R8MA 3ROKA 9ABPA 2HRBA 1ND6A 2VXCA 1K7EB 3Q12A 1WDTA 2JGRA 2XA1A 3JWJA 4M88A 4ND5A 4O63O 4P4NA 4KIFA 4PRKA 1ZMBA 1A8SA 4H0NA 4AX8A 4CMHA 1WW3A 4EABA 4L9SA 1U99A 1CZKA 4R1SA 5JSYA 3SHOA 2W6MA 5K0GA 3UMMA 3MJVA 1BIFA 4AW9A 1XYVA 1DBIA 1IL0A 4XLTA 1RP1A 3SIPA 5J43A 5IF3A 4F3NA 4YJHA 4KOEC 1A7UA 2AG0A 2IYZA 1DG3A 3HO8A 2B6NA 3P9SA 5E1BA 1A3CA 2NYRA 3TNJA 4B3FX 3F7TA 5TB5A 5EJ9A 1LBQA 3TGLA 4AP5A 3ZHYA 1DKMA 1I4LD 4HJRA 1EFAA 5CFOA 4D7AA 1IY0A 2CXXA 2ZWAA 4YNBA 3TOVA 3ET4A 2DTXA 4QUKA 1WU7A 1YU9A 3U26A 1CWUA 1HE4A 3W90A 2FZLA 3ES9A 4N7RA 4MUEA 4E7OA 1ZEMA 2AG5A 3HV2A 1P1RA 4KYTA 4ZALA 1V1MA 5FJIA 2B0CA 3CA8A 3KQWA 5B53A 4ZOBA 4LRWA 4QOSA 1DZIA 3WIDA 3AVUA 5AQEA 1CUHA 4Q1VA 3W6OA 5EIEA 4YRIA 5FV7A 2ATEA 2PO7A 3B9BA 2PXAA 1N6LA 1TRKA 2C4WA 3PDWA 4ZI7F 1ZAYA 4RYLA 1Z4LA 1ZUNA 3TPZA 4HPJB 4DPMA 1L5KA 1RC0A 4TV9A 4GAEA 2XGGA 1JLMA 2VJKA 2G04A 4OKSA 3I58A 1C1HA 3FPGA 3TQFA 1S7CA 4MHOA 3K70D 3E9YA 3T1OA 1A9XA 4FJ0A 3U16A 1YIOA 2R86A 3PTZA 1KYWA 2C2MA 4MO2A 4YRFA 4OGWA 5KSYA 1LJUA 3HB0A 1R16A 3KJNA 4K6CA 1KJIA 1R6AA 3GFRA 3W6UA 1RZRA 3S81A 5A62A 2VIIA 4XFJA 2M2IA 4GE3A 5HDBB 3UKOA 4EYEA 1T35A 2D0IA 1P81A 1AB5A 3ILSA 2G3YA 4B75A 1V43A 2DE0X 3WLHA 3BSYA 3WQHA 1XTPA 1GTVA 1BC5A 2OWDA 1WLYA 1L5ZA 1ZPDA 2I6SA 2JLCA 3RAPR 4P4SB 1YE8A 4JQSA 1CP2A 1H6CA 5KTTA 1K9SA 1R0CA 1T4CB 1HE8B 4KK4A 5J63A 5JD6A 4GOXA 5JDIC 4LQLA 2EWVA 1P17A 4F91B 2IP1A 4MROA 4TKLA 3G0HA 3U1VA 3M6MD 3ZIAA 4WN9B 4EBFA 4Q4LA 3IXMA 2OD9A 3JARB 4C0BA 5A4KA 3VNRA 3LDHA 3IE0A 3FLAA 3EQ8A 1WDMA 5H3LA 5G4KB 3HU2A 3D02A 1JKFA 2FW7A 3GG9A 3R7WB 4KXVA 3DZGA 1GTZA 1GRVA 3OQJA 4REOA 3VZSA 2BI8A 4C06A 2O8CB 3L43A 1X1DA 2XB8A 3DO8A 4Y2QA 3ADDA 3A36A 1UBOS 2PS9A 1W25A 2XCLA 