4IGKA

Structure of human brca1 brct in complex with atrip peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
211
Chain Sequence
VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Structural Basis for the BRCA1 BRCT Interaction with the Proteins ATRIP and BAAT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 63
structure length 211
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4igkA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4igkA01
1IMOA 4XQ0A 2AZMA 3COJA 2D8MA 3PXCX 3PXEA 2ETXA 3HUEA 3T7JA 3L40A 3SHVA 3T7IA 4Y2GA 3SHTA 3T1NA 3OLCX 4OFBA 2ADOA 3UENA 1Z56C 3SQDA 3II6X 3L41A 3SZMA 1N5OX 2VXCA 2R1ZA 5ECGC 2EBUA 3K15A 4ID3A 3PXBA 3JVEA 3I0NA 3L46A 1CDZA 2COUA 1KZYC 3K0KA 4BU0A 3PC8C 3AL2A 3EF0A 3AL3A 2L42A 3PC8A 1T2VA 4IGKA 2COKA 1Y98A 3U3ZA 2E2WA 2NTEA 4BMDA 4U4AA 4BMCA 1WF6A 3PA6A 1T2UA 3FA2A 3UEOA 1L7BA 3EF1A 2EBWA 2JW5A 1T15A 3K16A 2XNKA 3PC6A 2K7FA 2M2IA 3HUFA 1L0BA 2VXBA 3K0HA 2XNHA 3K05A 2HTFA 4XPZA 1T29A 2EP8A 4IFIA 2INGX 2COEA 3PD7A 4N40A 2LE0A 2DUNA 2WT8A 3QVGA 4Y18A 3I0MA 3PC7A 3PXDA 1GZHB 3KTFA 1IN1A 1JNXX 3T7KA 3QVGB 1OQAA 2K6GA 4BU1A 4JLUA 3PXAA
chains in the Genus database with same CATH superfamily
4E22A 1DQZA 4LMPA 1Y81A 5EQFA 3THSA 4BNDA 3KR9A 4WNIA 3F8TA 3B52X 5IAJA 2RGEA 1BEUB 1Z5VA 2R97A 3SM3A 4TKZA 1KO5A 5IC6A 3G3EA 1K06A 1QV6A 4QT4A 1SZPA 2GCEA 3O8NA 3I0ZA 3WISA 5IASA 1T4BA 3IAEA 3KKMA 2R79A 3CEAA 1AKEA 4DAEA 1H2ZA 5D2CA 1H05A 5AMXA 4H7EA 1WNFA 3IQHX 4KW7A 3M1AA 1UBRS 2A0XA 1VOTA 3PC4A 1ZBQA 4I1IA 2WYUA 3JRWA 4CHGA 5FWNA 2AX4A 2WOJA 3B5JA 5FPQA 5BQOA 4ARVA 1GRRA 1SIBE 4WERA 5IPFA 4NBSA 1JT2A 1GA4A 4ZOLB 4BKQA 4WQMA 2H51A 3GLFB 4RCVA 4D96A 1YQEA 4UZEA 2VYND 2BLLA 3EPRA 3C1UA 2AJDA 5EPEA 2RIRA 5EERA 1J49A 3KDAA 1Y33E 3ROPA 1GOTA 2X6TA 4CL0A 1VIVA 1OHHD 3U7EB 3SD7A 1JAIA 2BFMA 4KE8A 2QGNA 3BIXA 3UOWA 4ITVA 2FZKA 1SRQA 1V8ZA 2VA8A 3IBCA 3NOQA 1ZK0A 4L16A 4YJDA 4ZXFA 4UEJA 4DTIA 4G1UC 4BV2A 1YRBA 3BXEA 3OE1A 4XKJA 2HLPA 2JFZA 3UV7A 2CMGA 2DR0A 2CLEB 3TGLA 5CNIA 5AXBA 4RIIA 4YJFA 1TA4A 1R74A 5U4QA 1OTHA 3G17A 2BKEA 4XD2A 2O8DA 2HSZA 1V4VA 2WIFA 5G02A 1QNFA 3EF1A 1XEAA 4O4LA 1RJFA 4DVGA 2IPAB 4X6LA 4ZYXA 4D7AA 4IPTA 1X1AA 3ETLA 4GXTA 3ZKWA 5FJJA 4KQ2A 4RHYA 3PTAA 3LJKA 3B48A 1Z4MA 3DBRA 5IK2D 1QF7A 3I64A 4JJZA 2MU1A 4TV9B 3JRNA 4ENVA 2UVPB 2QRGA 2WYOA 2O2EA 4QREA 5AVQA 4E46A 3IQIX 1EK5A 1TUGA 3QUCA 3RRYA 5FBHA 1PR1A 1UF9A 3R7FA 4DUPA 2WZBA 4OH7A 2GDZA 3Q98A 4LFCB 1GSHA 1V48A 4DOMA 4DT1B 1ORDA 4QGGA 4U6QA 3I6YA 2EJBA 1VA4A 4Q3DA 3WKBA 1HDXA 3BDIA 4O2BB 4RF5A 3NZEA 3HPRA 3KALA 3N76A 4UMVA 4YONB 1DQYA 1F0PA 3BL6A 2KX7A 1WUYA 2C5SA 2GD1O 2ZGVA 1FNDA 3LCMA 3N6RA 4QBIA 1S2MA 1K6JA 1B8VA 2CK3A 2DTXA 3NDIA 1BN7A 1LGYA 5EMJA 1QCYA 3N58A 1R9JA 2X1VA 4I5GA 3PIRA 4L15A 2HLHA 4KK3A 4MWEA 5G40A 5TT0A 3W5DA 1KEEB 1W5AA 4ZDKA 4YFYA 2H92A 5H5JA 4GW3A 5AW6A 4F96A 3EMVA 1NVEA 1KSJA 5SY6A 2RHTA 4OM8A 1GCOA 1QVWA 3B9QA 3BAZA 1YC5A 1EK6A 1K7XB 1YZNA 3LQYA 4MKRA 2ZPTX 4G6ZA 3T38A 1ADFA 1SD1A 3QU9A 3OJEA 1TB4A 5MN5A 1MF7A 2VQEB 3WY9A 5CT4A 3OE4A 1KPIA 4N18A 3IQXA 3N2LA 1HY3A 5DXAA 3ZCRA 2FX2A 4TV8A 3U4QA 1X87A 1A2KC 1BVRA 1Q1BA 2P9BA 2Q5LA 4Y67A 3OU2A 5IXJA 3S8YA 1NBWB 1QAMA 1TJ5A 4Q24A 1F6WA 1W2WB 4HX2A 4BC1A 2AFHE 2X8JB 2GX6A 3DYBA 1DE0A 4WKNA 1K0FA 1IJBA 3LCVB 3H5RA 3S81A 1FP4B 1R6BX 4YCMA 1XTJA 5JXWA 1UPBA 5CYGA 2KB0A 1Q5PA 3M9WA 1GEEA 2YYZA 1CUDA 1PD1A 3IALA 3RIMA 3ZIAA 3ZCPA 3BGDA 3QUBA 4NATA 1JHQA 4JU9A 2XVMA 2C57A 2HV8A 2O23A 1F7UA 3C45A 2FZ5A 2Z95A 1TTPB 4AG3A 1CYEA 3ITKA 1KJIA 1P7YA 1G20A 1ZI8A 3KYBA 3LXXA 4TTTS 1N8KA 2O0JA 1R3UA 2XA2A 3VJMA 2PCJA 2D74A 2QNRA 2GBLC 1NPTO 1R4AA 1T5TA 3GGJA 5GJWC 5CEFA 3EJ6A 5BQFA 1SHJA 4GBGA 2D59A 1UP6A 3D4LA 2C2WA 3OUZA 4RA9B 5HIAA 1X2EA 1Z2EA 4QELA 5AJTA 2A7QA 1KVSA 3JQRA 1IE3A 3IEKA 5JDCA 3KLNA 4L78A 1EAYA 3PJDA 4HVTA 4RH3A 3WLPA 1TEHA 1UDXA 3P9RA 4BX3A 4EJ6A 2AQIA 3FVQA 4MR8B 3AETA 2W22A 2G06A 3KAKA 4DM3A 5HJ5A 1FC0A 3AHEA 3MTGA 2WICA 4TSFA 4C30A 1WS6A 2VFAA 3B6EA 1QIEA 3QXXA 4G9GA 3ICEA 1HUQA 3ONDA 1CY8A 4BZXA 3ZJ4A 3NW9A 1G8JA 2GCIA 4YJ3A 3ZHOA 2QVCA 5FHRA 4M98A 1V8OA 1I7SB 1QLHA 1ZSNA 1DAFA 3H2ZA 4MAMA 2XXBA 2RJNA 4B8ZA 4MIEA 3ZU4A 5DLQC 1JTVA 4WZBA 4O0LA 3CLKA 1EGMB 1E2IA 2EBHX 1GVNB 4FMBB 5BOVA 3UMVA 1NF8A 2OOSA 3KEGA 2VJQA 