4IF6A

Structure of nad-dependent protein deacetylase sirtuin-1 (closed state, 2.25 a)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
278
structure length
278
Chain Sequence
MRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title Structure of a nucleoporin complex
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 84
structure length 278
sequence length 278
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4if6A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4if6A01
1YC2A 1Y9DA 4JU9A 2BRUC 2Q5OA 2QQGA 2H2DA 4L3OA 5IMSA 3D4BA 1YHZA 2VJYA 4FVTA 2EZTA 4JUDX 3JWPA 2PGOA 4RJIA 4BV3A 5EJ5A 3RIGA 4BV2A 3JR3A 2Q5LA 1S5PA 4FEEA 2A1UA 4RMIA 4I5IA 3PKIA 2VK1A 4GG1A 2H2GA 2H4HA 4MPPA 2H4FA 3FSJX 2VBGA 1O97D 4F4UA 2IHVA 4K9MA 1HZZC 2H59A 3F6BX 5EJ7A 4Y6LA 1Q6ZA 2H4JA 4IG9A 4K9NA 4K9LA 2A1TR 2PGNA 4G1CA 4RMHA 2Q28A 1PO7A 4HDAA 3ZGVA 3F6EX 4RMGA 2FN3A 4MPJA 2VBFA 1PNQA 5FEMA 2AG1A 1YI1A 4X3PA 1U2GC 2JLAA 3CF4G 4COKA 4BN5A 1T9CA 2FRDC 3CLSD 3GLTA 1SZCA 1U31A 1UPBA 2NXWA 3K35A 3FZNA 4UTVA 4RJKA 2EZ8A 4BVFA 2DJIA 4FEGA 4UTNA 1YBHA 4ZP1A 4O8ZA 1PTJC 5EJ4A 1UPCA 5EJMA 1QPBA 1YTLA 5DGDA 4RJJA 3GLRA 1Q17A 1OZGA 2AG0A 3U3DA 2VK4A 5K6RA 1JSCA 1N0HA 2H2HA 1YI0A 5D7NA 4KXQA 4JT8A 1PNOA 2H2IA 2JI6A 3E9YA 1E3TA 1T9DA 4C7BA 3LQ1A 4UTXA 1NM5C 1T9BA 2JIBA 4ZZIA 4BN4A 1SZDA 4JUFA 1MA3A 2V3WA 3IAFA 4R8MA 4RMJA 1PVDA 4FZ3A 4K9QA 1M2GA 4IF6A 2OORC 3CLRD 4IAOA 3PDHA 4V1CA 1PT9A 1POXA 4GM4A 4V1CI 5K2OA 4JUBA 5DGTA 2EZUA 5DEIA 1ICIA 4HD8A 1D4OA 4QELA 4UUAA 3ZG6A 3U31A 1Q14A 4BUZA 4MZXA 1O96B 2X7JA 3OE1A 4UU8A 2B4YA 5EJ6A 4GM1A 1PI3A 4D5EA 4D5GA 4MPRA 5EJ9A 1BFDA 3ZGOA 3EY9A 2OD7A 5BWLA 3HWWA 5EJAA 4J16C 1YC5A 1M2JA 4JD5A 1T9AA 3PKJA 4GPEA 4F56A 2FWNA 5K3SA 2H2FA 1POWA 2WVAA 1U2DC 3EA4A 3HWX1 4JU8A 1XLTC 2UZ1B 2HJHA 2WVHA 2WVGA 4L2IA 2C31A 3CLTD 5K6TA 2OD2A 4TWIA 3IAEA 4K9KA 3GLUA 4JUCA 5MFPA 4UUBA 4GP9A 3D7KA 4X3OA 2W93A 1U28C 4K9OA 1M2HA 2QQFA 4J1TC 1V5GA 2OD9A 2VK8A 2JLCA 4UTZA 3GLSA 2EZ4A 2JI7A 2Q5JA 4JSRA 4BVEA 4C78A 4UTRA 1MCZA 4JUAA 4V1CB 4Q9DA 3EYAA 4JT9A 2NYRA 3RIYA 2OO5C 2Q27A 1UPAA 5MFZA 1DJLA 2FSVC 1PYDA 1EFVA 2JI8A 2PANA 5MF6A 5FYQA 4BVBA 2IHTA 3FLMA 1EFPA 4KPUA 4UU7A 2EZ9A 4Y6OA 1S7GA 1Z8NA 1V5FA 2Q5QA 5MGNA 1ZPDA 4MQ5A 5AHKA 2Q29A 5BWOA 1J8FA 2IHUA 5EJ8A 4QPZA 3D81A 4Y6QA 4BVGA 1Q1AA 1OVMA 1YNOA 2FR8C 2JI9A 5BWNA 4BVHA 1M2KA 1V5EA 4QQ8A 4TWJA 2UZ1A 1YHYA 4KGDA 1M2NA 1OZFA 3CLUD 4GM0A 4K9PA 1OZHA 2VBIA
chains in the Genus database with same CATH superfamily
3M6LA 1UOQA 4EK9A 3K2IA 5F1PA 1M7HA 5AHOA 1MX5A 1E7YA 2JRLA 4OL9A 3WDMA 4LFBB 3NATA 2P9ZA 3QU7A 1M54A 4E70A 4AKHA 1UWLA 1YCDA 3C8UA 3USES 1WQ1R 2WICA 4FFRA 2H0AA 2YXLA 1R8SA 3K5WA 1E69A 3RWMB 2D74A 2QMEA 4X00A 1N33B 3ND6A 4AS2A 3QPUA 1P9LA 3RUPA 1RHQA 9LDBA 5JH7B 4QBFA 1GG9A 2O8CB 4NI5A 1FTNA 5LC1A 3SIPA 1UBUS 2SKCA 4D0GA 4URXR 2ORYA 2PCLA 3EODA 4IOKA 2PSEA 3T9EA 3UTDA 2GT1A 2PL5A 4QA9A 3UPUA 4ARCA 2LKDA 2YMPA 2Q9BA 2VRNA 4G23A 3LM8A 4KLCA 5ALIA 3TL3A 2PEZA 3A7DA 5JECA 1WCIB 1T9GR 3CUYA 4A27A 1OFGA 5FWXB 3FTQA 3TSAA 4JQYA 3FTFA 4MUBA 2WUDA 2XJ9A 3UWSA 2EW2A 4N6OA 1Y4DE 1W0CA 4B6FA 1UBTS 1R6UA 2D7JA 4KZPA 4A6EA 4RSMA 2HRDA 5JMOA 2JGMA 1XZEA 1F3LA 3H1TA 2OFFA 5AP9A 1MKYA 1YBHA 2Y2UA 4HMQA 3GG2A 3I3SR 1CY6A 4HZIA 4OUKX 1CK4A 5GJWC 3UG6A 1NI4B 1R12A 5I9MA 2AZ4A 4US1R 2ZI3A 4F5EA 2J6CA 5DU2A 2J33A 3E48A 3PYXA 1P9OA 3WIEA 3PNSA 4C43A 3UZUA 3A11A 3ZGNA 1HEYA 2NTVA 2ZYDA 2QUHA 3H2IA 3KZMA 4HDKB 2C0PA 4EUSA 2RHCA 1TQDA 4YAUA 1S1MA 2CC2A 2HTEA 4FNOA 2PKWA 3FTCA 5DH9A 3LK6A 2FGJA 4GLJA 1XAGA 2OHFA 5IH7A 2YC4C 4UCQA 4Z4GA 1L5YA 4UBMA 1EXVA 3ICCA 5I7RA 1MG5A 5AVVA 3SSAA 4C7KA 1MIOB 2ZRBA 3PWZA 4B3MB 3IKMB 1AXEA 3GFFA 3JQ6A 3OICA 4PAGA 4R2IA 3AR8A 5FWYA 5JNVA 2ZBPA 4I8XA 4BX8A 3L1KA 1Q0HA 4B8YA 3SZMA 3UMGA 4NCJA 3KYDB 4N03A 3LC1O 4HMOA 4XFDA 3TVYA 4J3NA 3AU9A 4HHEA 1VB5A 1YD7A 1IXKA 1Y7LA 4OHKA 4MLPA 4CVNA 1G2OA 3E5RA 3ZKWA 4RTMA 2RG1A 3AWDA 1SJ9A 5K45A 4LOJA 3G0CA 1QHYA 4WLEA 5JMTA 2PUTA 1YWGO 3DZBA 2Q8PA 5DM4A 1CERA 1V3UA 2WRZA 3N70A 4ALNA 1HYEA 2BFWA 3GZ4A 5DX1A 4DLVA 4POOA 4Q18A 1U7PA 1Q1NA 1NI5A 3TB4A 2CYCA 5JDIC 4M6WA 3LT4A 1QIEA 3MJFA 1RYEA 4P54A 5JHHB 3EGDB 1W46A 2X8JA 3BB4A 4MVJF 4D0SA 1NP3A 1QVAA 2B1RA 3HSYA 2C92A 1DDIA 3F5FA 3VJRA 3R8FA 4NE2A 2QMYA 5REQA 1QO7A 1T4GA 2F64A 2W2OA 1BDMA 3BCSA 4UUOA 3MIIA 4H08A 1VHJA 4KRXA 3WY9A 3DAYA 3UYLA 2WIGA 4EGJA 1EAMA 1JE0A 4QJ4A 3D3NA 3HE3A 5EUMA 2ECPA 4F3KA 1E92A 3FCSB 2H4YA 5DLYA 2OXFA 1EUQA 5SY4A 2NVOA 3LOPA 4ZRNA 4W9MC 3PS9A 5GJBA 1J06A 3K9WA 1XQ9A 4IKEA 2I6GA 3WISA 2B8TA 1NQWA 3TMAA 3C5CA 1YR8A 4AM8A 4ZFNA 3IPYA 1L7AA 5CU7A 3BZUA 2WEKA 4CV0A 1SCIA 3TLAA 1QKJA 4HMPA 4YALA 1ZI8A 2JAWA 4IY1A 5JNUA 3EF0A 3HFGA 3KUDA 1KZHA 3VVCA 4CNBA 5JOQA 1Z37A 3OA0A 3AKDA 2W6JA 2PKRA 2N75A 1TZKA 4ZOLF 1TYZA 2I34A 2AS0A 2ZIZA 3HA2A 4KQ2A 2VPTA 3BRCA 3HDTA 3SJ7A 3ZY2A 2VK1A 1X7HA 1AH2A 2OLJA 1P1HA 3B2QA 1WNTA 3KOXA 4AYTA 2F4NA 1INLA 1E77A 2XADA 2XMZA 2PT5A 2ZAIA 4L4ZA 5K8LA 1OH7A 4FYYA 1LBHA 3TNJA 3SF8A 4DWWA 1Z34A 3HNRA 2PL1A 3PUYA 4EG6A 3V4ZA 2A3NA 