5FUBA 5EKUA 1RAHA 2O2JA 3E3AA 3GLHB 3GT7A 4PS0A 3U7FB 1PNRA 2H51A 3ML1A 4Q1EA 1GZSA 1V4NA 1YQ9A 4DLRA 1T0IA 4XKJA 5TF0A 3S5JA 2PU5A 1WPXA 5AKLA 1RM4A 3CX4A 1IN7A 1QIKA 2OV4A 3IAFA 4FBGA 3W5JA 1T4DA 3SHQA 3OTOB 3CCCA 3NWBA 1TC2A 4Z9FA 1Z0SA 5TX7A 5MF6A 1NA5A 3P2JA 4FWBA 3TNFA 1CQIB 3AH8A 5FA8A 2EIXA 1WTAA 3OJOA 1M2JA 1O77A 3QITA 4P81A 2PX8A 5AKHA 3VKVA 1AKTA 4WBNF 1JLLB 5DRTA 3TWOA 5JJBA 2BMWA 1ZH0A 2AI1A 2A0FA 3DG9A 3NC0C 4B7CA 4ZU3A 4DTCA 2PKYX 1SJ9A 4TS3A 2F48A 2ZJBA 5F2OA 1U5BA 3ROZA 4CCWA 1MJ5A 2COKA 4ACAA 4B8ZA 3C3JA 1AJEA 1MV5A 1UBEA 4JI4B 5IT9A 1XAJA 3ZE9A 1N1MA 2EOAA 3FPKA 1VBNA 1GVNB 3OPVA 3EPPA 2ZVDA 4QDXA 3WSVA 3SDBA 5D85A 3WBKA 1E0KA 3BQMB 2G8LA 1JU3A 3IDAA 5G1NA 3BXEA 3KQUA 1BX1A 3KL4A 3W8DA 1AX9A 1JU9A 3NT4A 3OECA 3G2LA 4HWTA 4N65A 4YDRA 5EXEA 1D8TA 3UJPA 1NULA 2HRZA 4BLOA 1UBRS 3G59A 2O7VA 3FOAA 5CDYA 2PSFA 2FEWB 2QTTA 3OTGA 2CSXA 1DPFA 3A0RB 2W42A 1OAOC 2OCXA 4F9GA 2LE0A 4GICA 1T9DA 3UYLA 3ZZ0A 4MUGA 4B6FA 3FGOA 4GGPA 4V3BA 1C7ZA 4K9LA 3RF6A 3AIOA 4Q15A 1TZ2A 5KYGA 3DJYA 4C4RA 4F86A 3M34A 1NFQA 4U0KA 3RHTA 1Y37A 2ZKLA 5AM2A 1MDBA 1PI3A 3FWNA 3MINB 4HEHA 4HRAA 1G60A 3IODA 1D2GA 4ZT2A 1CDZA 2E9SA 2F64A 5L3VA 1FP6A 1WOYA 5JOQA 2JG3A 3MERA 3ZZ1A 2B8EA 1WCIA 3H1PA 2Z6UA 4ZZ3A 2VSFA 4NZOA 2OWEA 4HVCA 1OA0A 2IEBA 2W2KA 1Y5LA 3RUEA 3COJA 3TQQA 2Y1DA 4I5DA 4ND3A 1DIHA 3EXIA 3WI7A 5DISB 1GTMA 1RI3A 1FZQA 2AZDA 3KEGA 3DD1A 3HVUA 2RGDA 1YGYA 3SG0A 3ODPA 5A4DA 4MVJD 3K1YA 4LECA 3UJ8A 3TW4A 4DG9A 4MYSA 4OMUA 4UC0A 4ETWA 3Q7IA 1VHQA 5IM4F 1C9MA 3FI9A 4M7PA 4MVWA 1U7HA 4NKRA 2PTGA 4XXHA 4QLBA 5M34A 3EIWA 3FPAA 2NXJA 3H1FA 1CDDA 2X40A 3KKLA 1LRLA 3KT8A 3L49A 4AJ4A 4E5DA 4OHYA 4FFRA 3QEMB 3TPFA 5CG2A 4WLNA 