2JIOA 2XNHA 4DEVA 2BHTA 4K6HA 4DG9A 3C7KA 1EVIA 4HFRA 1RRKA 4UHHA 3GBPA 2IC5A 4LWZA 5JSFA 1JDBC 4B33A 1NLYA 1J2EA 2FZWA 1D2NA 2VDJA 3TSOA 5K0BA 2VEDA 1LU9A 3DDNA 1NBOA 2DZDA 1PJQA 2DBZA 4MHOA 3SVTA 3PRKE 1DO2A 1W5EA 4KSCA 2XVYA 4TLBA 5AUNB 2Z30A 5KQSA 3WRWA 2ALJA 4JVSB 2WTXA 2I34A 4PZUA 1KI9A 4ZHQA 2VSFA 3BE5A 4JC0A 2FZVA 1K97A 3KYIB 4PRKA 4C2TA 1JJ7A 3V9PA 4FC7A 1AV7A 3MELA 5K9ZA 2H1RA 1QGUA 2G0AA 1X3LA 3A1WA 2PH5A 4OQXA 5E1DA 4PHCA 5EQJB 1JNXX 2OCXA 3N5CA 1JQLB 3A1EA 3MOIA 1GILA 3ONEA 4RMHA 4A0GA 4MINA 5K0ZA 3KB1A 4MPJA 4F8YA 4QU9A 5EP4A 4QSMA 4Q4HA 4G5GA 4GI3A 5BSHA 5I6DA 1LI7A 4Y6LA 4O2AB 4XQ0A 4EK9A 1KJQA 5EXSA 1XEFA 2W2XA 4J8PA 1FVOA 2AZDA 1PS9A 3HB1A 4D4IA 1N5RA 3HUEA 4B4DA 5G1NA 4PZYA 1WB6A 4LEIA 1SRRA 1F8YA 1JECA 2POQX 4IHKA 4D79A 4KXMA 4F12A 4AECA 1X1DA 5JDCC 3TPFA 1N0IA 4IDBA 1QZ3A 1AD2A 2CCKA 4MWDA 4O4IF 3VR6D 5ALIA 5AO9A 3HCCA 1NBME 2B5OA 4XR4A 3PE4A 3ELDA 3TNLA 4FZ5A 1LBIA 2VYFA 2IEIA 3I39X 3LY7A 3N87A 2XOEA 2ZEJA 2PX5A 3TDKA 4Z8YA 3UK1A 3GEEA 4QODA 4RW0A 3M9XA 4BVJA 3WLTA 2WA2A 1T1GA 1N5OX 1YASA 4PIPA 1GKUB 3W5VA 5HILA 3QENA 5KNBA 1C7EA 3AWDA 4QGFA 4E7OA 4EG0A 1UT5A 3HZZA 5AK0A 5ITVA 4BECA 4ID3A 1I13A 3LBHA 2H2GA 5EIWA 3P4UA 1YJ5A 1JVNA 2A5DA 3HB5X 1LSUA 1T26A 2GN2A 2Z8XA 3GMDA 3T1OA 4PN7A 3U7GA 2IPLA 4JL6A 2PL3A 5T6BA 3I4CA 3PQFA 5E2BA 2QW0X 2GN8A 4HJXA 1C9DB 3NYRA 4PIVA 2BDUA 1WXHA 5A5GA 1ZKDA 3LVQE 5DXFA 5FWYB 5SY9A 2ODWA 2OFFA 3PUKA 3V00A 2MYNA 1Z8DA 4DNPA 3FCCA 3LQFA 2PSDA 4FEEA 4ZEMA 3H4VA 1OX6A 5LDHA 5DNCA 3UKOA 3FMVA 1ECCA 1NF9A 4I8XA 3TLMA 5MGBA 5DM0A 3TD2A 3HFRA 4DDTA 4K40A 1LLQA 3R7NA 3P2IA 1PUJA 3DH0A 3UMGA 1NYQA 5FWAA 2QMUA 1FU7A 3ZCQA 4CT4B 2VN8A 2WJGA 4KRGA 1A5BB 1QHEA 2JPDA 2WT4A 1LFAA 2QL9A 1XMOB 4W5TA 2IZ5A 2Y0DA 4XWKA 2RHHA 5JSQA 3E9DA 1RLIA 4Q9IA 3PC6A 1DMRA 3TQFA 3NQ41 1U8ZA 2E0IA 4A6DA 3TCXB 3V4PB 1JKMA 1TCVA 1KNXA 3QEJA 2NU7B 2GF0A 1WY7A 4P36A 1JV2B 2ZVPX 1KC3A 1OIWA 2A1TR 2A5JA 2VXOA 4YFVA 1GRVA 1G7SA 5J2TF 1G42A 5CGZA 4DQDA 4MWTA 3ZU3A 2PT7A 2RAFA 4ND8A 4DHEA 2EV9A 2Q62A 4GMDA 4OK5A 1NVXQ 4BLQA 4EG4A 1ZXLA 3LDGA 5IS2A 5H59A 5I7OA 1O5OA 2EFEB 1C4KA 1AGRA 4M8LA 4DSZA 4ZRDA 1UQUA 3NT4A 2FRVA 4CMAA 4R7ZA 3I2GA 3UWKA 4A2PA 2ES4A 1OPRA 1L8AA 4KWTA 1M0SA 1BU5A 1L1EA 3RANA 1VE5A 2NNWB 2WTAA 2YZGA 2C4MA 4JLKA 4RCZA 1G7RA 5E4JA 1Y3HA 2J9YB 4M0UA 2ZS9A 4D82A 2E6UX 4RHXA 3VR3A 4WI1A 3LGSA 3QE2A 4E5UA 3TLZA 2YNMA 4D9HA 1IMOA 1WIWA 1OLXA 1DBRA 1E6MA 1XQ9A 2PZJA 3GNLA 4JB2A 1V71A 3CUTA 3A36A 3IHTA 4QDKA 3WRVA 1OYWA 1NMXA 2IF0A 2MTBA 3WWZA 4BTEA 3FCEA 2LCQA 1MC1A 3LWNA 3SCZA 5ALQA 5J1TB 3OF2A 3M0EA 2ZETA 3IPLA 3PWZA 5F76A 5HZMA 1DL5A 5EIOA 3K8YA 4JT9A 4DNOA 1UOPA 2QDKA 1UJ2A 2B21A 1H6BA 4MS1A 1CZHA 1U8CB 1KDTA 2GBFA 3IR7A 4PR3A 4PBSA 1DIBA 4XYBA 2Q1XA 2JFUA 2QJTA 3SQDA 1ZWKA 2BHNA 3IJEB 4YQEA 1V5GA 2KLBA 4TKVA 2WU8A 1NVGA 1V1RA 3OEYA 4XLLA 3E1GA 1TYEB 4PZAA 4FWTA 3UWSA 4M6WA 3TB6A 3EAQA 3DBHA 5CX4A 2QTTA 1YGPA 2C1EA 1LRJA 1JA1A 2PKCA 2AMVA 2FU5C 2Q4RA 3BWCA 1JJFA 4ADSG 2HXYA 2RONA 1UP4A 2JHFA 3KR0A 4KVAA 5FLYA 4I50F 3RLIA 3V8EA 3WNZA 3E2MA 1QG2A 1SUDA 3REFA 3F4KA 3LBNA 4I9FA 1QCZA 3IAHA 4NICA 2P11A 4RGQA 1FIUA 1FRQA 1CLUA 3JQFA 4LTDA 1XIVA 2VSOA 3L05A 4GDMA 3B6IA 4WFIA 4I4IA 4A23A 5A3RA 2E5LB 1O4WA 4OXRA 2E2WA 1E0SA 5GPBA 3LXRA 5KMGA 3PPWA 4QECA 2HA4A 3AJAA 4L22A 1EPUA 2QQEA 2RBGA 1NVWQ 1Q0QA 2CNLA 4WZBB 3BWVA 3K6JA 2CFRA 3JQ7A 4CIVA 3OOYA 1BXRB 1SXGA 2B99A 3RVNA 3T3HA 3Q3GE 1UBHS 5BR1A 5C3MA 2H2WA 1QHHB 2XBMA 1IG0A 2F1OA 3QY0A 4JVLA 1CUAA 1JKFA 1DUIA 4MWSA 5ERXA 1RQ7A 5LQNA 3A6KA 3AVVA 4DV3B 3AW9A 3GCGA 2JASA 4GLJA 2PX8A 4JLMA 4QWMA 1WTCA 1X8XA 4UJ3A 3ZK9A 4GDFA 4I1SA 1CB7A 3TMAA 2VBIA 2WKPA 3NAQA 4TZTA 4HTFA 3W9SA 1XCGB 5ALRA 3WKEA 2GHTA 1GPBA 2WJ4A 2G9ZA 1SY7A 1QUEA 1HURA 2A1UA 3BPSA 3WRYC 4C7KA 2C8LA 2TMDA 3UH1A 1H2XA 1G21E 4M0LA 5TQVA 1E8NA 1FS4A 3U3KA 2IYTA 2XWJI 4W63A 1T0PA 1DUVG 2Z08A 2CXUA 3MMXA 1H2EA 4A8JC 3QVGA 3I0MA 1TGYA 3KU4A 4YP5A 4TOIA 2GFIA 4LGMA 3C6KA 1WVGA 3A9WA 5JVDB 3DZJA 3IDQA 2HR1A 3CJTA 4X1YA 4EMBA 1EG7A 3AVTA 1WHTA 3G85A 4NONA 2P9EA 5I8WA 2WIBA 5M04A 1GFZA 4YCCA 3IOMA 1UINA 3IT0A 3QVJA 3QYAA 1LBTA 1H42A 1KZ4A 2QQ0A 1CQJA 3KKQA 5H82A 1UZAA 3ODGA 1JQ5A 4MX8A 2G4VA 1EMDA 1U28C 1NBHA 4HWPA 1LXCA 3WFIA 2J9ZB 5FL3A 4ZZIA 2D8MA 4WASA 1NW5A 1GU0A 2AG5A 