4DDVA 5A5GA 2GVNA 1R0LA 3HKDB 1KJJA 3BFJA 4CM6A 2CVFA 2G5PA 3ETGA 1NYQA 1NJGA 1QO0A 3I2HA 4X65B 4DBLE 3CF4G 2O06A 1QYRA 2XKBA 4QOGA 3EX7C 1EUCA 3AXTA 2BFFB 1VLLA 1NMYA 3ER6A 1IZ9A 4M83A 4XUDA 7AT1A 4ZOAA 2X2EA 4E12A 1CDOA 1VJTA 3AETB 4GR9A 4ML3A 4DNFA 3DP9A 1MIHA 1ODKA 5LOVA 2QSZA 2IPOA 4QGSA 1OFVA 3FBTA 4QICA 3TSZA 1LW6E 3GG9A 4N5IX 2E6UX 1F2UB 1R5BA 1VGRA 1Y8RA 2IQIA 2F3TA 2OY0A 1XXHE 2TMGA 4UDNA 4AL4A 3LBIA 2YW9A 1GEEA 1OXMA 4R8MA 4IIJF 3CRNA 1Z8DA 3IILA 1U4SA 4N0QA 1PT9A 3D54D 1AO0A 3O2NA 3QU2A 4CIAA 1NVUQ 3QU5A 4V0KA 3BWYA 2VRCA 3RAJA 2J30A 2P3LA 1ZIYA 4Z2AA 3HKDA 3I5MA 4C01A 2B8WA 3LXUX 4PCVA 3AONB 4FLMA 3LBHA 1J8VA 4R83A 1I9GA 3GJYA 1XJ0A 3DKIA 2N46A 4XDZA 4AP9A 4D42A 5A5VA 4FLFA 2PUHA 3PFKA 4NESA 4Q39A 2B20A 1SBCA 1RI3A 5L40A 1ZM9A 4R2LA 2GHIA 4J1QA 4C20A 4GFDA 2OHJA 3OKAA 2GZ2A 2H0RA 1EP3B 4WADA 1VBMA 3CR7A 4WV3A 3EC1A 3TUZC 3T9CA 3WX0A 3GUZA 3Q3GE 5AWFC 3IAEA 1KMNA 1YR2A 4AYXA 3VO8A 3PIRA 4NE7A 3D4OA 1JKIA 1G9TA 3GFPA 3INTA 4AY4A 2JIPA 2FUG1 2HDNB 2W6ID 3OJEA 1V37A 4G41A 4F21A 5BN3B 3GHHA 1JLHA 1CLEA 1RWQA 4LF8B 4EITA 1ACJA 3EZ2A 3ZWWA 1ULAA 4QDUA 1C4OA 4BCCA 3EQZA 2BONA 3HVRA 3DOCA 3K09A 4Q3DA 1N25A 4ZYVA 4AKIA 4FS8A 2DFVA 1I3LA 3I5UA 3PQ5A 3RUCA 3UIEA 3F5DA 1SUDA 3GGPA 4BMCA 1EX7A 3GJSA 2PXAA 5K99A 4EA8A 2VWQA 3D8RA 4EGAA 3B1YA 3IVXA 4GR4A 2AHRA 1AUXA 1OX6A 3P9PA 3ZHCA 5HE9A 4QQ8A 3E3OA 2W9XA 1HDYA 2JD1A 4X54A 2YXNA 4ZYTA 3QQPA 3VR6H 3ZWNA 5TPWB 1KI6B 3EPPA 5F7XA 5TY0A 2PIDA 3D7NA 1JL3A 4E7PA 1QPZA 1EWVA 1XDGA 2LBPA 1T4MA 1Z62A 2M1XA 3DMNA 2I4RA 3NFRA 4OHRA 1HRKA 1C14A 1WKVA 4OQXA 1MABB 4PWZA 5TQ0A 2LV8A 4G9EA 4M54A 3WBBA 3B60A 5KU7A 3NKLA 1QYDA 3PHHA 3ND9A 2H06A 1T5TA 1LNSA 3ASUA 5FKJA 4DOMA 5JROA 1PZFA 4M22A 3OZTA 1A3CA 4BBPA 1VHLA 5FPKA 2O20A 1Q6ZA 1P1FA 3NTRA 3DBOB 4HX9A 1W48A 3HWSA 3NUGA 3PR2B 1WXXA 1Y48E 4G4JA 4TTRA 4CTOA 3WWEA 2DVMA 1L3CA 4FC6A 4PSCA 1G55A 1E2BA 3BK7A 3ZZNA 1HORA 2DULA 3R74A 4BQPA 5K0EA 2ZJ0A 2J45A 5JI3E 2JLAA 2PT9A 2IU0A 1W36B 1LJ8A 5FI0B 1DO8A 4BE7B 4QU8A 1Y9ZA 1UMDB 121PA 1IN5A 3TLXA 3O8QA 3PUIA 3F2IA 1C3OB 4TMWA 4HRXA 2XTAA 3GRFA 3TB6A 5HIAA 1PR3A 2ODNA 1DIHA 2NU7A 3HVIA 1E2DA 3FBGA 3RK4A 1YU9A 3L7LA 1I4TD 1O89A 5IYZB 1UR5A 2E82A 1ZCZA 3DHYA 3ZLBA 1G41A 1JKJB 1LWNA 3PGLA 4G0XA 4CTJA 1Z39A 2HHCA 4HRVA 4X3CA 3CVXA 3ZU6A 3LSYA 3H5OA 5DHPA 1AS2A 2VF5X 4BB9A 4XD2A 1U9YA 1I6KA 4NNJA 4RMJA 2HC9A 1P73A 4I4IA 4WZAE 4J2HA 3SLGA 3V8EA 3WRVA 5BNTA 1F9AA 5DK6A 3LOQA 3N8HA 1JI0A 3HCRA 1OGIA 3D5QA 4X1IB 5CNKA 1KDZA 4Q9NA 5GWXA 1UJBA 4OK5A 2I8AA 4JUBA 5JDCA 2GHRA 2C5AA 3RANA 4EB3A 5LQDA 5K3CA 1YQWA 2BTQA 3GH3A 2PA0A 4PZAA 2BBOA 3BWDD 1FIUA 2I1QA 4HFMA 2D0DA 2PM8A 3G89A 4L22A 4CGYA 2YZNA 4KC0A 3LDUA 2FPWA 2F8LA 4L9RA 1AKTA 3EUFA 3FNIA 5LR6A 1IOLA 3P94A 2QPTA 3VDNB 4Z7NB 4G4SO 3RTGA 3TRKA 1IXRC 1QJ4A 2R97A 2ZBUA 3OLZA 4PX2A 2HPVA 1Z25A 1PR0A 4RU1A 4MRSA 5AJUA 4ZQGA 1ILWA 4RQAA 3BZBA 1WDMA 1JKJA 3MOIA 3IALA 3LT1A 5EPUA 3K1ZA 3ZIUA 5LQAA 1WHTA 5JCZA 2OFXA 1TZ2A 2F3RA 5KX5F 2CDNA 3LZ6A 1S8AA 4LA4A 1WDWB 2J4CA 1L5SA 5FLXA 3KYCA 3QKTA 4Y6SA 1M34A 3DZDA 3RD5A 4ZVMA 1J2RA 3D59A 4D9GA 2BFEA 3FXAA 4EA6A 1DG9A 3GVPA 4YROA 1L8XA 2O7NA 5SY6A 4GPIB 4XJVA 4G0YA 1VE3A 4EVSA 1ZD9A 3FSGD 2HZ7A 3AF2A 3WI7A 1ODSA 3ZGLA 4AZ0B 3ILVA 2XTZA 4PG6A 3SIXA 4C88A 4CMKA 3PUXA 3V55A 3C5WP 3V8BA 4HNVA 4EB6A 5EP4A 3ROPA 2IOQA 4C0KA 5I45A 4J0KA 4Q47A 4MYCA 4XR9A 1GDDA 3SS7X 1JEYA 3FVQA 5JBNA 2V4MA 2JFPA 4PNHA 4CMEA 2HJWA 1GFZA 3HSKA 1C29B 3EQ2A 3OJXA 1SQ0A 4K6HA 4U7GA 1LDYA 1D9XA 2HEIA 3BKXA 4JKOA 2WJZB 2YV5A 4JJIA 2XT0A 2W6NA 5IMSA 3JATA 5KINB 5KJCA 4QM7A 4RF5A 3E7FA 2JCVA 3OIDA 2G4VA 2FW1A 2P9QA 1GKIA 1SXJB 4N3BA 3GYGA 5JALA 3ESYA 2D6FA 6LDHA 2OZLA 2BKXA 2ORWA 2N1MA 2Q1UA 5C81A 3SK0A 2ZSKA 3AZOA 1TC2A 3KQOA 5IN4A 5SZHB 5JPDA 2JKVA 4I3FA 3I4LA 3ZV3A 1VL2A 2BM0A 1VSUA 3FWNA 4CFZA 4ENUA 1U5BB 1OW3B 4DT1A 3CLRC 4PBSA 3WGQA 4ZDKA 4AULA 3UMFA 2VNSA 3KLOA 3AEQB 2GCGA 3TLGA 2OAEA 5D3KA 1XYYA 4A91A 2JFVA 3BMNB 3N2EA 1Y7IA 1QP4A 5JCXA 3VRHA 1AKMA 3GD7A 3ANYB 4NC9A 3DXYA 1ESDA 2QTBA 2PUCA 4TTAA 3BSFA 2XUDA 1MGPA 1FP1D 4JQSA 4OFXA 3OF2A 1J9GA 4V3BA 2IWRA 4I3HA 3W6PA 1FRQA 1BHJA 1ODJA 4U02A 5TT0A 3FCAA 2QI9F 4IIGA 2A0WA 1KKMA 3OOWA 4XH9B 3LCMA 1RXVA 1T1SA 5JXJA 1QF6A 1TRKA 3ACDA 5A9SA 2WVJA 3IUMA 2GM3A 4LJLA 3H1FA 4GZ3A 4TVBA 3FOAA 3DDOA 4FDAA 2BEVB 3VHQA 2QTCA 2WYIA 1K63A 2Q4BA 3B8EA 3GDOA 4RVHA 1TE2A 3DOUA 4GLOA 4U7DA 4H2DA 4J0IA 3TBKA 3OESA 2CD9A 4Z1MD 2WT8A 2FEOA 2WHPA 5ALSA 2HU2A 5ALMA 1DDGA 1E3WA 1Y1QA 4F4DA 4KE6A 2ZAOA 1R8QA 3PPIA 1I3MA 3RRZA 1AS0A 4OY3A 3N1UA 5BW4A 4PO9A 1GKYA 1FQJA 3EVAA 4A0SA 2JCGA 1BTOA 1W2GA 2GZAA 2AKAB 3GRPA 5ALTA 4YRBA 2O3RA 3I9V6 4CTKA 3CA8A 2K6GA 3V97A 3KQHA 2IX9A 1X0VA 5LQJA 2QVLA 5F1YA 1P6XA 4GAEA 2ONJA 1PNTA 3RTAA 4HFRA 1H0KA 3U3JA 3UT6A 2YQZA 3LIPA 3PHGA 3SIRA 4TKUB 1P2FA 2P5SA 3FGNA 4HDQB 3UKDA 1SKBA 2GF2A 1HM5A 3KKOA 1UKVY 2XMDA 4DARA 3K70D 4U9HS 2Q2WA 1J0XO 1AHIA 1KQ3A 1L7XA 2A58A 4I55B 3QKIA 3ZDZB 4GYWA 2BKLA 3FWPA 4DR5B 2A5FA 4H3SA 2F17A 5DKFA 3MNFA 4XX1A 3HJTA 1U9CA 4URFA 1SUSA 4B75A 4RVSA 2ZRJA 4Q4AA 