5DCYA 5E3IA 2PUEA 1KZYC 1WEHA 2ZOSA 5LN1A 2Z5VA 1G63A 3ZJ5A 2WJWA 2CV0A 4QLAA 1I2CA 3F5FA 1X77A 5EIHA 2FJPA 3SSNA 4NWIA 3JQAB 2XWBF 3A06A 3VTZA 1EVZA 4FJ2A 1O95D 4UD2A 4LHEA 4AZ0A 1F2VA 1XLUA 3ZHUA 4UOZA 3ZV7A 4ZICA 4Q3BA 3SVTA 5E7QA 5JJ5A 3OAAD 4A8JB 2GBCA 3CUVA 5BOSB 1X8KA 1ITZA 1WKBA 2CNDA 2Q07A 2PWYA 4MVJP 3RUIA 3F2IA 3USES 1WXEA 4BY9E 5FH9A 4F06A 2ZWMA 4B45A 4NFSA 4AYXA 1YFZA 3TD6A 3QNMA 4KE8A 4GQIA 3HBMA 4N7JA 2D5BA 2XTMA 3JD0A 2QV7A 3I73A 1B3BA 4NAHA 1VHWA 4MKXA 1U8FO 4EHDA 4PN7A 1M5UA 3IVRA 1WCV1 1LFAA 2WP8J 3Q10A 2JAWA 3SVZA 1R66A 1W48A 4K0RA 3ZWYA 4HH0A 2FI1A 4IDDA 5BO5A 1ZJ5A 4QGBA 1T9HA 4NH4A 2I9KA 4MP3A 3I34X 1MXHA 3ZY6A 5B57C 3UAWA 2BBOA 2IE0A 4HB2A 3GLFA 4INZA 2UYYA 3L41A 2PWZA 3FX2A 3TIFA 2GAFA 5C3MA 2ZRAA 3ZEAA 3B6MA 4DRXB 1FQOA 1P1FA 1N2GA 1Z15A 2VSXA 1U2RA 3R0QA 1N0VC 3ROXA 1E5QA 2FK7A 2RGYA 4WOBA 2VRNA 1FPQA 3JWGA 5AVOA 2PVCA 4XVUA 1QRUA 4HYTA 5JISA 4K5QA 1VHLA 2NXEA 4FFVA 4R71A 4N0PA 2YJ3A 3E18A 3A1EA 5AT1A 1GUFA 4GR4A 1TU4A 2WV9A 2XCOA 1M0EA 3LX5A 3OSUA 2C7GA 4W1QA 4XRRA 4TL9A 2ZYSA 1KAHA 1JYEA 1JB9A 3PQ4A 5CFRA 2ZSKA 2LD4A 5L9AA 2FF7A 1IZ9A 1WU8A 5FL7A 4CZ2A 1VB5A 1NV8A 2JL1A 2VBCA 3KR2A 1U1IA 4YFVA 1C9NA 2HREA 3S1AA 3EUWA 4AG5A 5IUNC 3U5TA 3O1HB 2AN3A 4KQ9A 1E1CB 4H3KB 2XADA 1E9DA 4YDSA 4MRMB 3AM1A 5KTOA 1AY0A 4D0RA 1OI3A 1IZZA 1A98A 3NIFB 2FWNA 2IOYA 4HG2A 1NXVA 1RLTA 4INOA 4MMYB 1OUMA 4ZCSA 2EYQA 2PLAA 4CLXA 2E48A 1ZISA 1ZD9A 2F8LA 3FCUB 2YXEA 3CBGA 3TFOA 3CIOA 2BGGA 4MGHA 5TEWA 2X2EA 4E88A 1A97A 1I1HA 1F0PA 1QFJA 2PCLA 3R2JA 5KSWB 2HLNA 3NXKA 3REFA 4B9AA 1I2BA 3IBCA 4IQFA 4DKXA 4DLXA 5IVHA 3U4DA 2E1PA 4FOPA 1O96A 4FYWA 4FS3A 1Z45A 1Z4PX 1ZA2A 1F2TB 4GS5A 3BRWD 4QT4A 3R3JA 4AO8A 