6REQB 1DVRA 3KT6A 5MN4A 3KKZA 3L8EA 4HPXB 2QN9A 3NLLA 1AA6A 3BKXA 3EG5A 1XDSA 3R7SA 4EKNB 3UT5B 3C6XA 2Z5VA 3H6HA 4A10A 1R1DA 3ISTA 2BGLA 2REBA 4FIDA 3V4SA 1GL6A 3P2MA 3FDFA 2IYLD 2PLRA 3OE5A 4HDNB 4A0RA 5DW0A 2IP2A 4P6VF 3O8QB 3OFNA 4DDWA 5DW3A 3R74A 4EP1A 3C6BA 3PJFA 3GLFE 1TAQA 3LS2A 1EXWA 2BZGA 3H4IA 4F3RA 1C7RA 2VEOA 4TN1A 3ET5A 4EO4A 3COPA 2P9QA 3LY8A 3L77A 4GOXA 4Q6BA 1WB5A 2EBUA 3D6AA 5TQ2B 2VYQA 1N9GA 4I19A 5JU6A 1FNCA 2W2KA 3N9IA 2ZR9A 3O84A 4BNZA 1O8CA 3OESA 3QI7A 1OXKB 1T8PA 3S55A 3QLVA 1T8RA 1ZD5A 4G2TA 3WFJA 1XMJA 4TMYA 3AR6A 2PLFA 2B35A 4IZHA 3V1YA 4MW6A 3NUGA 3T4EA 7AT1A 1CZOA 3FLAA 1PD0A 1QFSA 1JR4A 4U7PB 4ZV7A 3SJZA 4DV7B 1W88B 4MMYB 5DYIA 2HX1A 2B8NA 2FFJA 4AY5A 1X8LA 3TCNA 2XOXA 4EQ6B 1NLMA 4KBFA 1A27A 1XXLA 4CMEC 2PGNA 4MIOA 4CBVA 1NM5C 1UFOA 3UJ9A 5MDHA 4QFCA 4EO9A 1GRNA 1NRIA 1P72A 2I3DA 2V7XA 3I2IA 1ZA2A 2GEVA 4H6WA 4RQTA 1PX2A 2V3CC 5AW3A 2GD2A 1IOVA 1JU3A 1PHPA 1O0SA 1J90A 1RXIA 2IY7A 3E7FA 1HTTA 3HH8A 3IQEA 3LAWA 4NFLA 2XWSA 1EWTA 4AUEA 2FPRA 1FS5A 1T3LA 3BRQA 3IQWA 4FDAA 1QVRA 4Q21A 2O8EA 1ISIA 3G2HA 4R41A 1QE5A 2NMVA 3NHKA 2R4TA 1RZUA 2X5XA 3LM8A 3EDRA 4LJRA 1KYQA 1WF3A 4F86A 5KQLA 4EW3A 2Q4EA 2PIAA 3QBJA 3VR3D 5MF6A 4EI9A 1X15A 4NE9A 3A11A 4KQXA 4KREA 3E8SA 4HN4B 2FLKA 3QLUC 1RWKA 2FF5A 3MWGA 3CCFA 2H9IA 4XWWA 1Y8CA 1G291 3H42B 3ROEA 4ZJZA 5JPCA 3R77A 1IBRA 3HYRA 4HAXA 5CTAA 3RS4A 1XZIA 2EOAA 2OD2A 2NXNA 3U5ZB 2QGZA 4IDCA 3JQPA 2JLYA 2BMVA 2D7DA 4GRIA 5FPTA 4BEVA 1TAHA 2PU5A 2Q5OA 1SCUB 4JB3A 2HMSA 5G4LA 2ORWA 1JU9A 3C4JA 1EA5A 4D4KA 5ESWA 4P58A 4QDUA 3THYB 3JATB 1WU8A 4RU1A 4DA0A 2YJGA 1E9AA 3NHBA 3ZZNA 2X0FA 1CEEA 1XQYA 1XZGA 2CLKB 2PSHA 4ZQIA 3V1LA 2H1SA 5E8JA 5K3CA 1XN4A 2CLHB 3BG5A 3LYUA 4Q3BA 2X2OA 5JZSA 4R9RA 4HDNA 1JKXA 2E9SA 2JATA 3EXFA 2XXAB 5GINE 1Y4UA 1CP3A 4E33A 3KHKA 2H1OA 4FFBB 4Z9FA 3EUFA 5DYGA 4O1MA 3BCSA 3M4NA 4WBNF 3QZUA 4FGUA 5KJ6A 1L5MA 4Q19A 3BFKA 5IUNC 4QOGA 1LF0A 1XR3A 5HM8A 1PG5A 2JA2A 2NUAA 3SDSA 5AT1A 5JUWA 3DOFA 1AF4A 1DMSA 2P91A 4BNJA 5JZVA 3I92A 4XJXA 4C7OA 2QB5A 2BKXA 3O8DA 5JQWA 5LMUB 3ZWQA 3LFTA 1KXZA 1YIOA 1YZFA 2NV0A 3MMPA 2HK8A 3FUTA 2GXSA 3A58B 2BEUB 4BIMA 3ND5A 1YBMA 5AK3A 2A0UA 3PT5A 4G8DA 4OFXA 4IFTA 4RPHA 3R5FA 4C14A 4D6PA 2WB2A 1U2GA 1KAMA 3BXXA 5LZ8A 5KNCA 3GGOA 1KAEA 3CLRD 3INRA 3D7NA 3O82A 1IEXA 1SCQA 1KP3A 2Y92A 3QE3A 4JC8A 4Q9AA 5ALVA 1TVKB 2YRWA 4ISCA 3VRHA 3WOHA 1N2IA 2C2HA 1IY9A 4OA8A 4BB9A 2I0FA 3O03A 3A6EA 2ZRLA 3HDQA 3PBKA 3ZIUA 1H4VB 1TUBB 5BRNA 3U3ZA 1J2TA 2QD1A 3MQ4A 4JR1A 3HB7A 2FZEA 4U8GA 2XBLA 4TV9A 4BE7B 3IE2A 2BMJA 3MYYA 3NIGB 3TTXA 1XL0A 1YL5A 3EVDA 5JECA 3L0ZA 3GB9A 3V48A 2VDQB 5F7OA 3U3XA 5JNVA 3WZMA 2ZYVX 1ZLYA 3D64A 3Q9UA 4ILEA 4EBBA 5AVXA 5FUVA 2BGWA 1RM3A 2C04A 2UZAA 1Y42X 4LWOA 1YB5A 3IJ5A 4CT0A 3ZXXA 1GO2A 4RWEA 5BP7A 2HWUA 3Q85A 5KYWA 1V7PC 4V02A 4EFDA 3R75A 2R4QA 1IZYA 1FNBA 1P1CA 2GNAA 1XG5A 1O3YA 1XYYA 2E82A 4AO6A 4OQQA 4YRZA 1MVOA 3H0CA 3KKEA 1JNYA 2Z1DA 3OZWA 4YAOA 1GPNA 2GXQA 4Y2JA 3RRXA 1YVUA 4ZMBA 3EE6A 4UVHA 3JW8A 4QRIA 4YP1A 4N65A 4RK1A 2C4UA 1TFRA 5EJ8A 1A9ZA 1U28A 1I32A 2CXQA 2C61A 4FNMA 4OMFG 5LYJB 5B7NA 3I9V1 4MO2A 4TMWA 1MAAA 4YRKA 4LHXA 4PFJA 2PJRA 3N86A 1SB9A 1QK4A 4UQLA 3NIBA 1T0IA 6PFKA 2HA6A 1YULA 2Y71A 4RL6A 16PKA 2Z43A 3MTDA 5JRZA 2RGXA 4DVJA 3WMEA 1NN3A 3C5HA 5ALSA 4P3OA 1YZUA 4QNNA 1S8NA 1M2VB 3V6LA 1DWPA 2JNWA 4GL4A 1QK3A 3F7NA 5KI6A 4HDKB 4DMRA 4OL9A 2VP2A 5JAUA 5H16A 1U1DA 1NFQA 3EFBA 4IJUA 2HV9A 2VL7A 4MICA 2WYIA 4BQFA 4TV9F 3NETA 4P2BA 4ALIA 2JDIA 3M5CA 4MYHA 3IERA 2XRYA 1GAJA 1QDEA 2RHRA 2RGCA 2YJTD 2J3IA 2F3RA 2Q9CA 2VHZA 4FSXA 4JKIA 1RAGA 3H9QA 1M5RA 1PS0A 2J5QA 3D4IA 3I52A 1L8XA 3RS2A 1VG8A 5KB3A 4NXNB 2AI3A 3IAS6 2WQ7A 2ZTUA 5AKZA 3WQQA 3JZIA 4ZEVA 3OY7A 3PFGA 3PE3A 2HADA 4ZTZB 5B6JA 4FGWA 4UAGA 3K09A 1CRZA 3GD7A 4ARAA 4Y2RA 4C43A 3B8HA 4NVRA 5HQ3A 4QDZA 3U3DA 3P52A 1M7BA 3HV0A 3VPDA 4FZVA 4RS3A 3EW9A 3QIAA 4MYRA 4HAWA 5I5EA 2R1ZA 3ZCUA 2XCRB 3NAMA 2XTZA 1NKSA 3WL4A 3CZQA 1FY2A 1ND6A 3H9UA 1FFEA 3G6WA 3GDFA 2YNMD 4X93A 4DMKA 2H31A 4AJLA 1KEEA 3QBDA 1WEKA 4RY2A 4XZ3A 2XZLA 2BPOA 2YQ5A 1MEEA 1WSAA 4YRRA 2BEWA 3TAUA 1I2BA 1Y37A 4GPTA 2AFHB 4XGKA 3WGIA 3G9ZA 3HCNA 2W2VA 1C9KA 2V7BA 5FTKA 2V6JA 3PNPA 3L06A 3NXKA 4LTMA 5HTKA 3LHDA 3UHAA 3WWCA 1E89A 4IIJB 4MV0A 1OYOA 