5E2IA 2X9LA 4XEUA 1IJFA 4Q1CA 2YHBA 1I32A 1EJBA 3CQ9A 5A7GA 1XNGA 5I7HA 3U4IA 1B1CA 4KLZA 4G4IA 5IVIA 4DIUA 2GN1A 1SCBA 2V7TA 2X5XA 4UMVA 2W6OA 3GN1A 1JQEA 1KF0A 2ZI6A 3DPIA 3C14C 3D2BA 3R3XA 4ZXFA 5MGNA 4F71A 5KHAA 1EQUA 1OXKB 3J81A 4BVGA 2AN4A 1W0JA 3JAWA 1FLAA 1XROA 3CUWA 1IEWA 4ND5A 1PS9A 1XRQA 2QOEA 4RLSA 1X7WB 2OG2A 5C7OO 4TTTS 1WX1A 2XUHA 5AJXA 5FRDA 1EXMA 1FY2A 3FHCB 4JUDX 4YUZA 4IFTA 4Q5IA 1FK8A 3KVOA 1L4FA 3AERA 2W2QA 3QW2A 2P5UA 4ENRA 2EYQA 4ER6A 1DC7A 2XDWA 2VQ6A 1FE8A 2ZGVA 1KAGA 3R5SA 1T1EA 4PAQA 4QU9A 1VBKA 1EVJA 1P29A 2BDEA 2P67A 3A3KA 2DUNA 1Z2CA 4YNBA 1PTKA 1QK3A 1SU4A 1T5LA 2A1IA 2EW8A 2MSLA 3DAOA 4NU0A 3DJYA 1Y4UA 4P8RA 1NQUA 1W34A 4OSPA 1FUKA 1JQJC 3DVRX 2HCJB 4ZAYA 3CH7A 4ASUD 5ABPA 3IAM1 4GQAA 4TQAA 1VSVA 1Y7HA 2BI8A 4FEAA 4HLNA 2IWHA 1RAAA 2GBLA 1Y81A 2B82A 1ZH8A 3A6JA 3AT1A 5DXJA 3BWVA 2NAFA 2ZJAA 5C46F 4YQYA 1FDSA 4KUEA 2CSXA 1H6AA 2Y1CA 1AGYA 4H7DA 1X38A 4JMLA 5F2OA 5LA6B 4YAIA 2AJDA 1SXJC 4FUTA 4R9UC 1B41A 1JQLB 1V6CA 4FT2A 1YS2X 1HV8A 3OZUA 4I2VA 3HSSA 4EO4A 1X74A 3LA8A 1SIOA 1GZ4A 4OGFA 3MJCA 4IJQA 4NZOA 5EZ5A 1L5WA 1X7YB 3M9XA 1NZDA 5FFNA 4OSEA 4RAOA 5ERYA 4Z4EA 4KR6A 2DPHA 4IDOA 2I54A 2PPVA 1YE5A 5TJ9A 1STOA 4GP7A 4PYOA 2ZJ4A 2XX3A 3H5AA 5LBTA 4NBTA 2GPSA 2WAMA 5LCXA 1QQTA 2BLLA 2J0EA 3PNVA 2D1QA 4BUJA 1KQPA 4P4LA 3T7DA 3KQUA 3TZ6A 3W77A 2C2XA 4NQZA 4OH7A 1GZ3A 4EJ0A 2F90A 5CDGA 4KQIA 2PKQO 5BQ3A 2I03A 4DVJA 2HJRA 5F2KA 3DOIA 3GJXC 5F5NA 3LFHA 4YONB 1WBDA 1AE1A 1Y6JA 3EWSA 2RHRA 3MFQA 3B1ZA 3W8DA 3JD4A 3MILA 3GRCA 3WGTA 1OB2A 4Y2JA 4BXOA 2X1VA 2XOEA 2JD2A 2CLKB 3BXOA 3DMTC 4DBLC 1LF0A 1MF7A 1JJIA 4RW0A 3PPYA 1RNLA 5K7SA 1Z2EA 5EMKA 3ZDFA 4A0HA 4JGIA 3ZEIA 4RD6A 3E2PA 2Z04A 4JOCA 4JIMA 3N6RA 1KSHA 2IUUA 4M3NA 3F3MA 4MUAA 1X6VA 4H7JA 2B92A 4MV4A 4U7PB 4W1PA 3FHTA 2O19A 1ONPA 4OHZA 4UTRA 2XCUA 1CUJA 2PGAA 5AK6A 5BUSA 2UZ4A 4JJKA 3O2JA 1ISPA 1BXRA 3CPEA 3NYWA 4JP3A 3PTAA 2CJFA 2JLZA 1QIJA 4GKAA 5HFNA 4JB2A 2PH1A 1TAGA 1TNDA 2G88A 2QSYA 3M4YA 1WP9A 3HZHA 1A95A 4LMBA 2R8YA 3ZBTA 1QX3A 4DC9A 4XW2A 3ZKWB 2FX5A 1RI5A 2YWRA 3P0RA 1JHAA 2ROQA 1N2EA 4YJ3B 1OGJA 4L6IA 5FH9A 1ELOA 5C80A 1JB9A 3ONFA 2DHRA 4P3KA 4UUMA 4CM7A 3FE2A 4OLAA 4OK6A 1BU8A 3MUOA 4JR1A 4NAHA 3KHUA 3RU3A 1NBOA 1SU7A 1X8LA 2H1SA 1Y3FE 4TMFA 4UAVA 5BN4B 3MWEB 2ZREA 1EG2A 1V47A 1Z6PA 2L19A 3EVTA 1N6RA 4LXYA 1JBEA 3CUSA 1N1MA 3ANMA 3NUQA 4KXLA 4NJEB 5EUQB 1ENYA 2HR1A 2H5EA 3NT2A 3G1WA 3EGOA 3HKBB 1EFDN 1OKKA 4L85A 5A4KA 5FBWB 1GADO 1CE8B 1ZAKA 2OXEA 4HR7A 2PUVA 2HSJA 1C9KA 1J99A 1SAYA 2ATVA 1X7ZA 2VS1A 3EB9A 3K1TA 5ALGA 2AR7A 4INOA 4K88A 4QFBA 1AMNA 2YR0A 1GCUA 3U6BA 2QM7A 4MP8A 5KTNA 3V8PA 1G21E 1PL6A 3KRTA 4ZHQA 4OIFA 4GNKA 1U7TA 1UJ5A 4M1QA 3VOAA 3ZJUA 1E3EA 1SCUA 1W85A 1T9ZA 2C5EA 1SKQA 2GAFA 2YV1A 1BCSA 1N5JA 3IIJA 4FFMA 4WESB 4S04A 2ISSD 2C00A 3L9XA 4Q0MA 4O8ZA 1PTJC 2R7AA 4FKBA 4RGYA 3OJFA 3JASA 3QIVA 4N7JA 4LGMA 1EX9A 3TF5A 1MO4A 3V5NA 4TVOA 4UEWA 1E6UA 4F2PA 1GP2A 1UOPA 4Z6KA 3ZWDA 2R6FA 4LBYA 2EFEB 1DAFA 3D8TA 4QBHA 3PEEA 5K0SA 3PE4A 1WB5A 5B64A 4M9RA 1DXYA 2GCOB 2RC6A 3UATA 1GPUA 4C4PA 5IWAB 2XVXA 5DK4A 2FG5A 3QOFA 4MW4A 1XCLA 3IEKA 1UDCA 3GIDA 5KDDA 1JG3A 3KXPA 2QW1A 3GF4A 3HKCA 1PYOA 5AI9A 3PSHA 2JFUA 2G40A 1RCFA 1S3GA 2OFWA 1KJ8A 4PZ0A 5FF9A 1ZY2A 3U3KA 3LL4A 1DS6A 1XTRA 3RM3A 2CHEA 1XTUA 3SM3A 3T9DA 3X1XA 5KTRA 3K20A 1IXYA 1J39A 2BBWA 1L8QA 3B6EA 3DB1A 3HO8A 3L8CA 3EVGA 3PCXA 2BTQB 4KRYA 3L0ZA 4Q7KA 5B1IA 4AO6A 5A1TA 1PD1A 3MTGA 4G0QA 1BMFA 2VT2A 3AX6A 4I8DA 5ALPA 1YKGA 1W0JD 3JQPA 3EBLA 4KR3A 1OWMA 1FFAA 4GOLD 4HS9A 1DQZA 3S8YA 2C9BA 4BE4A 1SY7A 4FYIA 2O8EA 2YY6A 4M60A 3EXEA 3OCZA 1PSDA 1R18A 3ND7A 1XV5A 2ZYUX 3OC0A 5ALNA 2YYSA 3BSWA 5FOQA 3SYNA 5C8ZA 5EKSA 7REQA 1GPH1 4IHJB 3IIEA 3STTA 2WSSD 5K09A 5KYXA 1GU1A 1LI4A 1VOTA 2A3RA 2WV7A 4TKVB 5I5EA 4RZXA 3U3XA 5FTJA 3E22A 5C4MA 3K53A 3ORSA 4TKMA 5IYZF 4YMSA 4Q4JA 1XZNA 4OF4A 1PD0A 1Z4MA 2H1WA 2REQB 2FPIB 5HKKD 1HNNA 1VPVA 2WF8A 3FVRA 5C4GB 2ZANA 4ND1A 3TRJA 7ABPA 4BU0A 5EJ8A 1UPXA 3O83A 1XL1A 2V7VA 5TGTA 4V0SA 5B7PA 1MDBA 1DOAA 4I4CA 5EWJA 1NMSA 1C50A 1Y82A 3NV9A 4C2AA 1GGEA 4WECA 5C5DA 3DFUA 3WKAA 2FZ5A 2D5BA 1L5RA 3TAXA 1T5DX 1Z8HA 3TL2A 2QN7A 4OV6B 1IBLB 3AVQA 3WKBA 1GNPA 1C7ZA 1KGSA 1XC7A 5JCPA 5JO0A 4ALMA 3ZLUA 3HCFA 3UCXA 1CQXA 4WGFA 1ZWKA 3WGLA 2JFGA 4P6VF 3H0KA 4GH5A 2XRZA 2NP7A 1Y4SA 3EZXA 4KYVA 1X13A 1NPTO 1GUAA 3A4YA 1NMEA 4M9CA 3IPLA 3Q15C 3KALA 4K5QA 1ZIOA 1E2FA 3BTSA 4X24A 4CMBA 2EEPA 1JB1A 4M0KA 3AKYA 4U3JA 2R87A 3ZCPA 5JNRA 2BFBA 4JFRA 3LW8A 4HTAA 5T67A 4RD2A 3TE7A 1SHUX 3KAKA 1GPKA 5BW6B 4BWVA 4D9BA 1E94E 4CU5A 2WWYA 1UKZA 2JBAA 4W6QA 2P4UA 4GIBA 4LOAA 4TKLA 2WUWE 2OFOA 3LYHA 5BO5A 2Y1GA 3OWOA 1IQ0A 2ZJ3A 1ZSYA 2C2MA 3K0BA 2GOYA 3ZGXA 2ZQ5A 1JT2A 3BXZA 4BKQA 3BILA 4BMZA 5D85A 1P31A 3EFHA 2QE7D 3QBJA 1HX7A 2YXPX 1ZVMA 3EZ9A 2XNCA 1DIAA 4KNVA 3A9WA 2AUTA 2IP4A 2CJPA 4XQ9A 5JXIA 1GPLA 2VHJA 2GJKA 4QSHA 1Q92A 1V1MA 2HADA 4TZTA 3TEMA 4BYMA 2LZ0A 3NX4A 5CVUA 1AKYA 3Q9SA 1KOGA 2O8NA 2V6IA 4BMXA 4GI7A 1J5PA 3NQ41 2J4FA 4S2EA 3KKKA 2CLEB 3OAAA 2J9FB 1L3BA 4G0OA 3M6FA 