4RULA 3SBOA 2VUUA 2PUBA 3TLGB 5AK3A 4EJSB 5AW3A 4RZ3A 2IIPA 2XSZD 1U8UA 5LP1A 1YZVA 5EXTA 1OX5A 4ABTA 2D1SA 5B7PA 1F0KA 3OFJA 1L4LA 1TX4B 3DZJA 1GQYA 4L27A 1LDEA 2CMFA 3MJFA 3LXUX 4HD8A 4RZSA 4IS3A 3TRDA 1DLIA 3SP1A 1PJCA 3FTFA 2V7EA 1IZYA 4OSEA 1QWSA 3KJQA 1TUEA 4PX5A 5T6BA 4D45A 5ICEA 2QLLA 4J07A 1GG2A 2ZCUA 1EUDA 1MO3A 5GGYA 4BWGA 1PUIA 3OE1A 2CD9A 2VFAA 3MXOA 2O5RA 2Q6KA 4YJHB 1E3WB 1E4VA 2XZPA 3EXFB 4CF6A 2J4CA 3ZZMA 2I2BA 1X1BA 4FJ1A 2Y93A 4HB0A 4OATA 4QTXA 3CKLA 1PVVA 1NVMB 2DZDA 1OJ7A 1DRKA 2WU4A 3I9KA 4HXYA 4K40A 2HV9A 3RYFB 3GPDG 3WL8A 5BYKA 1INLA 4MV6A 2VUHB 4UE2A 2CJWA 2JAXA 3HJGA 3VUEA 5GVRA 4TS4A 4EM6A 3PU6A 1QTQA 5FLXA 4JOSA 1SU4A 3ZJ4A 2QM7A 3X2FA 1PJ3A 4LJKA 3B1WA 2DAPA 4BLWA 1JQEA 3P2OA 1UMDB 3EBLA 1GTRA 4XWWA 2WIAA 5JMPA 1PV1A 2YVKA 3FZQA 4UFOA 4WH0A 4C30A 3F1KA 4Z1MD 1GPAA 3WB0A 4CBVA 4Q9IA 1R0YA 4UU1A 3LC0A 3ZLVA 4JXXA 3EK2A 3LUBA 1AQ6A 4IX1A 4LV8B 3WXBA 1PYOA 4CT4B 1CV2A 3HNOA 3RVBA 5ALXA 5HKKA 1MOZA 3L9XA 1JPVA 1TGYA 3ICEA 1GCAA 3K0CC 4BOYA 4OSOA 3FF1A 1NNUA 4KQ1A 4TN1A 3ZXSA 4DJFC 4JVOA 4ME6A 4H60A 1DAKA 5LMUB 2IS2A 2F17A 2HBRA 3I2FA 2ODAA 2ORIA 3L7NA 2AI3A 4BLUA 3EIOA 3PKIA 1NMEA 4EF5A 3HFGA 3IAEA 1V2HE 1P4RA 5CM8B 1EGAA 4JS0A 3ON5A 3DKVA 2O7RA 1KZ6A 1GZHB 2PA3A 5FF9A 4L7VA 3BGDA 2PWBA 3PR2B 3C0KA 1V4BA 4GX0A 4FNGA 5ALUA 3TR5A 3BM5A 1X1TA 5SICE 3GRKA 1XKQA 2I4OA 3BTVA 5BSHA 4WEQA 4HPWA 3VX4A 2G1UA 4F8YA 4KXWA 1JHAA 4NYIR 1FJHA 1ZM7A 2GPSA 4UHHA 3QOWA 3X1KA 4DZTA 2KHZA 3HCNA 3DBRA 4IWXA 1EHCA 3K0BA 5C80A 1XMVA 3E22A 5IVDA 2ZRDA 2YINC 3RNLA 1YAHA 3E81A 4JB0A 4XUDA 4ZAWA 5IXJA 2V7WA 1HEIA 3PFKA 4L3VA 2ZBVA 3T3IA 4P4UA 1Q0SA 4JC4A 4ON9A 1XJCA 2EFYA 2X42A 3LJKA 5G0WA 3H2GA 4CXMA 4DRXA 1CBUA 