2B8TA 4Y1EA 4AZWA 4K9SA 4W7SA 3BB1A 2H85A 2FX5A 3BREA 2XVXA 3WJAA 3HO1A 1DDGA 1DQPA 1WLYA 4A0SA 3KKKA 1JFTA 4QXAA 3CZRA 1GSIA 4AJNA 4KXNA 3AP2A 2VF7A 2A33A 1W46A 1WE2A 1XQ6A 1SKQA 5EY5B 1XE3A 1R88A 2GM3A 4C01A 1RAHA 3O93A 1U9ZA 4WKCA 4BNIA 3L7NA 5KOYA 2IW3A 5DPMA 4C4ZA 4ZYUA 5DTMA 1HPLA 4PZ9A 4BUJA 2JA1A 2NYUA 3P0HA 4LY9A 2F6RA 4JEHA 1C14A 1R8QA 1VCMA 1Z0JA 3HCOA 5SYAA 2VK8A 4B47A 4MZXA 1OREA 3NR2A 4ZCQA 5KOHB 1TRHA 3L4BA 3ND9A 2LCFA 2Z5GA 3MSXA 3OT1A 1QYXA 2D1QA 5AI8A 3SQLA 1KEZA 2ANCA 1FPMA 4EUEA 2ZJ8A 2Z4SA 2GPBA 4WFKA 4FCTA 1U7DA 3MAGA 5HW0A 1HGXA 3GJ4A 3WYAA 4MGHA 3FNFA 3MCAA 4RDCA 2VHTA 5B1IA 2COEA 1DZ3A 3H4MA 3UO8B 4AZVA 2BUCA 2C7OA 1XPUA 3DV0A 3OQHA 5MFZA 5C4IA 2AFHA 2DUJA 2IUSA 2V74B 3AJ9A 4W6QA 2EVWX 5I8PA 1RXWA 4JI4B 1XCLA 2QTBA 4MWZA 3GRUA 5KC9A 1M2WA 3N7TA 1KE1A 4R3UC 1MDBA 1GCGA 1RC1A 1A82A 4NK5A 3K8ZA 4QA9A 4F5WA 2W9XA 1DIAA 4C6RA 1RZVA 4KI7A 3QGMA 4PCUA 3MC1A 1WV1A 2P4UA 2NUPB 3BXFA 3T5MA 1QC5B 1WHSB 3MILA 4IWXA 2R7MA 2GYUA 2VPZA 4XWGA 4LZOA 3EDQA 4BFUA 3ZJTA 1C9JA 1U4SA 1BKDR 1Z47A 2MYTA 3WLLA 2QLNA 3W1WA 2XEDA 4DG8A 3O4VA 1WLSA 2YYAA 5KWSA 2CE2X 2JIZD 1C3LA 5C34B 4FI3F 1DAOA 4RTQA 1N7HA 4HQ0A 3SQXA 3EGIA 3Q7EA 4DY6A 3TG2A 2EFHB 4ETWA 1QX3A 1R4MB 3X1DA 1DX4A 2FI1A 4LJ8A 2ZIXA 1G5IA 2YXLA 4B6FA 4LRXA 3TBFA 1P29A 4DANA 3RYIA 4GOMD 1O0BA 4D41A 5C2JB 4IXNA 2PS9A 4YP9A 1GR1A 3A1VA 1UBGA 1AE1A 3NVAA 1QV9A 4WOKA 1VCNA 1PDWA 5IEJA 1GYRA 3M1IA 1Z88A 5TJ9A 4OHMA 4C4SA 2Q1TA 1E18A 1QYDA 1VJTA 3LUGA 3LX5A 1GCIA 1CUEA 3OFVA 1L1QA 4XYMA 3I04A 4NDAA 4CIAA 1PFUA 5KX5F 3H7AA 5A05A 2CEKA 2X7HA 3FRIA 5CEJA 3USES 1RP7A 1CUYA 1G1MA 4BNYA 2XDQB 3Q7SA 2Z6VA 1ISJA 4NX2A 3ORRA 4I3HA 2HD4A 4H35A 3CW9A 2VQ3A 2KS6A 4NOJA 3U4HA 3MJSA 2Q6VA 2B7BA 4AG5A 5JZMA 3AERB 4ZO7A 1ZJ5A 2WHRA 1FSZA 2ZXUA 1E4OA 3IUMA 5CFZA 1P1RA 3OJOA 3GMIA 2PA3A 3R23A 2Z5LA 3BF7A 1RI1A 1ZM4A 3JYPA 3R44A 2PG3A 5AW5A 4H0NA 4BMDA 1MGOA 4C76A 1K8RA 2PKRA 4HWRA 3R9WA 2AH5A 3NBYC 3QWFA 3KUUA 1E6KA 1JJAA 3OQIA 1D1SA 1ZH0A 1PR5A 1UMDB 1XRNA 4PG8A 3OWXA 1IJFA 4MPTA 3WNQA 1NIJA 4LFAB 1NW7A 3L7DA 4GYJA 1M34E 4ABTA 3KVVA 2I9PA 1G4HA 4MYCA 2V0GA 1W36C 1NTOA 3YASA 3L8GA 4HNAB 4E11A 2Z3WA 1F5SA 4H4CA 5EGNA 1CY6A 3WLSA 2P9JA 2VXBA 4EPTA 3AU8A 4TQ9A 4RPIA 2X9QA 3PDIA 1Q6ZA 4FX5A 2PPVA 3NP9A 5JEEA 3CO0S 5FA8A 4AMYA 4J49A 2UU9B 2QG6A 3P0EA 2BZ0A 2VP0A 4OB6A 4ZTUB 1D6MA 3GLHB 3ZQ6A 1RAFA 5I9NA 3FHOA 3BJEA 4BRWA 4GAEA 1GJRA 3Q7TA 3F6EX 2XNJA 1C4OA 4WADA 3V97A 2AZXA 3FSJX 3TM5A 3ZNNA 1QBKC 1QTRA 2AJLI 1XMVA 2C58A 3FCAA 3WIDA 1KPHA 2KQUA 3BD8A 5DISB 5JTUA 1TVMA 1ZL0A 3EIHA 3FE2A 4ME6A 4RK6A 1TADA 3FWZA 4L8YA 4J03A 5LQJA 2DBYA 4CEIA 2XT0A 3HM9A 1DCTA 2H4JA 1E7QA 4M87A 5ENZA 3L4JA 1Y7HA 2XHEA 4FT4A 1M8FA 1ABFA 3H84A 3KQMA 2C29D 1W4RA 2V4ZA 3GZTB 1Z4IA 2J33A 3NOVA 4JX9A 4WN9B 5F12A 4D4HA 1R9MA 1WWKA 5GGYA 5SV2A 5ER9A 3QPUA 3ON5A 3SIWA 4D5GA 2VRNA 3HACA 3F5QA 4OAOA 3M6LA 1ZI9A 3WAKA 4IH1A 2WAMA 1KA9H 4HGPA 4DIEA 3OJCA 1LTKA 2WJIA 4CDGA 5EHQA 5AIAA 1ZH4A 2J9FB 3I6MA 3TZEA 5JISA 4B7XA 3CBQA 4QM6A 1XLWA 2VQFB 1PN3A 4OB8A 3WLEA 3NORA 3WMGA 1K9SA 4TVKA 4P4UA 5EE1A 2XUFA 3O2NA 1JQAA 4KXWA 1QKIA 1VI2A 2VYNA 5KSZA 4JLSA 1BA3A 3NHLA 3LSTA 4DLXA 5ITSA 4QHSA 2R66A 3BGIA 1P7CA 3AHHA 3HPQA 1MOQA 3QKRA 3UAZA 3AEZA 1V26A 1W85B 3CZ5A 2VDPB 3JASA 3LC0A 5F7ZA 3OT5A 3ZG6A 2ZQ5A 3IAAA 3K30A 4Z4QA 1C1XB 3ZHCA 1SC1A 1VPLA 2ZAOA 3RFTA 2I7TA 2DHRA 5IFLA 3DOUA 1CY0A 5KMGB 1PTJA 3ESQA 1UODA 4X0EA 5IDQA 1H66A 2MIIA 3CPSA 2VPWA 1GPYA 3PIIA 1PFVA 4WZ6A 3OX1A 1AURA 2XMRA 1J8DA 2OYCA 4G1FA 4V1CI 1UEJA 5A3VA 2ZRPA 2NV6A 3IXMA 4B44A 3RTEA 2AJ8A 1ORHA 2W6NA 4RVHA 2FZLA 5IN5A 5FTMA 5TVKA 3V55A 4BWFB 5FPKA 1XHLA 5FPYA 4EPWA 1PP4A 1SR8A 2BFNA 4PINA 4CQLB 1JMVA 2GBLA 4GQIA 1G6Q1 4EB0A 5TX7A 1GPDG 2YZ2A 2QJRA 1JQJC 3JTEA 1V25A 4WA8A 5F1OA 5GONF 4ZEWA 3TJRA 3UKDA 2I65A 5K45A 5HNKA 3CZMA 1XWFA 3NEYA 3CZ9A 5AK4A 3T7SA 1U2DA 4Q3AA 5KTKA 4Y9SA 3EPHA 5ITWA 2CN1A 2GR9A 2WZDA 2FPLA 1RHMA 1EXDA 2Z98A 2RSLA 3PGLA 1AQUA 4XM2A 4X5OA 4OL0A 4ZKEA 1OXMA 4IUBS 4A91A 4DA4A 2ZCUA 5JCOA 1CR6A 2P3OA 5AVTA 2Y6UA 3AY3A 1USKA 4W5HA 2UYCA 4MA4A 4JYZA 3U3RA 2JHAA 2O2IA 4RYLA 1EHYA 1QR2A 1Q1NA 1MGPA 2A4MA 1UBMS 3IA2A 1E62A 3CRVA 4MR8A 1VGRA 3GLSA 3L7CA 3AFNA 2AG1A 2WYVA 2CXPA 3GIWA 1HE1C 1KR5A 2W98A 3D3EA 4UHBA 4ZOBA 4A1OA 