3NHJA 6PFKA 1UFOA 3PX7A 1KSJA 4GSYA 3HUDA 2AJTA 2BMJA 2DBZA 2XMSA 2FOIA 3DL4A 4BBZA 4NMXB 1YBMA 1YK1A 1EFVB 1WP4A 2G6TA 4QBKA 3B38A 1RC1A 4TSRA 4UBLA 4C4RA 3IIIA 2RHLA 1ZZEA 3PTZA 2IXEA 5LB4A 4DV3B 1Q1GA 1P39A 1NQ5A 1ZO8A 2FR0A 3GT7A 4UUNA 5EJAA 2ZYRA 4YPOA 2C5FA 3LF1A 3FI9A 2H57A 3WB2A 4E5DA 4MUNA 4MGIR 2YASA 1FYXA 1KIFA 1WPXA 2VSOA 3L8GA 2R7KA 5JZ9A 3B6ZA 1ZL0A 3GGJA 3KD3A 3KWJA 4MUGA 1PFVA 4OA8A 3ZK8A 2I99A 4B2IA 3NBKA 4HNQA 4RZUA 1Z0AA 3D7KA 4M8NE 4CMJA 4O33A 1QYCA 2FETA 1RQGA 2GILA 3L18A 4IVNA 1ZK1A 2CKDA 1IBSA 2QZSA 2QM3A 1JHDA 1HQYE 4K05A 1ZP6A 4YJ2F 2OO5C 4YVFA 3JU3A 3OZIA 3JTEA 4W1RA 2F8TA 4LZLA 1U6JA 2JHPA 3D31A 1BH6A 3OIFA 2OP1A 4GVLA 4NJMB 3QJ5A 2YICA 2CXTA 3I72A 4IHJF 4ZAGA 4EBBA 1KZ4A 5IJ9A 1Q1ZA 2KWIA 4D4GA 1E9EA 1GRCA 1E8NA 1HOXA 1P1BA 1Q7CA 3H8SA 3UQYS 1Z5GA 1OVMA 2QIOA 5DNVA 1SUCA 3LBNA 2C4HA 3S8MA 2A59A 4R9SA 2OGZA 2X1MA 3ZTTA 1SHZA 4NMHA 3R9IA 3RYCA 1RWXA 1RWOA 2YWBA 1GTRA 5KI6A 1JEDA 5GIOE 1QIMA 4KFSA 3CTPA 5CDFA 4FX5A 3JWEA 1JWLA 2CLCX 1ULHA 3HA3A 3AINA 3AIIA 3AVUA 1JLRA 4QX6A 4MKRA 1LX7A 3PRYA 4NP6A 3D8UA 2QNRA 1J97A 1M9NA 2ZM5A 3FX2A 1WUKS 3LPMA 5SY9A 3R76A 3HGMA 3SQOA 5IF3A 2C5LA 2H2AA 4HC4A 1DZIA 1KFKB 3C5VA 1FC0A 3O5AA 3F5SA 4L16A 4XD7D 4BVAA 3NV7A 1OIVA 2R8EA 1PK8A 1J56A 3PXUA 2Y3IA 4I1IA 1XCPA 2P6OA 3ZW9A 4J43A 4DR2B 4I55F 4O5AA 1NXTA 3VMFA 3V1YA 3QMMA 1KBQA 3FMIA 2QUAA 1XTPA 3PFFA 3B5EA 1Z0KA 4H4DA 4MROA 4OGGA 1G5HA 3FDIA 2G0NA 2CNOA 2WJYA 3CE6A 2WUEA 1OLXB 1WW8A 2VDOB 4Y67A 5AIBA 2E7ZA 5DFAA 2NZYA 2QTWB 4FI3F 4CFSA 1XXHB 4O2LA 4HDCA 3T7CA 4GRDA 4LMRA 3QX3A 3MWJA 2ASEA 4FOLA 5FORA 1WCXA 1D0VA 3L07A 3FOZA 2ADMA 4YRKA 3O4RA 3RHFA 3ZGYA 4JEHA 1YS4A 3OEHA 4IDBA 4A82A 1LLQA 1VCIA 2BUBA 1Q7GA 3TZEA 1IB0A 4DMKA 1SVNA 5J2UA 1MA3A 3T3EA 1Q2UA 1XZQA 3COVA 5AVQA 8GPBA 1O95A 3WV4A 3VHXB 1BD3A 1ZSNA 4HH1A 5EIBD 3TIXB 4UC0A 2FPKA 1KKLA 2ZQYA 5DYNA 2AE2A 5JPCA 2HM7A 2VP4A 1Y5NA 1YRAA 3H9JA 3ADPA 3PZBA 5G3ZA 3UFXA 1I2CA 2G5CA 521PA 4MVWA 4O02B 4OXNA 3WJ2A 1IBRA 5FA6A 4Y2TA 5JXWA 3K8ZA 3PFIA 1OX4B 2DTXA 2QSJA 2RGWA 3VGPA 3NMUF 2GN8A 1YKFA 1Z5PA 3A2NA 3CPHA 2BV3A 4X8OA 2O8VA 4Y0NA 4ZVNA 3ZJ5A 5F7OA 5JBIA 4LX8A 3QPBA 4YRLA 4WACA 3EEQA 1R9NA 2GNOA 4Y2VA 1MEJA 1YJ8A 3DCIA 3IVCA 5FPTA 2GFQA 3N8GA 3TGWA 1I7SB 3HZRA 5HQTA 2E87A 2PTGA 1JKMA 1I1OA 3DCJA 1QQ6A 4NJMA 1OLSB 5I48A 4QE3A 1IDOA 4L4UA 1VIVA 2FMXA 4Z3OA 1H9AA 4HH4A 4O59O 3I2KA 5TF4A 3DG9A 1AQYA 1NBME 5CH5A 4PTYA 2OCYC 2DWPA 2JH3A 2X8JB 5KCMA 1Z0UA 4GD3Q 4A0FA 2PMBA 2V54A 5BQXA 1AKVA 3ZV7A 3O95A 1VPEA 1M72A 1G2QA 4M37A 2R47A 4M1MA 3UJ9A 1VKJA 3OZBA 3D2CA 3C8HA 4LFAB 2YC2C 3RYFB 4DG8A 1VGQA 4QVIA 2NUPA 2RGNC 2QT1A 1NRIA 4NU8X 3PR1A 5KAPA 2NUAB 2J3EA 2C5BA 4NDZA 5WRFA 5BWNA 1VZ2A 4MV6A 4NZNA 5AJTA 4C4XA 4D8TA 5DSZA 4MJ7A 3AI2A 3KSZO 1I6WA 3BWXA 1EBUA 4JSTA 4UCWA 1L5LA 5T4BA 4FU0A 3VU0A 3IPCA 1QTIA 3QG1A 3ZBQA 2CLMB 3C15C 2FMHA 4DTIA 4P3XA 3IVGA 1M1YB 4JHLA 3K9NA 4UFOA 2AKYA 4BV2A 1ECBA 1YS9A 2C4VA 2IYZA 1ZXXA 2PS0A 3D7SA 2C2OA 4FFLA 2O2ZA 3U0VA 4F84A 4F7DA 2O57A 4KQHA 4M7RA 1H85A 1DEHA 4JBHA 3VTZA 4HB3A 1E0KA 2I8LA 3QK7A 4R1SA 1GDHA 3AGPA 5LXTA 3OJCA 3U44B 2WC1A 1J2TA 3MS2A 1Z6QA 2PL9A 4HDSA 4K1LA 4KMRA 4KX5A 4PYJA 4M53A 4EEKA 4N7BA 2IZOA 4EYKA 3P0IA 4K28A 1ML4A 3VUEA 1TYAE 5C52B 2SICE 3V1LA 4XDHA 1WAMA 3SQDA 1HWYA 2HSWA 1OH5A 2XNKA 1FFXA 1G7TA 1SEVA 3C87A 1JFTA 3P2MA 4JEMA 2P30A 4HTFB 4TTJA 5GM2A 1PL0A 5E6UA 4C03A 1QHXA 3U40A 2MSEB 3I9KA 2Q3FA 5KJ6A 1DHTA 5JCJD 4MQFA 4FSHA 2AXPA 5DGDA 3IKTA 3IVAA 4N5NA 4JI8B 1FX0A 1KK0A 4ZK6A 4S2UA 1O6GA 2G1AA 2DWOA 3HYRA 2ICAA 3DGEC 3F47A 1VHTA 2WR8A 3FFBA 5K3BA 4EF4A 3SVLA 3Q8WA 4MYDA 5HBGA 3LP5A 2VJPA 4BO5A 3TLMA 1EXNA 3NEJA 4IF6A 1CUZA 1I1NA 3P9XA 3QLTA 4PIVA 2CHFA 4Z49A 1VMAA 2B6HA 3EDRA 4AJNA 1GGJA 1TYDE 2CZGA 3M4JA 4PAOA 3SE7A 1R6XA 1RC8A 3AG5A 4TLMB 2XUGA 4HB2A 1I1QB 1I8TA 2NLOA 3KSMA 1MAAA 1DPFA 3A32A 3DE2X 4Q9AA 3RAFC 2FE1A 1JJAA 1HMYA 1K68A 1TM5E 2JJYA 1N8SA 4L5CA 1TU4A 3QF7A 3IUJA 4GKKB 1Y80A 3F3KA 2A0KA 5E6UB 1M1NA 2AD1A 1A4XA 1H8HD 4OJQA 3S5JA 1P2SA 3FDZA 1PFKA 2QX6A 4P32A 3AESB 4OATA 4XTCS 5AM4A 1E32A 3OZGA 1K1EA 3UENA 2OCLA 1YULA 1TT5A 3OM8A 4OAQA 2Q99A 2PX6A 1XKTA 2DBQA 1UM8A 3FYUB 4IF4A 5C8XA 1OLUB 1M66A 1ZGHA 2J5XA 2PH5A 3DVAA 5TQVA 3S1AA 1U04A 2XUPA 2IOYA 1PQUA 1OTHA 4PGAA 3TI7A 1ONBA 2XXAA 1WMEA 1L3IA 3SVZA 1B8PA 1R74A 2VNKA 4MKZA 3FOWA 3UN1A 5L7TA 4YP0A 5EGSA 4INPA 4FFPA 4JA2A 3Q8KA 5I4CA 2JGLA 4DSOA 1XTIA 1D04A 3A1CA 4PQFA 1Q7RA 1A72A 2I7TA 2VA9A 2JEZA 4CLHA 2OV8A 2NU6A 3FFXA 3Q1KA 4G5SA 4GR5A 4NL4H 4QNMA 3WWCA 5LNK1 2HBRA 3N0WA 3PNPA 4LNUB 4EY8A 2JFHA 2P75A 1UPTA 2J3JA 4WJZA 2GJSA 4C5CA 3GEBA 1Q1AA 4PXYA 1M2FA 2QPAA 4GZLA 1KOLA 1UBRS 4DQLA 4ZYWA 3BGIA 2WMOB 4DSTA 3KQMA 1KI7A 1JHMA 1S01A 3QUTA 2Z2XA 1CXZA 2P11A 4ON9A 4N41A 4NCBA 4QTTB 4EABA 2G72A 3H1PA 4ZVTA 1MNAA 5KTTA 2X0IA 3JALA 5HFAA 4ARSA 4QL3A 4Y1EA 4U2KA 1SPBS 4OHXA 5CA0F 2I2CA 4JLUA 5IHXA 4PGMA 2H8KA 4HWOA 5TDHA 2DR0A 3U7EB 3ZI4A 4AXXA 4FM9A 3U44A 1H6DA 1RSZA 3KOMA 3CVVA 2WUGA 3HI4A 1F2UA 4GG1A 2ETVA 2IDKA 1JHZA 3E15A 2E48A 1BQ3A 3MT7A 3NT5A 4IRMA 