2JFBA 2FN9A 4EJFA 5EN4A 3ZHCA 4J94A 1MOQA 1YA6A 1UOEA 3DCYA 1K4KA 4TZTA 3DTTA 1BMDA 4RXUA 4HZUB 1ZOLA 3VPCA 4ESOA 1KZGB 1BU8A 1N8KA 4L0CA 5A5VA 1GLGA 2JB9A 2XXAB 4U02A 4ER3A 2J0QA 5FI1B 2OZEA 1S2GA 3DDOA 2V65A 5FLKA 1O95C 4PAQA 4HUQA 4L8FA 1W5EA 2PWPA 1MA0A 4OQMA 4UEJA 4ZOEA 4DIUA 3RSLA 1B15A 1P2TA 2C9BA 3RT9A 3VU0A 2QG4A 2FPPA 3GYBA 2Y76A 1CFJA 2FK8A 3E9CA 3VPFA 1PK9A 4Q01A 5AUNB 4GOOD 1Z0IA 2ZT7A 1QQ5A 1PV4A 2OCPA 1NNLA 2WUWE 5F33A 5LOVF 2VJQA 1CJTC 1U2SA 1XL1A 3PLAE 2I6QA 4DVJA 3B53X 4XGIA 1KMNA 4UPVA 1S8AA 4UTRA 5DB4A 2Z58A 4TV9B 4WNYA 4ZGWA 3SZLA 1W8IA 2HNKA 1DQSA 2DPYA 3F49S 3H2KA 4ZV7A 5ITWA 1TB4A 3M4ZA 1I4DD 4HYQA 4NRDA 5DNEA 4WA8A 4MPTA 4X6LA 2R7MA 2H6EA 4B3CA 1II8B 2EEPA 3OY7A 3NOVA 5DIZA 3QMVA 1UBNA 3TD2A 4ZTBA 3F0TA 4Y3UA 3WP1B 5JZVA 1V11B 3E05A 1SIUA 1TKBA 1CF9A 5CXQA 2JW5A 3TJRA 1QK4A 1RZUA 3K16A 4L16A 3GLHA 3QNWA 1OWPA 1JS1X 5FOXA 5CIYA 4QVGA 5DNUA 2H9AA 4A73A 3NVAA 2I4LA 3OE7A 3RJ5A 4NCBA 2SHKA 4RMJA 3I76A 1HDOA 3A6HA 3DXXA 4PAOA 3S2GA 3DEYX 2JFPA 1B93A 4MQUA 1MXFA 3S2ZA 3NVDA 5DK4A 1K2WA 4RFSB 2QYTA 1WV1A 3UENA 3F6YA 4Y2HA 2WAYA 4QRHA 3WQQA 4YMHA 3N0WA 3MQ2A 1L5HA 1KR5A 4JN6B 1W19A 3OZTA 1FFCA 3KSRA 4NARA 2ZRIA 2BH9A 4RK6A 5AI0A 4JLPA 2QTLA 4A8JA 4D0NA 4E11A 1R4MB 1P4JA 2HKIA 3AIIA 3DVLA 3CLRD 1Y8QA 2B1RA 2IY9A 4UBKA 4LSMA 4RJIA 1WL8A 1BE0A 4KWEA 2FDCA 5JY6A 2FW9A 2ZTHA 3BOSA 5H4GA 1DXHA 4DXHA 1FMLA 3JYHA 3RVSA 3D9QX 1P1IA 3AUAA 721PA 4Z2YA 2PKRA 2G71A 1W4BA 2XR1A 10MHA 4UHFA 3AI3A 4N0MA 2EERA 1GOTA 1GZVA 1U4SA 2X5XA 3DAPA 4IVQA 3PXGA 4B35A 4UHDA 4N0EA 3PJFA 4NXNB 2GFQA 3LGAA 2GEKA 3D3EA 2YICA 4OAQA 4FHEA 1W5TA 3NASA 1QQ7A 2CLKB 2EBFX 4EG4A 2ZYIA 4W4TA 1YMVA 4J3JA 1GGFA 2ZR9A 3VBCA 4ENRA 