1G5QA 3R1IA 5AJHA 1Q14A 4DZRA 9GPBA 1V6AA 4JVMA 3C5EA 4ZHQF 2D06A 3JD4A 2FMIA 1J7KA 4LE2A 3AM1A 1ZWLA 4NU6A 1VIAA 3IVXA 5DN6D 3DSRA 2ACWA 2J45A 5EJEA 3WLAA 5FR1A 2HC9A 4HMOA 4BVEA 4X8OA 1OZHA 4QFDA 3RQSA 2VC2B 1NJ1A 1ZOIA 1KYTA 2WABA 4ZMSA 1Y3AA 2B98A 5ALUA 4BQIA 4I4TF 5B36A 3RB8A 2W6QA 5LYJF 3KB2A 3QY9A 4CIYA 3E9ZA 1BA2A 1FVHA 1ONPA 3KYJB 4QFBA 4Q1DA 3S7TA 1KYVA 3TZKA 1MQSA 4TX1A 3H8JA 1RTTA 3ONVA 2ZI3A 2Q4OA 3NHSA 2AZ4A 3OIYA 2R00C 1JIXA 3E9NA 1L4MA 1WCWA 3A10A 3SVLA 5CGQB 2GSWA 5CM8B 2IYNA 4NDZA 1AK9A 1F9EA 4BLPA 4WK0B 1KQFA 1UK9A 4MEJA 1CW2B 3FPSA 4CU5A 2WYHA 3LL4A 3FMOB 3Q0EA 3QPCA 1HYBA 2PMBA 3A27A 5H9WA 5I01A 1XJ5A 4RZQA 2FPWA 2O3QA 5C8ZA 4BMYA 1XD8A 3HUUA 2I7DA 2IEAA 3LC7O 5BYBA 1BCRA 4CN8A 2QUAA 1RNLA 4ALNA 2I2CA 4E0BA 2N42A 2OV2A 3I30X 4NBVA 3R09A 5C3UA 4C07A 4TMKA 5A02A 3JV7A 4Z3DA 3TLXA 4U39A 3SZRA 5GV7A 4GSYA 4W99A 3UUGA 1E0DA 2VTKA 2H2FA 2WU4A 4IOMA 5BYAA 1C7ZA 1QWSA 1SCUA 1E2QA 2H5EA 3O2JA 5AVVA 2OGUA 4M36A 4MCHA 3H19A 1P7WA 2IHJA 3ZWXA 3GJRA 3M83A 3MRTA 3BJZA 5CUQA 2BMFA 2FKNA 3FB1A 5EIBC 5GZ3A 3U6KA 1VG0B 3OP4A 3ZQJA 3VNRA 1ZXBA 1UFKA 1K8YB 1NURA 4ZK2A 1J70A 1AMUA 5I7EA 1IPFA 1F0KA 2JLAA 5C0OE 4KL8S 2H7XA 2I99A 2VRWA 1GA1A 3EFOA 4M9UA 1ZBDA 4C3ZA 5IWAB 1QM5A 3PUVA 1IZ9A 3MT0A 4K2HA 5K6RA 3DLCA 1T9BA 1T6NA 2RKOA 1R4ZA 3RJ9A 1PZFA 3UC9A 4ALMA 5REQB 3M70A 3O8OB 1PGOA 3KPUA 4ESEA 3AIIA 3H2KA 4WA7A 4H15A 2FYTA 3ASYA 2R62A 3N2NA 1I0ZA 4DLNA 4BMCA 1NW6A 2PXCA 2VHXA 3OTWA 1LCIA 3EGEA 1EKXA 4J7UA 1JZSA 2IU0A 3UJCA 4QG7A 4B2PA 1E7YA 2D5AA 5DCUA 5K0TA 1FMFA 3CX8A 4Y1RB 3WX0A 2VJOA 2P35A 1RYEA 3PDCA 1VP9A 1ZA1A 4U7GA 3T3IA 4BNGA 4DM7A 4URVR 1I0IA 2H08A 1GQOA 3GJ3A 4AYWA 4JGIA 3A3NA 4EPVA 1MRZA 3KOYA 4GMGA 2HSGA 3PDWA 5KTYA 3HO8A 1NPDA 4WAUA 2N46A 3RBXA 1KXJA 5A62A 2IF2A 2EP5A 1ULSA 3ZX4A 1VJDA 4C3UA 2GNOA 4OSPA 3RT9A 1DDIA 3P97A 3PFIA 1R0CA 1VCOA 1BGXT 1KZGB 3ZDZB 2QD2A 3GYGA 3GF4A 5JD4A 5JCPA 1KYZA 3BQ9A 4N7JA 4YPFA 1AG9A 4NE2A 4CM1A 4BY9E 4JJKA 4RGYA 3X1YA 3STXA 4ALLA 3S8EA 4YQZA 1W0CA 2Z2JA 4C7JA 4DG5A 4NZOA 2GAOA 1E3QA 1CX9B 2AE1A 1YC2A 1AKNA 3NHWA 4TXJA 1NJ5A 5CK4A 5FOVA 5LIPA 1UC5B 1KSGA 1R6DA 2VOJA 3ZS9A 1Q6YA 2H1LA 3BMCA 3NBMA 5BW8A 3DE7X 3CPEA 2LZ0A 3DAYA 4KIWA 1GL3A 3FZYA 3IUNA 4OHRA 4WDRA 5DWVA 2DFVA 3CNQS 5BNWA 2X77A 1TJ3A 2IOFK 2CHUA 3N2KA 1T34A 4E1AA 4UFPA 5BR4A 2OFPA 4IJWA 3VNVA 4EYQA 1B2LA 2XUAA 2QPOA 3DZKA 3L8MA 4ZVVA 2F67A 2YL2A 5A7HA 2A9VA 3ML1A 1GFIA 3RC7A 1E2KA 3SC6A 2FN8A 4O4JF 4KYVA 4PCVA 3V3KA 5I3ZA 4ENTA 3COJA 2UUBB 1A5SB 1P1KA 4MP8A 2R68A 3AX6A 4IW3B 3VUFA 1S4MA 1TTTA 3ENVA 2UYYA 4KLRA 4CF5A 5C37A 3CKYA 1ICIA 1BJRE 2ATEA 3EXG2 1UZNA 4L6CA 1XYVA 4LAFA 4TTRA 3SHVA 3TO5A 3ZWDA 4QXRA 4BNDB 5GVSA 3OZFA 5JPIA 5BOSA 1PQYA 1ZOOA 3DTYA 1ZC3A 2F1RA 1KIMA 1Y9DA 2ONYA 3E4CA 3NV7A 1Y1SA 3R0JA 4XDYA 4XJVA 5AR1A 4M83A 5T8KA 3IAUA 4Z4CA 1ZIXA 1T25A 2O3UA 5KQGA 4I6GA 4BNWA 4BEWA 4KAJA 3GJ7A 2GPWA 3MTIA 2ZRDA 2YZKA 4TTJA 3WBJA 1NTRA 2NXEA 4KQHA 2I2AA 1JIVA 4B74A 1PR6A 4HEJA 3A6GA 4PNEA 3WMRA 3NDBB 3ZE0B 4ERNA 1D4AA 2QY9A 2WJYA 1OZAA 1R0RE 2ZTLA 3M1YA 4X3CA 3JTMA 5G1OA 4EEKA 2GF9A 2JIZA 1CJBA 2GEBA 2O3RA 3RKRA 5HJEA 3DLBA 2AC2A 4JI7B 1EX9A 4BX8A 3AEKB 5KIAA 5KTOA 5DGIA 1CRPA 1FXUA 3PKZA 1RS0A 1EVQA 2X3YA 3NWJA 4OK6A 5FWXB 1RHQA 1EM8B 4C0SA 1CPYA 1GFSA 4J16A 2JGAA 4Y2QA 3DDWA 3RWOA 3SJUA 2BHLA 2QR3A 4PLVA 1XZ8A 2IA5A 3NBQA 1OWPA 4H2DA 1G9XA 1JR2A 5LOVA 1EVEA 5HQJA 4LJAA 2XMDA 3EAGA 4X91A 1RRFA 4QTXA 4TKUA 2CL6X 3E9YA 4GYYA 4QXQA 4D0GA 1TM2A 3O0TA 2OT3B 1U5AA 2GBCA 2ZDGA 2OBYA 2H1CA 4D46A 4ZGWA 4B17A 1EVZA 2OCKA 2NUAB 4PAMA 2CMHA 3KZVA 2FV8A 4OBBA 4DJEC 1GARA 2ZJ3A 2O8DB 3KOXA 1YACA 2GKOA 2BL4A 1XZBA 2WSYB 3RJMA 3NX4A 1JW9B 4A16A 2GILA 3BSFA 3LX8A 2DECA 1N3IA 4M9CA 2Q3FA 2FPXA 4QUIA 1E9DA 4I5FA 4M1OA 3REOA 3T3PB 4C7XA 3I2YX 4E5DA 4EDHA 1XAJA 5BXQC 2QRLA 4WLUA 5IHXA 5KINB 3EHEA 3V3TA 1XXHB 4M1SA 4JT2A 4GI2A 6ADHA 2I33A 4RA9A 4I99A 2JIPA 1N8NA 3WWYA 1Z6TA 2PRYA 3RRMA 1OWOA 3AO0B 3Q11A 3WGVA 3DDSA 4HB4A 1P6QA 1Y9JA 1T36B 2OECA 1M2GA 1SA0B 4M53A 1PR4A 4X6UA 5BWBA 4DV4B 3OY2A 1Y8ZA 3RC3A 4LX0A 2GM9A 3W6NA 1PYGA 3GQBB 4X8LA 3U3OA 2QGFA 2Z56A 3HI4A 3KTOA 3O9MA 4FOSA 4MUHA 2OV1A 5EJ7A 4I2NA 1Z6ZA 2FPIA 2BM0A 1PJ4A 4GUDA 1J99A 2XGSA 1SOUA 1PJ2A 3AOEA 2VSQA 3HS3A 5JCOC 1B8PA 3LFUA 4LSGA 4K46A 