4DRXA 2HYDA 2PN1A 4K9MA 4NONA 1UPFA 3H19A 4WKGA 1PL7A 4QC2A 1E3JA 2HF9A 3GOHA 3QQ5A 5FJJA 1YIOA 4ZCIA 2VJMB 4ZI5A 1A8HA 3IEPA 4MVJD 4RK5A 3OX3A 3LTNC 3HUTA 2V98A 1ODFA 3DDUA 3QVUA 1UCFA 4BN5A 1F6BA 4BO2A 4QYIB 2X4GA 2BFPA 3O03A 3N8KA 1JRLA 3I1JA 5DHAA 4XVCA 4JI4B 1ENZA 1YQTA 4JSYA 1USVA 1TLLA 1X7YA 1QPBA 2OHIA 4CF3A 1Y9JA 3U7IA 4B3FX 1RPNA 3HABA 1KI9A 1HDZA 2D8MA 3G23A 2QWXA 1ULZA 4ENQA 5K6RA 2VHXA 1MC1A 3CZPA 1CVLA 4QJ5A 4F2HA 5KNCA 1QHHA 5CFNA 5JAHA 1N6LA 4BO4A 4JBYA 3AW8A 3K7EA 1JHYA 4YMWA 3TXYA 1EBFA 1LQTA 1OZ0A 1WMAA 1N2ZA 1E6KA 1FP4B 2WJWA 2ZITA 5DI9A 5JT1A 4P58A 1Q11A 4EG7A 3VPBA 2UVPB 3C70A 3DCYA 4MIYA 3I4CA 4TN1A 5EVCA 3U7HB 1TVEA 4UUAA 4FJ0A 5LB2A 3GJQA 4XLZA 3CPSA 5GGXA 3TLZA 4A2WA 4BXOB 2A0FA 1SVKA 1X87A 2UDPA 1MX9A 2YFQA 4QQKA 1FFBA 3OY2A 1THGA 4B87A 1Q20A 1PR1A 2NTJA 4TZ0A 5CD1A 4OMFG 3MWGA 2NT3A 2WT9A 4MR7A 4A8PA 4CI0B 1GPDG 1D0SA 4YJGA 3UV6A 2R7LA 3IKJA 5E1DA 2PZEA 4FYWA 2BJWA 2OBYA 5A4DA 1W1IA 3SP1A 2D2XA 4QUHA 4CEHB 1Q0PA 1R4NA 1Y37A 3PF9A 4YJKA 4UBOA 3ORQA 4GBGA 2ZJ8A 1RYYA 5FWNA 1WXWA 4JC5A 2GGSA 3OIYA 1RE1A 1REQB 3F71A 4ZQIA 4AMGA 1LBTA 2GN4A 4YI3A 2UYYA 4UD2A 3THYB 2FG6C 4ZA2A 2VK2A 4G0UA 2F1JA 4CM9D 2FX2A 3WV5A 3EG9A 1TB4A 4K9SA 4S1PA 1RWMA 1XK6A 5E3JA 3VC3A 1UEJA 4LGYA 5ADHA 1MU0A 4P33A 2XUZA 1KZ7B 3UJHA 2G63A 1V5FA 1UC8A 2FUG6 1GAXA 4FHEA 2WB2A 3FJOA 3INYA 3HYLA 4LEIA 3IA2A 4Y9DA 4UHCA 3TTUA 2Q41A 2H1OA 1PZMA 4FNMA 4LDQA 3EOZA 4AZ0A 2IRWA 5CFLA 1JLLA 1MMFB 2WJIA 3GCWA 2EX0A 2X5JO 3KYBA 3UAWA 4ESOA 4V02A 1DOHA 1YC2A 2FHPA 1JMYA 3KM0A 4Z9XA 4GOMD 4F8JA 1JVBA 4LSWA 5AW1A 4PGHA 3W5BA 1JU3A 1GAJA 3EAFA 2IUEA 2X1LA 4UHHA 3OZXA 821PA 4YP1A 3R6DA 3OKPA 4BWGA 1EWRA 4HGRA 5THQA 3AUKA 2OBXA 2X41A 4BEWA 5LFAA 1UKBA 1ZUD1 4HNGA 3AR9A 4RTRA 3A14A 1SQGA 3KDAA 3BIOA 2QTZA 4DR1B 1DTSA 1HO3A 1SBTA 3DUWA 4R51A 1QPGA 5KWSA 3OPYB 1SHJA 2Z9DA 3B70A 2I6FA 2J31A 3CC8A 3L0PA 2GI4A 3LQFA 5CA0B 5HZGA 2JLXA 3OUUA 3UMCA 1KC1A 1QS0B 3A6HA 3AM3A 2C7PA 1B15A 2M6KA 1QO0D 3UOAB 3LLSA 3I6BA 3R7SA 4RABA 3QF4A 3PE3A 1WD7A 2L0XA 4R1NA 2CJWB 3R3UA 5CFMA 4YAGA 3FW1A 3M70A 4P98A 5HM8A 1L7OA 5K01A 1DMSA 4OLBA 1ZK0A 1MX1A 3ANTA 2WSIA 1VKNA 1JQAA 2FQQA 5ICMA 3NDBB 5BYJA 1FMCA 2JVIA 2RHMA 2VNHA 1Z2DA 1ILEA 1IDN1 3EEYA 3FNRA 5EXPA 5ERGB 4ZZ1A 1Y6FA 3OTQA 1CLUA 3PFBA 5C3MA 1CPYA 2GPBA 4I4TA 3Q0IA 1H2AS 4ZQFA 4KXWA 4PG5A 4MICA 1US8A 4GBMA 2VHQA 4NARA 1ZJYA 2NZ8A 2NUTB 3DO5A 1HTBA 4XIIA 3KPWA 3N5KA 3SC4A 3WLPA 1UP6A 2X86A 5H8WA 1ANKA 3G79A 4WRRA 4C05A 1E7QA 2L42A 3FWKA 1ICIA 1PUIA 2LDXA 1SU8A 2I2DA 3PXAA 4YCNA 1JWBB 1V25A 3ED5A 4GZMA 4RVDA 2FV8A 4C04A 1GXSB 1GYQA 1I6MA 2QLJA 3B5IA 3O3CA 1ZVJA 3COZA 4UVEA 2FW9A 2NV6A 1QYVA 2AE1A 2Y27A 3HWWA 3PF8A 4LYFA 4CTMA 1V11A 2OSVA 2VA8A 5DX0A 1Y89A 4E7OA 5B6JA 5F98A 1CYEA 1FQWA 1WV0A 3VPGA 5LA6F 3L4JA 3A0RB 2H92A 5CT8A 1XO1A 1MO6A 4KPGA 2FMKA 1ETUA 4O2AA 5ALFA 4HT3B 4IGAA 2F3UA 1NN1A 1PZNA 1RCTE 2Z56A 1S2MA 2VF4X 3ILSA 3LC2O 2OOSA 4G84A 5L6LB 4TKVA 5ES3A 4G2TA 4X3OA 3NHRA 4X60A 1N75A 1FDWA 3I9LA 1G0OA 3G5UA 1RABA 4QTUB 2NUTA 3G9QA 3TOZA 5FI1B 4PLFA 4DADA 1W581 3O38A 3ZJYA 3W1WA 2XXBA 5F1OA 4N01A 4QAJA 3WGHA 1PGQA 2IGBA 2XKKA 4UVDA 4BQQA 2B0CA 3ETJA 2RHDA 3L40A 1CEYA 3U7QB 5JRDS 5JBQA 4M1SA 3WZMA 2HZBA 2O0HA 4AJPA 1HYHA 3NJRA 4FE3A 1A4UA 3DMHA 2QL9A 1ODIA 2O5EA 4JI1B 1PWXA 4US2R 2QI9C 4CKXA 1OPXA 3SXUA 2OZKA 4WXRA 2EKDA 5B1DA 5I8WA 3K5HA 4ENTA 5JAMA 1RLUA 1EWKA 1IEVA 4L9AA 3I52A 2EBFX 1NY6A 1WABA 1CZUA 2WKQA 3BGDA 5F4BA 2VUIB 3I05A 5IVDA 4E30A 2CVPA 4JL5A 3JCZA 2QE6A 3OO1A 4QUDA 1GTL1 4R41A 3MMZA 3LVQE 2I4OA 5JH7F 2Q49A 1XZHA 3BHJA 4OMUA 4Z4QA 1YV9A 1KVQA 4U9IS 1NVWQ 2JFNA 4U3JB 2O9JA 4RMIA 3PL5A 4QGAA 3SLKA 2AA3A 3BEOA 3CN7A 5KNBH 2A78A 3LP6A 5KYWA 2REXB 2C4WA 3JTMA 1A9OA 5CVJA 1IN4A 1EG7A 2XVAA 4LI3X 4R1QA 1U1EA 4R7ZA 4ES6A 3F3YA 4FOPA 3JD2A 4B83A 2Z4SA 5TPZA 5EJ7A 4RNCA 1GD1O 4IEFB 4RC9A 4BCDA 1T4CA 2GS9A 3T61A 3SWWA 2ONZA 4G0WA 4DLKA 3HEBA 1I1HA 3L6UA 3S68A 1FOEB 4ZHSA 4WZAA 1TIBA 3F5QA 2IYTA 2GLUA 4UKDA 3O2SB 1IHPA 1EM8B 1RXEA 1WO8A 4R5MA 1E9FA 2IW1A 1LGYA 1CUYA 3SR3A 4HDMA 2BC9A 2PY6A 2ZYSA 4CF7A 4RELA 1VXRA 2BFDA 1ZN2A 2IKSA 4PPFA 5ENDA 3RVLA 4LTNA 4JVLA 4P7KA 4JB3A 1SIUA 3RTEA 5EXEA 2VK4A 3FFTA 2ZE5A 4NH0A 4R81A 4U2CA 2B21A 2V7XA 2WSLA 3BZWA 4XWTA 3CB4A 5C7LO 2H2IA 1NN0A 1KETA 1DAGA 4UTXA 1CF9A 1NT4A 2JIBA 4QO7A 4A3SA 5CDYA 4OLHA 2I1VB 3JWJA 4EVIA 4OU5A 1ID8A 1X14A 1PR2A 4R2HA 4FJ1A 3TXAA 2H5IA 3S40A 2JZNA 3ZW7A 5CFPA 1NU6A 2DXIA 3AQIA 3RDPA 2FAXA 3GEDA 3UJDA 3PV0A 4KXVA 1XZMA 3L8YA 4YAFA 1OB5A 1XMJA 1FQOA 4BQRA 4ZV4A 4C06A 2E4AA 4KVFA 3S8EA 2MYPA 3FPAA 2OXRA 4FD3A 1KXZA 1YRHA 1NQAO 3HJGA 4J8PA 2D3WA 2H0QA 2O07A 4KIGA 3VNRA 3AY3A 3VPHA 4AJIA 3C3KA 3TG8A 1KMHA 3S2UA 3BERA 1CIVA 3MERA 3H11B 2C2YA 4GEGA 1FLDA 3GW8A 3FCUB 2OYCA 3C98A 2WVHA 1C2TA 2BJHA 1N4AA 3PXGA 1DEXA 4LV6A 1WDKA 4RZ3A 3FPJA 4KL8S 2IDJA 3MJRA 3R3JA 3CLVA 3NHSA 5FBLB 2HTFA 2IOFK 2OFPA 1Z4KA 4EA9A 4NLLA 2QD1A 3UUFA 5A4JA 1A97A 4RDCA 2RGNA 3I04A 1B43A 3QKUA 1C8VB 4EHKA 3ICVA 4UTZA 4NAVA 2NG1A 2RGBA 4KQWA 4QTZA 5K8UA 2PK3A 2XA2A 4Q7JB 4P53A 