1TTHA 1KYQA 2BONA 3TLBA 5GIOE 3OKAA 3GXBA 2YY5A 4JLWA 5AOAA 2DPMA 5BWLA 1HNWB 4DCTA 1ENPA 1SOMA 4X97A 4MWEA 5IJAA 1NWCA 2PUVA 4EVSA 4N03A 1GKKA 3VO8A 1JQ3A 3PNYA 1V8FA 2AMYA 4E13A 3GN2A 1FZTA 3CKYA 4NDAA 5C4IA 2HUNA 2XQIA 1P19A 2PG3A 2DBRA 1RMYA 2YCLA 2CJFA 3SYRA 3P9IA 1J42A 3I9MA 5LQSA 4D0SA 2DHQA 1CQJB 5IXSA 1J2YA 4V0ME 1X1QA 3TZBA 2BF4A 1OJLA 1ZI6A 2WBLC 3A3NA 1PWZA 3E4DA 3KTFA 4JYZA 1DO0A 1JMVA 2L82A 4PYRA 1KRXA 4LHZA 3HVKA 4REMA 1NRWA 2V96A 2A1TR 5IHXA 3IVAA 5BSKA 5KMGA 3HUTA 3IP3A 4ZGBA 1UWLA 2NUBA 2XWQA 2UXCB 2ZSUA 2BKUA 3LE8A 7REQB 1N2OA 2FPLA 3JRXA 4FNMA 3N70A 1YVRA 2Y1EA 4QASA 5TEVA 1ENOA 4BNYA 2H4XA 3EQ6A 1C1DA 2KSQA 4NYJQ 1CUAA 4CV3A 2DETA 3TAUA 3ZWKA 4RKRA 4E6PA 4Y67A 1AO0A 1P29A 3WJAA 3ZWDA 1XO1A 1Y1QA 3K92A 4MPDA 5JTTA 2JLUA 1NAHA 1N0WA 4ZOLA 3S2YA 4N54A 3GEMA 4FGZA 4RKWA 3GVCA 2ZIVB 4Y1GA 1N1DA 1QRSA 3T7SA 4IH9A 5AJVB 5JAQA 2XBUA 2FDRA 2DQYA 1ETUA 3LWBA 3Q9UA 2WD7A 1TTQB 4W8HA 5TS3A 1H66A 2P75A 3D8NA 3NBMA 1HE5A 4G0PA 5JYCA 5DW0A 1SVKA 4AN4A 5F1PA 3A58B 2X4DA 3N8KA 4UULA 3WAGA 2N1BA 4OQEA 3M1IA 1N3IA 1JKIA 1T36A 1U0NA 3WK7A 1UOOA 2PBLA 3B36A 3ZXYA 2OEPA 4MIEA 3ZDXB 3IEPA 4E46A 1VI2A 5HRUA 2DCUA 4NMMA 1X7XB 1PG0A 1L5WA 2CHUA 3QFTA 2BGLA 5E3JA 3DULA 4AJ1A 2I6TA 2J5XA 2FLKA 5J4VA 1SUDA 2D2IA 1V3VA 3JD4A 1RYEA 4QGHA 2F9MA 2ZUBA 4A2QA 5JSHA 1UAYA 2AOUA 4YJ2A 4D26A 3ILVA 4ZAGA 1L4GA 4X8OA 3EB9A 4YCAA 5BYAA 1D07A 5IBCA 3IKJA 5CVDA 4BRZA 4BZXA 4PGFA 2AOTA 5JAHA 3EF0A 4RGVA 4EMSA 4WZBB 1I3MA 4RNDB 2XOEA 2WOJA 2Z9CA 3UWKA 4RL6A 1Z63A 2FW8A 2JIRA 1LZLA 1FDRA 1ZAKA 5TPWA 3EISA 1FTQA 4EW6A 2FWMX 1SVSA 4HEJA 4JKOA 1VJCA 4OTZA 1VBFA 3ENKA 2VDJA 2AFHE 2C07A 3E9QA 4XD7A 4YK7A 1V3TA 3LC1O 4WFKA 5EVCA 3LXRA 