4WECA 1H0SA 4IBOA 4XUGB 4D57A 1SVUA 3HQ4O 2P41A 4F4DA 2OAP1 5SZJA 5CXQA 4MTCA 1S2GA 1PK8A 1IEVA 1DZIA 4AZ3A 2QUZA 3TRIA 3E1KA 1NQVA 4X97A 1YZ3A 3UXYA 4IDGA 4CLDA 4AY2A 2OXCA 1JHDA 5K03A 3GLKA 1YNOA 3RE1A 2B4AA 4X84A 3R9KA 2BFDA 4N82A 3ROTA 2RJ3A 4FJ1A 1H8HD 2XPCA 2XR1A 3D3WA 2EYUA 2WSBA 2QR5A 1WRBA 3DAGA 3MTEA 4QAJA 1E3LA 4N5MA 2FHSA 4P93A 1C1DB 4C4YA 1WZCA 2R5FA 2Q46A 5J9FA 3G5MA 1O54A 3TIGA 4AP6A 3CPJB 4PXSA 4FXPA 2AV6A 2RMKA 4UQPA 2B0JA 2X86A 4GX5A 4IFBA 5LU9A 4DV0B 1LVHA 3PJGA 1YQ9A 1XEXA 1XTUA 1XJ0A 3NC1C 4DSOA 1NRXA 3D3KA 3MJ4A 2ZYRA 3MTJA 1GFWA 3VAAA 1E32A 1S01A 2Y77A 4DN6A 8GPBA 3T06B 1KJ8A 1L7MA 2YN4A 3PRJA 2HZBA 4P4TA 3WLOA 4A26A 4N12A 3W78A 5I48A 4ZODA 3K0CA 2OM2A 2W4IA 3L82B 3ETGA 4DT1A 1U9IC 1HK7A 1WUKS 2W2QA 5H02A 5CDSA 2COKA 1XSEA 1Q7CA 2LBPA 1DJLA 4P4SB 4MS4B 5IVKA 1TO6A 2O1WA 3FYHA 3H0EA 4KI0A 2IX9A 5AWFC 5ALTA 3DDOA 4XCQA 3OT1B 7ABPA 5FFMA 2F1KA 4B6EA 3BMXA 1L7RA 1Z0DA 2BP7B 3OZRA 4CMJA 5BSGA 3LV8A 3QKTA 4HQOA 3J81A 4ZO6A 2O59A 3ZNOA 2HJRA 2I1VB 3WB2A 1BCSA 5F51A 3VZPA 3K09C 1SUIA 2CJWB 2C20A 1YZVA 2B8JA 2QW8A 4N9QA 4QTUB 4TS4A 1QP4A 1AXGA 5A7GA 3O4RA 5I9IA 1K8QA 2G09A 3HJNA 3JQCA 1H93A 1O95A 4Y0AA 5C35A 4X90A 2Z5FA 4WY2A 2QWXA 3S1AA 1ZCBA 4DCJA 5IM4A 5M29A 1QS0B 4YUVA 1Z62A 2VIIA 3EQ2A 3B7GA 4K6KA 3IAFA 4DIDA 1FFXB 2DPHA 2FDRA 3IGFA 1I01A 1J56A 4F97A 3M89A 4I7EA 1IEWA 5I9LA 3SXUB 2WFAA 2H5LA 4LZNA 1JSLA 1SVSA 4EHAA 3LC2O 4ID9A 5L53A 4FNOA 1QIHA 4GICA 4F46A 4TROA 1F5NA 2ZIFA 3H5AA 3I9JA 2F8LA 4CL8A 1XDBA 3JPWA 5BNIA 1KZ7B 4B34A 1CNMA 4HZUB 4X8HA 4LRWA 1YS7A 2ZJBA 3WGNA 1SCDA 2YIJA 4IM7A 5FUXA 2BE7A 2PMDA 1EK0A 4AG6A 5IK2A 2YASA 3WB0A 3ZTWA 2FSHA 4NFYA 1FRNA 1QHNA 2HQ1A 3OP1A 2ORIA 4Q39A 4WUVA 1BMFA 2ZIVB 2AD5A 4J0HA 1ODKA 2DSTA 4IGIA 4H7PA 1S8OA 3QF7A 5DRYA 3WS7A 3RG2A 4J94A 2AFIB 1NJGA 4F3YA 4OJYA 2WV7A 3DGEC 2CJPA 2I29A 3ZGYA 3D7RA 5A71A 2ID4A 4RVUA 2JFWA 3KQTA 3OPNA 3SVZA 2X6RA 4LVNA 4DWVA 4ML3A 4O4JB 4GLFA 4HCJA 4POOA 2VYVA 3AR2A 5BV2P 5GP1A 1P44A 1P31A 3DXYA 1PEAA 3G5TA 3UCEA 4CG1A 1H69A 1IWBB 3GX1A 1RRPA 2GK6A 1KMIY 3HBNA 4YAEA 4AUKA 3ROZA 2IYQA 4BBJA 1RXYA 5B12A 4CTMA 3L07A 1S3FA 2EG5A 2KSQA 3GUYA 3UMCA 1I24A 1HFJA 1Z7GA 3KEQA 3T0GA 2XUGA 1YQTA 1VKHA 5L6MB 4DLRA 2WF7A 4E15A 1KC1A 2Y2UA 4Q3EA 4KO4S 2YH2A 3HXQA 3CU5A 1RCTE 4AC9A 2IY9A 3I8SA 4RLHA 2LP4Y 2PZMA 1DTWA 4LYGA 4ZANA 5G4KB 3IEUA 2QIOA 5FNVF 4QVGA 2Z8ZA 1WXQA 4EPXA 3GFSA 5IT5A 3DCIA 3UN1A 2Q6LA 5TT1A 1ODJA 1OI2A 3L1IA 3ZXSA 1SUPA 4RIGA 1ZVMA 3AY0A 3FBWA 1VKNA 3HBFA 1LWNA 2FUCA 1KMNA 1QRDA 1CEQA 3QYPA 1H0KA 3O8CA 5TQJA 2ODTX 4B80A 2QTFA 2GM4A 3ZHQA 3HGMA 3PNLA 4IDAA 3V8RA 2LVBA 1DT3A 3KAQA 5JO9A 4J0GA 1KFKB 2GCNA 2XTJA 1YR3A 3DA8A 3PQ7A 3VU9B 3OF5A 4MDEA 2TECE 4MVJH 3R0XA 4OREX 4BX2A 3MRVA 4P4LA 4MAFA 4DA7A 4IWYA 1EUCA 4E70A 3QSYA 3EEBA 2FW0A 3NH9A 4TL6A 5BMVA 1Z6AA 3ICWA 2VDRB 1ST3A 3PZBA 1V1JA 2C31A 2CHVA 3PDHA 2ECFA 3ESDA 3CUVA 2C3MA 3F96A 1XEWY 3WA6A 3WI7A 3U0BA 1LZLA 3GUZA 1IFXA 5JHHB 2ZCJA 2A4KA 3RTDA 3N39C 1MJNA 2FG7C 1FSSA 4WZAE 3R8FA 3ZBQA 3HHEA 4NG5A 1I94B 3KELA 5K3AA 2QP9X 1HG0A 5IUJC 4P3XA 4O2AF 1JX6A 1YZGA 1PSZA 1W8DA 2WD9A 3L1JA 3H11B 2PZFA 4JCCA 4MRMB 3CQ9A 3QVLA 4O1HA 3WXMA 2XD4A 2RAPA 4J90A 4F92B 1H3FA 2UZIR 3IUSA 4LZLA 3KJXA 4EEZA 3QMMA 4MI1A 4IFIA 3W9YA 3WK4A 5EHIA 5IJXA 1ESMA 2DM6A 1KVQA 1C50A 1OVMA 3ADPA 4MW5A 4C88A 3CVJA 1JFFB 4CEHA 1ZR4A 4UEKA 1UOEA 4QUHA 4CIXA 2Q3MA 1K2VN 1M1YA 1AA9A 1NQUA 3FNGA 4HDAA 5D84A 5TDHA 2VWGA 2ONJA 2GEJA 1W25A 1H2YA 3VR5A 1Y1TA 1GYQA 4DRXA 3I01M 2SKCA 4MV9A 5EUCA 3PHCA 2X9VA 3ZV4A 1FQWA 3CF6R 3IMCA 3TJMA 4OJQA 4X1KB 1EEXB 1U2RA 1V1RB 2CVOA 3I1YA 2NVUA 4MXDA 4CI0B 3FPBA 5CD9A 3K0SA 1V2HE 2PAFA 3NYIA 1Y6FA 2JLSA 4ZT7A 1TVCA 4LKRA 3RO7A 3RV4A 1U3FA 4YRMA 1HFKA 3H1PA 3HN2A 3FLBA 3HVHA 4RLSA 1R27A 4F93B 3H87A 3FOCA 3EXIB 3E5MA 2BFDB 3FUUA 4Y8VA 4ZCTA 1ADYA 1RKQA 4KC0A 2V55B 1M1NA 4LQ4A 2WFLA 1X1QA 2VH1A 4QUGA 3Q8WA 5BNTA 2EQ5A 1RE0A 1KMHB 1R15A 5KYKA 4F6CA 1A7UA 1PJ3A 2YXNA 3ZWMA 5C1OA 3WL5A 1PJZA 4TV8F 2W42A 2NNLD 1XKXA 3K6RA 1W4BA 4NS4A 3WLQA 1J2UA 1GTMA 1NQAO 5HIKA 4FWBA 5JI3E 4IXDA 5HZHA 1UAAA 2YDXA 3TNYA 3RV3A 2QTRA 5BR8B 4RZSA 1DPGA 4OHUA 3JQ9A 1P0FA 1JFVA 4KX3A 5HF5A 3OQMA 3EXHB 1D5WA 3PPXA 5E0KB 2NP7A 2IS4A 3NONA 1WMEA 1A1VA 1MO5A 2O3SA 2ZI5A 3KR1A 5G53C 1KDOA 