3P0FA 4DXDA 1ZL2A 4MCJA 5FA8A 1B26A 3RRXA 3LU1A 4B6QA 4B3JA 2G76A 5BP7A 1YR7A 3LHKA 3I5AA 3V1TC 2DWQA 5KYUB 3HXOA 3QKRA 2A8YA 1H1LB 1ZNWA 5ICSA 5BORA 4C2TA 2ZUCA 3P2JA 1BWQA 3E5HA 4DA8A 1UT5A 1V95A 1W88A 1WCIA 1Z5OA 2AX4A 1DBWA 2A57A 5FUVA 4MPDA 3AUFA 5ER6A 4OI4A 1IVSA 2NPOA 2XOKD 1NBWB 4H59A 5FPHA 1KEKA 3QYFA 1JAZA 4NENB 1GPAA 2IT1A 2OYSA 3B9QA 3PQCA 3V2UA 4E14A 5I9NA 1H2FA 1W2HA 2VZLA 2WV9A 3HYTA 1FNBA 2FK8A 4AWAA 4FZVA 1U7WA 1QBGA 4O29A 4UHDA 2NP6A 1H2YA 3OLVA 2JHFA 4R3NA 1RQLA 2XIJA 2ZTUA 3L7DA 4MQ6A 4U7TB 4WK6A 3AHEA 4YMUA 3E2IA 3BE6A 1E64A 4RNDB 4LWPA 5FPSA 1CV2A 4PY2A 4ERNA 4K6FA 2A1UA 3E18A 3E3NA 3W4KA 1V8BA 4QXMA 2P3SA 5K6AA 1EI9A 1X1AA 3G0IA 2H4HA 1XA0A 5EMLA 4PAMA 3TYXA 4O8CA 5FUWA 2EEZA 5IBPA 4BL5A 3G17A 1XQVA 1L4NA 4DFDA 1SD5A 3AHCA 1UMBB 4AVYA 2ZVDA 1E58A 2E9SA 2FK7A 1KMIY 4WJLA 4EARA 5LUAA 2RI1A 4C0WA 4B45A 1MNQA 2FP4B 2OMKA 3EEFA 3OP4A 1X80A 1PO7A 2R6AA 2ZR7A 4WMLA 4F5WA 2DYKA 3ZHUA 2WI8A 4ZEWA 3GP8A 1S96A 1Q16A 1XXHA 3K30A 3UJCA 3IOYA 1OWLA 4COKA 1WY5A 1BMFD 2P35A 2C99A 2WD7B 4K6CA 3ZHXA 1L4GA 2WWHA 5BVHA 3VU8A 2IFTA 3AKEA 3VOBA 1K75A 3KKQA 4YEDA 3NBXX 3NIDB 3KQYA 1G3RA 1YL5A 1PJQA 3I0NA 3U3DA 2YY5A 4HWRA 4IJMA 4LF9B 1VYUA 5BV7A 4PHCA 3NR2A 4IUYA 2BAGA 4Z8XA 5ALJA 3G8CA 5AM0A 3CBGA 1LTKA 3A31A 3DDCA 1AHNA 3DL7A 1OA0A 4UHJA 5C8DA 5K0BA 4NCAA 2YJ4A 4R8SA 2V3WA 4FYMA 1BA3A 1U8TA 1WXIA 2WZQA 1M2GA 3HC7A 5JATA 2V1UA 3K05A 3BYZA 2O0JA 1GQYA 1VHWA 3L6DA 3TOVA 3ZYCA 5B6PA 1H4SA 4LJ8A 2QRUA 4JJZA 2BMWA 1VM6A 2XKAA 4UHKA 4WFIA 1W1UA 3C6MA 3FBWA 3SDZA 1I0ZA 1DRKA 2VHUA 3LC7O 5I7SA 1XRMA 4BTEA 1QRDA 2I7XA 1W1WA 2GJ4A 2OVBA 4F3TA 3W34A 2XB8A 2XQGA 3EXG1 5EJ9A 4WKCA 5EKTA 1WRBA 1CHDA 3DOFA 2XDYA 1QOQB 5DHSA 1BZYA 2W2MA 2XQJA 3KQPA 2H00A 1DMRA 2BGRA 4UQLA 3FKJA 5FOTA 3ZU5A 2KB0A 1FFSA 1NAHA 1QIIA 5G0SA 4H6PA 4P80A 5DM60 1Z15A 2NADA 2QAGC 1JQ5A 4OHOA 2JGDA 4GHWA 5BSGA 1E2MA 1G5FA 3ILHA 2ZIFA 4ECEA 5AVSA 3PC4A 2WDPA 1TUGA 2IH4A 3IMGA 2FUCA 1W19A 4KXYA 5HMMA 4J1NA 1UH5A 4MGHA 4WNIA 3UC9A 2WD9A 2I3ZA 2ZJYA 1NWHA 3GNSA 2NU9A 4C6TB 4IMRA 4ONEA 1LJLA 4GW3A 4J6FA 5TMDA 4YRJA 2VJCA 2RDMA 1VL5A 5BN3A 4YRFA 5DYGA 3O1JC 5FYQA 4WSOA 1DZ3A 1Q22A 3VDRA 4D81A 3CB2A 1RYDA 4S1NA 3TW6A 3EVFA 3EXIB 3A36A 1HL3A 5DHFA 4KH0A 4E1AA 1UBLS 3DXZA 1J8DA 1I7LA 2QTGA 5AHKA 3SR4A 1SCAA 5EXDA 1KYWA 5KNDD 5LQRA 1UOEA 3B2NA 4HDOB 4FMPA 1L5ZA 3DNMA 4MV0A 1T1JA 3LUHA 2VEOA 4EKYA 2DR2A 2W22A 2MINA 2ZRMA 5FAXA 3NGMA 4P0PB 2WWRA 1OSNA 1UWKA 5FLKA 2NQTA 4N8DA 4J4HA 2WUVA 4B33A 1RBQA 4EG1A 4CLDA 4HDRB 3H8WA 4JI7B 2DRIA 3V4PB 3ZQJA 5GZ1A 1PDWA 2JGNA 3GRRA 3ONWA 2GUGA 2VDPB 4OXIA 4REQB 5B58C 1OI3A 3OEWA 5IKEA 1XF1A 3VDXA 1ZJ4A 2P90A 4WWHA 3WWPA 1N8NA 2YUTA 5CVEA 5ERXA 1KJZA 1UJNA 4CQMA 1DKQA 4L3WA 1QHEA 2X3FA 3IT0A 2EWVA 4RPLA 5AW7A 5B4UA 1AU9A 2HK6A 3QUAA 4PE5B 3WK9A 3D4IA 3WSVA 4ARAA 5G40A 4Z9AA 4B6PA 3ZJTA 4L5AA 3LYUA 2CGEA 1X1CA 3PUJA 1P8JA 5F21A 3RHSA 3KOOA 5CHYA 1PQ4A 3WK4A 3KZNA 3TS1A 3HCAA 5CIYA 2DFPA 2V97A 1V1RB 2MR5A 3FNHA 3KO8A 3N9IA 1Z0ZA 3THXB 3E35A 4JUIA 2X8AA 3SS8A 2JIZA 3KXIA 2FSSA 4ZCLA 3SZLA 4CQNA 2CK3D 3D4NA 3FPEA 3KK0A 2QEQA 4NFLA 4Z99A 2O2IA 3TFQA 3F7MA 4GYKA 1G7CA 2HWWA 4IGKA 4J3FA 4GMFA 3SYKA 5LQNA 2B1QA 2BVNA 4AKSA 2NOAA 3QE3A 4R71A 1J22A 3GFOA 4QDKA 3O82A 2HQSA 2Q3DA 4CV3A 3LKDA 1O6CA 2BGMA 1VYVA 1EWYA 3AUXA 3N7TA 2AZDA 4DC1A 4YUWA 4YV2A 5LM3A 4H18A 3GRKA 4W1QA 3RJTA 1CUCA 1KK1A 5CA1A 1NDUA 1YONA 1MHPA 3BD9A 3QNMA 4TMZA 4UZFA 3RVDA 2HMWA 3SU8A 5HHTA 4KHPB 3FHOA 2VF7A 3QVOA 3MHTA 2VQSA 1WOMA 1U0JA 2FPGB 1OAKA 3H9QA 2V55B 4WESA 2PJDA 2X2FA 1GU7A 3MAGA 4W82A 3VSEA 2AT1A 2VLBA 3W90A 1E6EA 3QLUA 4NBSA 3OQOA 1XP8A 4P0QB 3NKVA 3H5NA 5E2AA 1N6NA 3T0IA 2GO1A 1H23A 3JAKB 5K3SA 4BO9A 3TNFA 1IHXA 4MRNA 4DWJA 2W4QA 1Q0TA 1DKLA 1IXSB 4QGBA 3WICA 4GC9A 4WFKA 1A9YA 1RADA 1UC4B 3QLEA 4F96A 3J7AC 1BHO1 1A2BA 1U5AA 4GLFA 1KE1A 1CWUA 1BKSB 1WY7A 2I8CA 1YUBA 1IHUA 2FQ1A 2XWPA 3PFWO 3VZCA 2NU6B 2AR0A 4BNTA 4EHJA 2ZS8A 3LHFA 3PPXA 1N5KA 5KKNB 5MGBA 1Z17A 3CWCA 4A0GA 2EJTA 2QTTA 1W4CA 2QRGA 3Q5DA 1C9DB 1T8YA 4GMKA 3CN9A 1XVTA 3INRA 1W0KD 1B23P 4BFCA 2W2NA 1SUPA 4J4BA 1ISFA 2FKAA 3AJRA 3PC8A 3ASYA 2JK1A 2LCIA 3EVZA 5DCLA 1L5NA 4DYHA 4OHUA 1DSSG 3PNBA 3AHGA 3BFVA 1N0UA 2VT7A 3OAAD 5CFRA 3KPYA 4WXHA 5FL7D 1W75A 3ROTA 1C4WA 2ZB3A 1WMBA 4YRGA 2XXAB 2F62A 4GM0A 3UT5B 2ZU6A 1P1RA 1T5SA 1SXPA 2Q5OA 3B5JA 3GUHA 3Q3HA 3RWBA 5K4GA 2GH1A 4XVQA 3HKBA 2PV7A 5DULA 3W1EA 4LY3A 4KITB 5G0WA 1XGKA 2Q3CA 4IBOA 3MQ2A 1V1MB 3RSHA 4EY6A 1WETA 4HQ0A 4B3TB 4M7OA 2IE8A 5CG1A 4EF5A 1TJNA 1XBTA 2XZLA 1TJ3A 4FHDA 2D2EA 2FMIA 1WXGA 2OHXA 1W5AA 4H3KB 3OE5A 4C0XA 4M38A 2WU0A 3L7NA 1AVTA 1WSAA 3WDSA 3ZDDA 1U6KA 1AK9A 2E1RA 1HF3A 3I34X 2V96A 4F92B 2DFKB 3JZDA 3BHNA 3AP2A 4JLBA 3W9SA 4ZJZA 1ZHOA 3QG5A 3JQBC 1B16A 1GVHA 1UBCA 4NEHB 1DKUA 2BGUA 4NPCA 4NHOA 1ZXLA 2BELA 1ZIDA 1T4CB 3NTUA 4XPZA 3LA6A 4DNPA 1JSRA 4ZEVA 1NRXA 4ND2A 4MUKA 2VCYA 2J3LA 3N75A 1Y8QB 1B0AA 2QN2A 1CEEA 3IGFA 4D3XA 3HR4A 2HSZA 4AQDA 2JA1A 4LHXA 4YRRA 4YQEA 2ZR8A 3WLJA 3ACCA 3KZVA 4J2TA 1SURA 2J07A 4L72A 2QPOA 1T9DA 1O6ZA 3SEFA 