1PWHA 2JJQA 1G0OA 5D8DA 3D8HA 3K9HA 5K8IA 1EFPB 1AURA 2C5BA 5C5DA 1JFFA 1KFEB 2IU6A 3P5SA 3E8SA 4O8CA 4QJ4A 1UXKA 5F1KA 1X19A 3PDIA 2ET6A 3TVYA 3D3WA 4MR7A 3TIXB 5L53A 2ACKA 4IGKA 2GRAA 4DLSA 5DTMA 1P77A 4NTZA 5ALKA 3U80A 1XQYA 2RGNA 1P4SA 3IRUA 4AG6A 1T1EA 4US1R 5CTAA 2GN6A 3SEAA 1VIAA 3GJ8A 1PAUA 2FXVA 4RACA 5ER9A 3JZAA 2DLCX 3LKDA 4KBFA 1XFAA 5CH3A 3N58A 1SC4A 2WMYA 5EG5A 2XNSA 3RPEA 4BJHB 3GXOA 1E8NA 1JLRA 1BFDA 1V5IA 2WJJA 3E7DA 1XAHA 3UICA 4GPEA 5FFNA 5D87A 2UZ3A 3AJEA 5KS2A 1W36D 4N3AA 2E4XA 2EZ4A 5K3CA 5C46F 3V4PB 1IMOA 4WXEA 1SK9A 3MJHA 2W48A 4TM8A 2XV1A 3HXTA 3BWDD 4JLDA 5ELLA 4UATA 2H4HA 3AEKA 4RSRA 1T1IA 4YMIA 3LOPA 2XW6A 3GEBA 2YYSA 3P9RA 1SD5A 1FDWA 2OK7A 3D7SA 3K2IA 2B7BA 2DUJA 2X3UA 3VR5D 5F51A 1JZTA 4ZFNA 2P9FA 4D96A 4HP8A 4CDNA 2I76A 3QOYA 1GCIA 5EXXA 1EE9A 3RRBA 2E4VA 4GNRA 1CIPA 2VTBB 2CXSA 1KOJA 2JIZA 2DM6A 2YJZA 4MV7A 3BG5A 1FUEA 1ZGZA 3O8OA 4OMCA 3K5HA 3SVLA 2ZYHA 4B31A 2QROA 2FXIA 1SBIA 2GD2A 2WG0A 4OB7A 4DG5A 3QG5A 2JA1A 2L17A 4HUJA 1JKXA 1Q6YA 4O4LA 4B44A 4O4HB 1N5JA 3HJNA 4TKUA 4F4HA 1TDJA 1X1RA 2B35A 2I4TA 1M75A 4KDCA 2XUAA 2F3TA 2VJBA 4DCMA 4YFYA 1PD1A 1NXXA 1O96B 1P80A 1BVUA 5K0TA 1KZ9A 4NV0A 1XVTA 1BTOA 1CX9B 2WM8A 3WGKA 2JLSA 2J85A 3EA4A 4QUJA 4HWKA 1WWKA 1UT8A 2Y71A 3H8WA 3PXXA 3UXHA 1MC8A 2W9XA 5I7SA 3H5OA 1MC5A 2NAFA 4IDHA 4Y1RA 4B3BA 3H5RA 1V35A 1WXIA 3T6KA 4P3KA 3HWSA 5DULA 2QMOA 1C9EA 3F7OA 3LKVA 3NJRA 3IEUA 2X86A 5LUAA 1EUQA 4GOMD 1SVLA 5IWCA 1EFDN 4TYPA 3HNPA 3KIPA 4IXWA 1Y3CE 4B48A 1H69A 3ZNNA 1FSGA 1NI4B 4HQ6A 1HBJA 3CNQS 3IMGA 1EZZA 1ZQ9A 4FYJA 2X15A 4CL0A 3JAKA 5K0JA 1Z4JA 3L5OA 3N74A 1SURA 2C20A 2PGNA 3AL3A 1GNRA 4ZVKA 4FSHA 1V5FA 2VKTA 3DZBA 1L9XA 4M7WA 3V4VB 2XQJA