4HO1X 1HM5A 2XNDD 1VFNA 4Y3UA 5KVCA 4DE5A 2J3MA 1HSOA 5EHXA 1SUFA 1Z15A 3FTCA 3MMZA 4L50A 1W5BA 4O6VA 4ER0A 3GK3A 3FNEA 3HCEA 3TTTA 2A0YA 1RE1A 1UKYA 4I55B 4HNUA 2ZAMA 1ZNXA 3TQSA 2DKOA 1NI4A 2JFHA 4HLUC 2NACA 3D8SA 3GUUA 2X8WA 2IHKA 4I46A 4GWGA 4FOOA 4PGAA 1NVBA 1O9GA 3R7DA 3TVTA 3GGCA 3RH0A 3SYRA 1B0PA 2GPNA 3G7NA 1EAMA 1UJCA 2P5YA 3MWEA 5A1JA 3IKJA 1Z4LA 3AJEA 3CE6A 3L7OA 3HR8A 5LJIA 2GRAA 4Q7QA 3EY4A 3OPMA 5EJIA 3O26A 5KNBD 2CXTA 4ZQBA 2FSIA 4ERXA 4ZVLA 4C0QC 3S2GA 5JNUA 4TXHA 2DQ4A 4EF4A 3R6TA 2JW5A 3OIFA 1MQ9A 4O4LF 1FFBA 2PO7A 3WSTA 2YUTA 1KGSA 5FBKA 3MAJA 4ARZA 2H5JA 3TEJA 1C8LA 1SUSA 3DV2A 3IT2A 3L1UA 4Q1AA 2QRVB 1NMZA 2FJUA 4E5YA 4F7DA 2VF8A 2ZXEA 4NPAA 1KFJB 5AJVB 3TOSA 1M2EA 3VV2A 3ZHZA 3VBCA 2CGEA 4NNPA 4KPUA 3ZHTA 1JDBB 4YRPA 4YCSA 6REQA 1N25A 3I9MA 4X6XA 1M54A 1EB8A 4IIJA 1S7GA 1YIDA 3W04A 2OYSA 4BVFA 3AY7A 4YDQA 1XUOA 1YCHA 3WMXA 3MWDB 3X2FA 2GZ2A 5GJBA 1UC9A 1UXHA 2KE5A 3ACBA 3EFOB 3VC2A 4AO7A 5JBIA 5JQGB 1EHIA 2CJYA 5J2UA 5F9MA 3EW7A 5CDFA 5KDLA 3B13B 3PDIB 1IK6A 3WYNA 5CVUA 1L5HA 1BWRA 1MPXA 3CVOA 4NE7A 5JS6A 4ZU6X 2IYPA 5A4JA 5ALWA 4A8JA 4Z9XA 5KNBH 4NLLA 1GNVA 2VUUA 1GNSA 3E3OA 4PTYA 4CKXA 4A2QA 3G5AA 1W1UA 3OE7A 4DCSA 4TSKA 4GI7A 2WAAA 3NM5A 5IJAA 3IP8A 1VBNA 1L5ZA 2EZTA 1O6FA 2XQJA 3PYMA 4IZIA 3R6LA 2FN3A 2IOYA 2PEZA 3TZQA 1JRLA 1XVTA 2J6BA 2NUTA 5JOQA 4OEHA 5H0IA 1KZ1A 2D1RA 4U7TB 5DF1A 1FQJA 2B3TA 3K0AB 4PZLA 3WKDA 2XUZA 1GM5A 1WCXA 2NXCA 3LUDA 5LP6C 3SEZA 4CEHB 1P74A 2JDID 5CJ2A 4EKYA 5ICCA 1RPZA 3FI9A 5JR3A 3QV2A 3RGGA 1LX6A 3AF1A 4Q1VA 3NIDB 1DO0A 3G2OA 3E05A 3NJ8A 3NTRA 1CNEA 2JD2A 4KPEC 1GWNA 1RBZA 3V42A 4JXKA 4MUEA 2QOEA 4A7PA 3CO5A 1DS6A 1NIPA 2HTEA 3P26A 1KYIA 5EUBA 2DP4E 3JD3A 1E2BA 3OD1A 3TVDA 1FE8A 2FLVA 3K6SB 4D9BA 4HN2A 4LY3A 5G0UA 1HKHA 4L2IB 5CXUA 2P2LA 4DRXB 2HGSA 3B2EA 4KN8A 4X44A 3JQFC 2OV4A 2X2EA 1BE1A 3DG9A 3K0CC 2H4WA 2F90A 1Z7YA 1D6NA 2TS1A 2Z4TA 3GUVA 3K2QA 4NY1A 1TPZA 3CA8A 3WK8A 1U7PA 5LKAA 4DM4A 3PPVA 1FA9A 4BZPA 3AUKA 4WEOA 1NW9B 3ITNA 1P2TA 1YMQA 2C5GA 3ABQB 1S2OA 3Q1LA 1OIXA 1QZXA 2NVOA 3GXOA 4IOLA 3HADA 1W9MA 2DVMA 2DUMA 4WCFC 1UDCA 2JGMA 4IGEA 4B7CA 3CLUC 3VO8A 4L0QA 1XLVA 2BZ1A 2HSWA 1ESZA 3KTAB 4RK5A 2WM2A 4D8WA 5DYNA 2EYQA 4YT8A 3UEOA 4RORA 2EBWA 2GJ9A 4U7HA 1U3WA 5E1BA 3ORHA 3TOZA 2P9ZA 4U2BA 1UK7A 2WD7A 3VPHA 4AUNA 7MHTA 1D7AA 4CMCA 1Q0ZA 5GGXA 2P27A 1HT2E 1PL6A 2NZ8A 1ULZA 1ZIOA 3KUKA 4GECA 4JK3A 4LCJA 5FO0A 5B1YA 5CA1A 4ZVPA 2VCEA 1GY8A 2Q3LA 2O8BB 2BCJQ 2P9CA 5E3JA 1ONNA 4ISBA 3IJRA 1PR2A 3PVSA 1U5CA 1YJQA 2I7CA 4P98A 5DBOA 2C2YA 3SYLA 2EP8A 4FYIA 1DU4A 3LP5A 4K3UA 1XF1A 1YDEA 2FFBA 2IE8A 1XMIA 1IQRA 2A57A 3BN3A 5JYCA 1CQZA 3R9XA 2ZE6A 1HDZA 5JMPA 4NCNA 2XY4A 3VYWA 3ICQB 1SOAA 2CLSA 4B5LA 2PD6A 3I45A 2ZR8A 2Y8EA 4MLZA 4CYMA 3QQ5A 3QVTA 4YR7A 1WETA 2ENUA 2X14A 5AH0A 4DMUB 3R7AA 3C24A 3ZWNA 3KNZA 2JEYA 1IQPA 1OIVA 5KX5A 2YVKA 2CXNA 5ESDA 3KFVA 2QLFA 4YRNA 5CDGA 3ABZA 1T5OA 3UH0A 4NZNA 4G0UA 4Z2YA 1UBLS 1U0BB 1PJBA 4CCWA 5SY4A 1QIGA 3B1JA 1IY2A 2GN9A 2QSUA 2FR1A 2PWBA 2HIMA 1ZVQA 2PT5A 4BUCA 5KVSA 1KGDA 2E4WA 3A7DA 4HSGA 4AFNA 7GPBA 3FHLA 2XNDA 4HZIA 1S5PA 3U1VA 5BUQA 3HDVA 3VOBA 2GYVA 2R84A 2V4MA 3JQAA 1MFPA 2VXYA 4KP7A 1VIDA 4YCLA 2Z6AA 4FDLA 1AXRA 4KO1S 4WXRA 2D54A 1RI5A 2ZBRA 1AUQA 1KRHA 2B1JA 1WUJS 4K6CA 1BFDA 1KMMA 4L0CA 2I6TA 5HDQA 4Y6PA 4YAFA 1JHUA 1V7CA 4FNAA 2H2IA 2WP8J 1TCUA 2ZYAA 4JJFA 2WKSA 5DMXA 1GZDA 1WMDA 2IP1A 3N70A 3Q87B 5JSYA 5TQ0A 3KE8A 4RK7A 2OQRA 2Q3EA 2VT7A 4O63O 3RABA 1J8YF 2VWPA 1NVVQ 3EGVA 1E77A 2YFQA 3AF3A 1NDHA 3BDVA 4WKOA 2CYBA 3S8MA 4R2IA 3FHJA 2FR8C 2ZG6A 1UDWA 3AYXB 2JGEA 3DOIA 1W75A 4G9EA 4Y7DA 3TSWA 3WL7A 1XLTC 3IR5A 1DTSA 3BD9A 1JAZA 1F3LA 2LWIA 1PZXA 3GEMA 4DCMA 3EASA 3LP8A 3GJZA 4RPCA 4UUMA 4AO8A 2CZCA 4ZRMA 1VMDA 4URYR 5CT6A 2QBYB 2JAQA 1YRHA 1JXAA 1H5UA 3LKDA 4ARCA 3LPLA 4F56A 2IVZA 1Z5PA 2IHVA 1NSYA 1Z45A 1DCFA 2I4NA 3BEOA 3BSWA 5ERGB 5K0GA 1EFAA 1R7RA 3UPUA 1JIJA 3UWMA 5HQ3B 1TKAA 3CF0A 3I8OA 2AUTA 2HU8A 2QRNA 3IP5A 2P3LA 3U7QB 3WHLA 2ODPA 1VHQA 3TD9A 1BVHA 1YE5A 3W3ZB 1TIKA 5FL7D 5FI5A 3DDUA 1Z75A 1Z7BA 1W35A 3BL5A 3DKVA 4ZFNA 1VE3A 1DIGA 3OURA 1HNNA 4FOLA 4AX4A 2GNPA 4F6RB 4NQRA 4UTPA 5FEUA 1AH2A 5HF6A 3RF7A 2GO1A 2H17A 4F2GA 3L49A 5AOVA 4PO8A 3V8MA 1TQ6A 3BIOA 4UU1A 1TVEA 4G1VA 1ZIYA 