3EQ9A 3FR8A 1KQFA 2CXUA 1SBIA 5BPFA 1RFGE 3TTWA 5GJCA 2H3HA 3H5LA 3ITDA 5CCBA 3KTAA 3URMA 4G0NA 4JWTA 1ML3A 2ZE6A 2A7XA 4BNKA 1YB5A 2XYVA 1NJ5A 4JI2B 3NBMA 1E60A 3NDJA 3NS7A 1R8XA 1WSBA 2GBPA 1HG0A 3HY6A 3IEUA 3NTQA 4FYXA 1TU0A 1RWNA 2X0RA 4J0CA 1IL0A 5AJZA 4D5EA 3GROA 5IUKC 1SQSA 1UUFA 4BMDA 4BNWA 1JAHA 4RTJA 4RDIA 1JLKA 2VP0A 2EF0A 4RGVA 3OZSA 2O2CA 4IV8A 4B5KA 4PG8A 2FWPA 4Z1OA 5H4HA 2ODWA 1P19A 1W4AA 1PEYA 4QDJA 3LPLA 4TWIA 1KMHB 1K27A 3HY4A 1V45E 1FFEA 4QOSA 5AKXA 1F20A 5CXQA 1UC9A 1CVRA 1E20A 1KAOA 1NJFA 1V2HE 4GRAA 1YUNA 4RTKA 4DV1B 4WUTA 1R9GA 5CXUA 1GCAA 4RTLA 2EJUA 3L2OB 1IPFA 3ZTYA 3WLEA 4BP9A 1OASA 2EWWA 4BN0A 3PL1A 3UY4A 1HYGA 5CLGA 3C8MA 1AUPA 2V3CC 1I14A 4EHDA 4LIPD 2DHEA 5FBKA 3AXSA 3EEIA 3VI3B 3TX6A 5ITWA 5KYYA 4MLCA 3RO7A 1GAEO 4ALKA 3NRJA 2HQOA 4O4HB 4PC2A 4EY7A 2YRFA 3L82B 2AX3A 1U2SA 4IWXA 4ZVKA 1M6HA 1L1EA 2RJNA 3ZI7A 3HVUA 3OHMA 2GN6A 3D6FA 3OOYA 1UIRA 4L8WB 4D9NA 4EL0A 2O2YA 3JQFA 2RIPA 4E1BA 2CYAA 1T8SA 4RH1A 1N5OX 1HK7A 4B4VA 4HAVA 2C7BA 2H16A 1DIOB 3OQNA 1V1JA 1ONNA 1YBAA 2NO0A 4PLWA 4NH4A 4X6UA 2AXEA 1OTXA 4MMYB 2H2DA 1T24A 5CCDA 3RKSA 2Q5HA 3T1NA 5LMZA 2V0NA 1YB2A 2G5TA 1ZEMA 2REBA 3DM9B 3KKEA 3PPVA 4KVZA 3ROEA 3RRNA 5ADVA 1HLPA 4OBEA 2K7FA 3OX4A 3GLIE 3A05A 4GXNA 1Y34E 3H87A 2D0PB 1Z4LA 3PHIA 4R9RA 2J59A 3PBKA 5ALYA 4K3VA 3WB1A 2VAVA 4JDUA 2PWZA 3AVTA 3FDFA 5CX1A 2DQKA 2CJWA 3CSDA 1UDRA 1Z2OX 1N7HA 4NAUA 4G8CA 1XU4A 2I3DA 4QDZA 4PYRA 3KSDO 3E5NA 1FUEA 4AN1A 3GEIA 1LK5A 5HVNA 4UZSA 3FZNA 3RF7A 3TW0A 2PJZA 1AA6A 2C78A 2DJIA 4DRYA 1DQYA 3JWGA 4ZO9A 4RZSA 1ISIA 1CR0A 4I1SA 5T3YA 3RTCA 3G2PA 5TVKA 2WMDA 3ZW8A 3MTDA 3K72B 1BXZA 1UBMS 4XWGA 4EDFA 1GPBA 5CAEB 1NMXA 2C3MA 5F4ZA 1FVXA 1XNHA 1GLGA 3OT4A 4NICA 1GZ6A 4AJOA 1F2VA 2ZJ1A 3NPMA 1SZDA 1N2BA 4X1YB 4RE5A 3HKEA 4N4AA 4YPFA 1C8KA 2AN9A 3ACBA 3OU7A 4CKYA 4F86A 3CLRD 3P9RA 5A3QA 1UAGA 3AOEC 4LYDA 4DQUA 2O3TA 2FMFA 1XMIA 3E1SA 3IQDB 3GJ6A 4OHVA 5AM5A 4F11A 5ANRB 4D25A 2JIQA 1E5LA 2Y66A 1Q14A 2XT9A 3JQAA 2YXDA 5H1YA 4FTWA 2PSJA 1N0WA 3FAZA 1BFDA 3QE2A 2K2WA 5A0TA 1Z07A 2GLXA 1DQNA 4MQUA 3R7DA 3JAWB 3C7CB 3QI2A 1FFCA 3LKBA 3DBHB 3DOOA 1Z0JA 1TTTA 4U6NA 1E1CA 5P8WA 1FMFA 4ZAFA 3LFTA 4X97A 3UFBA 4I50B 4LRQA 4A5SA 1E9SA 1EGVB 4J6EA 5JRZA 4RPCA 4TVKA 5KYNA 3GFSA 3ZY4A 1UMKA 2DPYA 2ZPTX 3G7UA 4M9SA 1MG0A 3WIVA 2Y68A 5H0IA 1K7XB 2HA6A 3SXJA 2C8JA 4CM8A 1ZOIA 4RKRA 3G9XA 5MN6A 1JS1X 4R0VA 3OOEA 1L4MA 1S2NA 4P4UA 2I55A 3WLIA 1YMQA 1NBMA 1T5HX 2PX5A 4Y6OA 2OQVA 3SBEA 1W47A 1VG0B 3K1AB 1VFNA 3KTDA 5ESDA 4BFXA 3NZEA 3AFIA 3W8FA 4EJSB 2XR1A 3C4JA 4BC1A 3AR4A 3R0VA 2EDCA 2OQRA 3JQ8B 5I7WA 1YACA 1JJFA 4K6GA 2J9XB 4OJKA 1X7DA 3F6YA 1IN7A 3H2HA 5KQSA 2WF6A 2D1FA 2GAIA 2CDAA 4LZZA 2BY4A 3T41A 2IH5A 3CRMA 3KD2A 4D3YA 4P7BA 3C4QA 1JHQA 3VA7A 1ZM2A 1AD2A 3PLRA 3QTLA 3R0IA 4FVTA 3EZGA 3NLLA 4MI6A 2NXCA 4E13A 1OXXK 1XCBA 3VPAA 4GLLA 2FOXA 5KOYA 4PG4A 5G4KA 2ZBQA 2W6CX 1S6YA 3FNBA 2H5JA 1N3YA 3WGGA 5CDUA 3GCDA 3X2SA 4HQKA 4FP9A 5CTJA 2FRVA 4RVFA 1ESZA 1Y4AE 1XP5A 3CWQA 1C0LA 5DN9A 2QLLA 2PWAA 4B81A 3I9MA 1RRPA 4JI6B 1ZU4A 3CX6A 4TUYA 5EFOA 3H0EA 4XAQA 1U11A 1VPWA 1ETHA 5C2JB 5ALVA 3KLPX 3MBIA 5KOHB 1L4BA 1IY1A 1RHUA 1ZK4A 2O48X 3RABA 4EW2A 3K0CC 4AUMA 1ZDMA 2WA1A 2B34A 3EFOB 3HN2A 4IIYA 3FZYA 1G18A 2IUFA 5TGDA 4P3NA 2A9QA 1QIHA 4S35A 1JEAA 4G25A 5C1OA 3WC4A 1RJGA 2HREA 4N6NA 4ZI7A 2JFFA 4U7JA 4NBRA 5B2FA 5GZ3A 3MS7A 2BEVA 2EJBA 4QUGA 3IXQA 1E1RA 3BXEA 4ZC1A 4FE7A 1H4TA 2W2LD 3DWFA 5CHEA 5KC8A 1AKWA 1TPZA 3AERB 3W8NA 2P9YA 4IDGA 3DONA 1LTHR 3VH3A 2P2DA 1G2IA 2R8RA 3B89A 1PL8A 4FNGA 4GL4A 5HG0A 4GDFA 1Q0RA 5HEKA 3IXMA 4PCUA 1CBUA 4P36A 1U98A 3NUZA 1GGHA 3ZE9A 2OOKA 1XG5A 3DW1X 3H2SA 4XB1A 4RHUA 5C8VA 5GZ6A 1CRQA 3TKAA 4X20B 2E1PA 1ZX1A 2XEDA 4OLJA 3VTKA 4LYAA 1CUFA 1IG0A 1PLJA 2P77A 2WPDD 2BKEA 4HX2A 3BN3A 2ZETA 3ESAA 1C1DA 4BKUA 3DT9A 1OAOC 3O7WA 1TMYA 1WNFA 2QF7A 3RYTC 1FU4A 3D0QA 4C0HA 3IP1A 1A9XB 5CA1B 3NTVA 4J16C 1VFPA 1H65A 3FROA 2QX9A 3O1IC 3ROQA 3U3RA 3V8QA 4F4IA 4X90A 3WB9A 4DLLA 4KXFB 3C8ZA 3BCRA 4L2IA 4D4MA 2GZDA 2R66A 3IMFA 5FI5A 3HUUA 4GBED 2F00A 3GRUA 2PLAA 1KMQA 2EXXA 2FN7A 3B20A 5G02A 5CFQA 4GUDA 3D6TB 2XI4A 2W6ZA 2GD0A 4U0JA 2WPDA 5DTEA 3CCCA 5IMBA 4YK7A 3A9RA 4KFCA 4L76A 3BRQA 1MPXA 3RC3A 2DLNA 2ZPAA 3FZQA 3AP1A 4FW9A 1T13A 4RHEA 1TO6A 1LI5A 4XJXA 1CY8A 4MP6A 3DMGA 1DBVO 3JQQA 3GZTB 4G85A 5JEDA 1M2VA 1RJWA 2R86A 5HF5A 3NP7A 3SFVA 1USGA 3HYCA 2FWIA 1RPJA 2B0JA 1ISHA 2EIXA 2G70A 2GR9A 4FDLA 4BUCA 3ISJA 4MQ5A 3B1VA 4B46A 1V4VA 2W11A 4P5PA 3PNMA 4YRTA 4UREA 3MJVA 5I8ZA 4EFDA 4II3A 4V2UA 1RZUA 3L7JA 3MW8A 1WG8A 4HATA 1QAMA 3UK0A 3NVAA 1M1YA 2G8LA 4TLBA 3O1HB 3IE1A 2UYHA 5D86A 1U0RA 3GDGA 3WNBA 3AWIA 4F5YA 1RYFA 1J7JA 4A10A 5JSZB 2EBHX 2IXDA 4OREX 1VJDA 3U7GA 5IJWA 4KPYA 3JYHA 1P0FA 3LZCA 1X42A 1E5TA 1X9HA 1X1SA 2J32A 3CO5A 3PK0A 3BD8A 3WYCA 3E82A 1QB8A 2ZJ5A 4XYGA 4V0LA 3TW8A 4BLWA 1XDBA 4UEOA 1BJKA 3AP3A 3HB0A 3D1JA 3Q5EA 3IH5A 1WMDA 3RKUA 5CD9A 1N92A 1ORTA 4Y7DA 1RAIA 4HRYA 2NSHA 1ODLA 2ZJ2A 5FPQA 1DJMA 4Y6LA 2VPYA 3D8SA 3FLEA 3D64A 4H6VA 1PYGA 3DLPX 4LQCA 5ECDA 5DLPA 5HE8A 4BYGA 5AD1A 4TSKA 3M49A 3K9QO 4HNSA 4XGKA 1P3Y1 1X0XA 3WAKA 1VC2A 3IJEB 3IPAA 1YI1A 2NMVA 2C95A 5E6SA 3W79A 3T34A 1T9CA 2K87A 3KUUA 4HGYA 1V3TA 4R7TA 3MT0A 1XRLA 3T7JA 1JSZA 4EATA 1K97A 3Q85A 3BTOA 1PKXA 8ABPA 3GZNB 1BOOA 3H99A 4GRIA 2B3DA 3OJLA 2ZTMA 5AUPB 2IW3A 2W0MA 3AFGA 1XJCA 4FLEA 2X7XA 1ECPA 4YIKA 3P26A 1GA1A 1PGPA 3KQSA 3WJ1A 4G81A 1C3OA 1WXQA 3WKCA 1G6KA 2ZB8A 2HLDA 1SOWA 2V4UA 4CG2A 2VTEA 2YS6A 2PD4A 3DVLA 1QOPB 3O91A 5FWYB 4I6EA 5BT8A 3JZAA 3K0CA 1FFHA 3BJIC 5CTAA 2QLFA 2POQX 5ALWA 3L7BA 3TQCA 4XXHA 5GAJA 2BP7B 3I5XA 4ERXA 4YLEA 4X85A 3IULA 3ZG6A 5LPNA 1AXGA 2YOFA 4OYRA 1I3KA 1RM3A 1E9CA 2ZKLA 1SCUB 1W85B 1Y5IA 2YTZA 3HCBA 1LU9A 3L06A 3R5JA 4L5YA 1KYVA 1BFKA 5AW5A 3SY8A 3TQRA 3SPXA 2R6GA 1KEWA 1VSTA 4EL5A 4W5RA 4HFJA 1UKAA 2OESA 2FSHA 2XUIA 3QITA 3NBQA 4FONA 2JAUA 4PANA 2GZSA 2EYUA 2VYCA 4B48A 2IEDA 2KLHA 2NO6A 3LX8A 1Z0SA 1NYRA 2H51A 1EVEA 4OU4A 2B36A 3H13A 1HFWA 2OCKA 3F6RA 2NVUB 1FW6A 1IE3A 4M7PA 5DYIA 4RQUA 3RYIB 1M6NA 4OQZA 4ITVA 4UOZA 2ERYA 4IICA 2Y2VA 2ANCA 3IPRA 4RS3A 4TLLB 2R4QA 2HO5A 1EEHA 2QSUA 5K3FA 3V9AA 4XWYA 4ZDJA 2QYTA 1M73E 3K09C 4OL0A 3BK2A 2HSGA 1RWPA 1Q15A 3R0QA 3TRHA 5B7QA 1GNVA 2C1EA 4FMCF 1DBIA 2PUJA 2R5WA 5AI4A 5F9FA 1SXHA 5CBPA 3I45A 1E7WA 4QFMA 2IF2A 2IHUA 4M1KA 1BEZA 3KDSE 2PE5A 3QXGA 4C7VA 2Z0MA 2PLRA 1AN9A 4L3VA 4F4HA 1UPUA 3L0YA 4XVUA 2AOUB 4KQXA 3VR0A 1TEVA 1IZYA 4MYSA 3P32A 3L5KA 3OKFA 5CT9A 3TQFA 3DPUA 2AQHA 4M98A 2MMGA 2ERCA 2FLWA 4QQFA 1YZUA 1E4YA 3PE6A 3GIWA 2MT9A 3GGOA 4QGFA 5DTIA 3ZZTA 5EJ5A 3A70A 3FA2A 2BBSA 2R6DA 4ZVQA 3RVOA 3NJ8A 4K40A 4ZWNA 1GGVA 2XDQA 3OPVA 4WN3A 4KWTA 1TM2A 1CIPA 3C3PA 3PJEA 1BVRA 2O14A 4H4EA 3RUHA 1QIGA 3QPCA 5B6IA 5FUMA 5KYKA 1P7VA 4Y9SA 4A6XA 3DFIA 1MX3A 3B8HA 1ARZA 2X40A 3UM9A 5ECGC 3WK6A 4BO7A 3T5AA 4DCMA 5CDHA 1PWEA 3E4DA 3MTQA 3R3HA 3OBIA 2YOHA 2A94A 5JY1A 1A7AA 1XDUA 2V7WA 5CBPB 2AFHA 3IQZA 1CQIA 4B6OA 1H3EA 2AI3A 2CLOB 2OVFA 3CXRA 3DBLA 1Y9EA 1QKIA 3C8DA 3K35A 1IAVA 1X8JA 3AEQA 3FR7A 1OQAA 3X1DA 4CUZA 3DVQX 3G0DA 4ENWA 1Y8AA 2VZ0A 4K81B 1D2NA 5HYVA 5KYVA 1BJRE 2L82A 2EF1A 3RFUA 2DH5A 3ZV5A 1YZTA 1KWKA 4LXHA 1ZUHA 1NXSA 2ZYVX 4RZQA 1CJTC 1E3TA 4AIIA 3CV3A 2HHLA 3PEFA 1DQPA 4Q3OA 5G3YA 1E4EA 3KJQA 4CCYB 1RKXA 5F5LA 4YIHA 1FLNA 4HS4A 4XJSA 1KEUA 1CRLA 1JVNA 1P1IA 3AOGA 1Z33A 3CRZA 1GA6A 4DZZA 1GL3A 3QPVA 1IZZA 1TL7C 4L78A 4TRRA 4W5JA 2YNMD 3I73A 3KS9A 5H83A 2COKA 5BXYA 5KYYB 3EAGA 1XFAA 2ACEA 3UMJA 4FCTA 1C0KA 4LZAA 3JAKA 4G1FA 1XZPA 5C51B 3EMKA 2R2GA 3TDNA 1IN6A 4YX9A 1YMUA 1ZNZA 1CUWA 4NG4A 2JW5A 3O26A 1FCJA 3V4RA 1DWQA 5LU9A 3X1ZA 2VDMB 2ZOSA 5BN5B 2UXCB 3GT4A 3TEFA 4ROSA 5JMPA 4NBWA 2I62A 3R7FA 1KMCA 1POWA 2OM2A 4PPGA 3TZCA 3TKYA 2WWWA 4TV8A 1BXGA 4AMBA 1Z6AA 1V6SA 2BM8A 2P4QA 1G8KA 2PRIA 5FUYA 3OQVA 2CHVA 3GLUA 1MJGA 1U0TA 4H7IA 3GLFA 1OVGA 1QGDA 4E5UA 4HQRA 3MMPA 1GZSA 1EVYA 2H7YA 5ALXA 1CFJA 4PHTA 5LL6P 3OQIB 4A03A 1ADJA 3B6JA 1MCZA 1PUJA 5B7GA 4Q1EA 5FA5A 4OP2A 2Y1WA 4Q02A 4I50A 5L3SB 3I53A 3IVRA 3JSAA 1QK5A 3HBMA 4RETA 3QSYA 1P8AA 2UUAB 1PJTA 2PEYA 4BATA 1K7FB 4K6OA 4ARZB 3HP7A 1DJPA 1N6OA 2WF9A 1HLDA 1KYTA 4FMBB 2DHCA 2CBZA 1DAMA 1G1MA 5FULA 4KFRA 2R8PA 1NF8A 2AMFA 1KQOA 3VJMA 2XPCA 4HH0A 3D81A 4Y6QA 8LDHA 2G17A 4ND7A 4QJBA 4ZT5A 2Q6OA 3C3AA 1ZNQO 3NH6A 1P0CA 5IBRA 5K8VA 2WU3A 4LJ6A 2XQIA 5PNTA 4CMCA 4ZO6A 4QPDA 5I8PA 4KI0A 5FFMA 1KTVA 3VNSA 4PZ9A 1ORHA 3R1IA 5HUQA 5TEWA 2QD3A 1CQZA 3CUEF 5D51S 4OKSA 4BEVA 1Y42X 1L5QA 1E1QD 1P9RA 2JIZD 4BKPA 3WL8A 1N5DA 2A5YB 3H05A 2G08A 1T2UA 2JBHA 1USKA 2ZBFA 4KMSA 4N18A 2EV9A 1OC2A 2HCTA 2B69A 2JAPA 4QYTA 2QBYA 4JGBA 1BX3A 3PC7A 3O8OB 3LY5A 3C3BA 2J85A 1QQ7A 3O8NA 3U16A 2ZDQA 3WRXA 4LHVA 1IUNA 1H2HA 3H7AA 2RAVA 4BKOA 1G38A 1K3UB 3ZHOA 1BCRB 4E5NA 4B3RB 3R5KA 1PF7E 3MQ4A 2YCLA 4JODA 1A77A 1H2ZA 2XZDA 3FPSA 2EVWX 4YUYA 3ZIAA 3DFKA 3TUIC 3HQ4O 3OZEA 3I0ZA 1A50B 4P4NA 1AKNA 2CFCA 2FN9A 4B7AA 4X6XA 5ENZA 2RAFA 4BLQA 4OQPA 4CDMA 5JAZA 2VRWA 2ZRCA 5ALEA 2R7MA 4OLFA 4XFJA 3C74A 3KYIB 3D8HA 1PSZA 2R8BA 2RKOA 1Q7EA 2V6MA 4YGYA 5DW0A 4HVLA 3AVPA 4HVCA 4LE0A 5M34A 4AY6A 1YL7A 2GB4A 4KDEA 5BVHB 5KWEA 4AD8A 1V71A 3BG5A 4O2AF 5B3JC 1JH9A 1EE9A 2JLRA 2XOKA 3SDSA 3RAPR 1EQ2A 3EWNA 4XCQA 3FKQA 4MYRA 1OJLA 1TUEA 2R6HA 1E6WA 5ALRA 3LLVA 3U5ZB 2C2WA 2W8ZA 3OI7A 4HAIA 2JGKA 1GGFA 2HLHA 4ZCPA 2BMDA 1TO2E 5EJ6A 1XHEA 3IQWA 1C81A 2ZAYA 2YFKA 4DCJA 5LQCA 1MAUA 3GLFE 4IH9A 3QUCA 1DL5A 1KIAA 1FMTA 5LP6B 1F12A 3OQHA 1LPSA 2CXHA 5DNDA 3JRNA 4YS6A 4CIXA 4W8HA 5DX8A 1BGVA 4CKWB 1EFRA 4D8YA 5C5CA 1A76A 1TD9A 4BFWA 1JV2B 1AURA 3HRHA 1VG9B 4UM8B 5EL0A 4UEQA 4KREA 3LXRA 1SC1A 4R0MA 2JIDA 3OIWA 4I81A 4N3NA 2OCPA 2RARA 3AY6A 3HN7A 1K5GA 3D0OA 4RLQA 4TN5A 4GGOA 1E1RD 3U4CA 2XLCA 2XSZA 1PBNA 2JLCA 3ZWQA 3EIFA 4OMDA 6ABPA 4C78A 1D4AA 2P4EA 1XTSA 3I09A 1M10A 2ZIGA 3I8SA 5GV7A 2MYNA 1GL7A 3S2YA 4ARBA 3E9MA 2FZ4A 5LUBA 4XRRA 5T7BA 3V2HA 4MVYA 2JI8A 1DWPA 3GJ5A 3JQAB 4LV5B 2J7PA 3NOVA 5DYTA 2BFNA 1UANA 3JQ7B 4J1SA 1I10A 5HZKA 2QRJA 2YVKA 4EX6A 1NP7A 1ZGBA 1HUQA 2ZJ7A 4KQEA 3RC1A 4BNHA 2EP5A 1L7DA 2HWYA 3KUCA 4MQBA 1UXHA 3IIKA 4KAAA