1OCEA 1QQ6A 2B9EA 2ODQA 2R85A 1WZUA 2QZSA 3BCUA 1E4EB 1YQWA 2RGUA 4UDOA 3PEFA 3UIEA 1CVRA 3D7KA 2OM6A 4AKHA 1V8BA 2YJ5A 4HVLA 3WKAA 3SIPA 2PBFA 4UEWA 2F43A 1D3AA 1VHLA 4OYRA 1IVNA 3JD2A 4XUCA 3C87A 4CM5A 3F4BA 3C2QA 4L3WA 3VYRB 4LXXA 1QPBA 1YQGA 1P1FA 2HI0A 1LPMA 5TE9A 4EHFA 1G66A 5A6VA 4S05A 1RXCA 3R3WA 4XDHA 4Z7OB 3SGLA 4G97A 5KSOA 2OG2A 3R5HA 4RPKA 3CTMA 5D3MA 2OD9A 4UHDA 1P5ZB 1R9GA 1Z6GA 4QLOA 5HFAA 1QHXA 4LHWA 4CF3A 4NWIA 1ID1A 2B7CA 5TRTA 3WHIA 3ICPA 2ECQA 3LY5A 1TK9A 2GN6A 3DMGA 1QRSA 3I8XA 1FFWA 2M6KA 1L5SA 3TZLA 1JP7A 5JLAA 2BGGA 1T9DA 1Q7BA 3AY6A 1AUOA 3OCUA 4UE6A 4FOTA 2O8FA 4B87A 1EDEA 1PT6A 2F3SA 2HHJA 3DQPA 4JXXA 4OI0A 4IZ6A 4RTSA 3NHUA 2HRBA 1GG5A 1XZLA 3MM4A 2CNOA 5EMNA 1SCNE 3BTVA 3JQ8A 4W5NA 3R6GA 4WNAA 2P5UA 4D9MA 2R6GA 2EERA 2PDAA 3QPAA 3U56A 4YBRA 4IIUA 1P6UA 1I3KA 1PFGA 1NVDA 4GRAA 2Q4TA 2GRJA 4PHTA 1EE9A 2AWNA 4OFBA 4C6TA 3M4YA 3QNWA 4D99A 3BTOA 4I9GA 2HREA 3URMA 4LI0A 4II2A 4P34A 5COQA 4E4RA 3PEYA 3L41A 1Q92A 3R0IA 4CF6A 3PX3A 4ZPXA 2ID9A 5I51A 1MX5A 1X94A 4LRUA 1J0BA 1EUYA 1U1GA 2H18A 3IH5A 1KL7A 1ZN2A 1ODIA 3DXZA 4YJGA 3RNOA 2BFPA 1FFAA 1RW4A 2NW6A 2O2YA 2WJZB 1SU6A 2FWNA 3DTVD 1TE2A 4I50B 1RYNA 3H1EA 4RIEA 3KKLA 5JQGF 1XTRA 2IH5A 4US1R 3U5TA 4XIYA 1EE1A 2RK4A 3COZA 5CFRA 4X71A 1SHLA 1YKSA 4ER6A 4PY2A 1JSXA 1QH1A 3KOZA 3PK0A 5B30A 2O05A 1OLSA 2XB8A 1XMQB 4XIJA 3SXPA 3OPYB 3TQRA 3P32A 3FNBA 1C0IA 5AICA 2NXJA 2D6FA 3DE4X 4BE9A 1VHJA 4I4TA 1D2CA 1RLTA 4YJKA 4AD8A 4BO4A 1CVLA 5HIMA 4EX6A 2I3BA 2POCA 5EIBD 1JG6A 2BFEA 5BN1A 3QBTA 4YJ3F 2CNBA 1TKBA 1U8UA 5IBPA 2YNMC 1F20A 2PMWB 4HEA6 4MR7A 3MLEA 4DJJA 1ZLXA 1WW3A 3AUTA 1Z38A 2P4QA 2XSZA 1L6RA 1PK9A 4LK3A 1XELA 4OHYA 3ZDAA 2QMZA 4MWCA 5HUQA 1VJ0A 2NT4A 4QJ5A 1MHTA 1A7AA 1ZSVA 2HJGA 5ALLA 5EE9A 1Y1RA 2ZJZA 4D44A 2IQIA 2QG4A 5KBYA 3JWHA 4OM7A 5HQTA 1BJKA 2UKDA 2ZU6A 2C5LA 1VPDA 3BMNA 1R8XA 3HU5A 4AN4A 4B3XA 4G09A 1T43A 1L5LA 4Q82A 4WESA 2OK7A 3ZCSA 4D0SA 4RULA 2H29A 3UB4A 3PC2A 2Z9DA 1OOEA 3EBPA 1UKZA 3MT9A 2DUNA 3EC1A 4KFSA 4NJEA 5IWCA 3NRBA 5DULA 2WWVD 3ZXUB 5DBIA 2Q3BA 621PA 3CRRA 5JATA 1K89A 1C41A 2REXB 1V9LA 3IULA 3QFFA 2HF7A 2IXTA 4GOJA 2HLDA 4CTNA 5I7FA 1M73E 1W19A 3SE0A 4C7OB 1U98A 1Z2PX 3ACCA 4FVTA 1FMCA 3AEQA 4HAYA 4H4EA 4PG5A 5C31A 2JBWA 3NM6B 1QVVA 3DBOB 5HOEA 4IIFA 1J97A 1MVNA 4L5YA 1DCKA 5HGJA 1C3EA 1QIDA 2J6HA 3DYVA 4G4JA 3O8BA 3ZE7A 1WMFA 1TYZA 3MG9A 1L8OA 1NRWA 4TWZA 4OATA 1ZM9A 5DHAA 3DE5X 2TYSB 2VJLA 2ZUWA 4AJ2A 2R6AA 4AN0A 1RU3A 2QU7A 3JR3A 3BERA 3SLKA 1NSFA 2XMGA 2Y68A 1P4HA 3ESCA 2OMEA 5JDIC 5KNLA 1RYHA 3CF4G 3AKEA 3DOHA 4DSAA 3CVYA 4PC3A 2WF8A 2GZSA 4FFVA 4UTVA 5GZ1A 1EDZA 3D7LA 4Q16A 2OXRA 1VG1A 3VMFA 4D45A 4IS2A 2ADOA 1V16A 1JLHA 3AUSA 3GN1A 2XITA 3E7XA 1IRIA 4IMRA 1I5EA 3BFXA 3L2OB 2JGIA 5CLQA 1NQWA 3SQNA 2PMCA 1XNGA 3AB3A 1XNJA 1PJ8A 3AIOA 5EA2A 5BWLA 1NDQA 2R7AA 3RU7A 4BFYA 2WDZA 3GJXC 3KU1A 1MRNA 3NMUF 4KVZA 1J8FA 1GUZA 1WMSA 1FX0A 1G3QA 4LJLA 2B4KA 1HDIA 2EIXA 3TLAA 1A5ZA 5ALOA 1NMQA 3L6BA 2NTVA 3U44B 2G36A 4BYGA 3GEPA 2Y0PA 4JC4A 2YWCA 5FFNA 2R48A 4YK7A 2C3PA 4UNIA 3DE3X 4MVJM 5KEIA 2PT6A 3ZH9B 2FAXA 4BB5A 1SU8A 2J9FA 2NTNA 3AUFA 1NY6A 1SCBA 1H1TA 2CLFB 2RHWA 3EG9B 3P5BA 4ZVOA 4E6PA 1E3MA 2IK8A 3O4IA 3FHCB 5CJJA 2CFTA 3UAGA 2OCLA 3EHDA 2OLEA 3A31A 2IQ5A 1X7DA 1XZEA 2I1LA 3IRUA 1I8TA 2EL9A 1E2LA 3M9LA 5KPDA 1YBFA 2EC5A 3NPMA 2GN1A 4GGMX 1E2UA 4UJ5A 1OX4A 5EOVA 1YH3A 3T4PA 4NAHA 3LQQA 5BNFA 1FU4A 1XWIA 1R8JA 3WLRA 1RAAA 1RXSA 1UT8A 1PBTA 3FKSD 1A4IA 3M49A 4CM7A 1VBMA 1B6TA 2M6SA 1M2VA 3P19A 3QOXA 3LD9A 1IUPA 2I3AA 4II7A 3E9MA 3L6DA 1W7AA 2MWMA 3K96A 1K66A 3H1AA 2LNDA 3L8DA 4DLBA 3AIKA 1B73A 3AV3A 4ND3A 1VE1A 1Q50A 2XOKA 5L3SB 5E9QA 4K8RB 2JJ8A 2ZS8A 3QW2A 2Q7XA 1YRQA 2INGX 2V45A 3AIMA 3RU2A 3IIJA 4B79A 2LD4A 1Z28A 3SJCA 1OB2A 2AT1A 1RHUA 2E85A 3LCCA 1GZ4A 4J3JA 3SZ3A 3WWEA 5BPHA 3I04M 5K6TA 4K6MA 1L3IA 5BSRA 4AROA 4NR0A 1CS0B 1OKKD 5EP1A 3TLKA 2VZ9A 1PJAA 1DC4A 1JQDA 1DAEA 2F7SA 3A6JA 3GGSA 3PFBA 3F5SA 5E95A 4QTTB 1W6RA 2J3EA 3B6ZA 3F7TA 4G5QA 4ZO4A 5TQ2A 4XPIB 4JKOA 4F9TA 1G3MA 2W00A 2F17A 3ZV5A 4JELA 1M67A 3FAKA 3VNQA 1VXOA 2L17A 1LPBB 3IV9A 4FEGA 4QDOA 1EVKA 5E6RB 1I4DD 3ID6C 3ANXA 1G0NA 3OU7A 1QHSA 4HLNA 4NYIR 3TW8B 3HRIA 3UV6A 4M9RA 4PQYA 2ZIWB 5JFOA 1M8JA 2PX3A 1T9ZA 2EIHA 2JAHA 4HWSA 3GZNA 5FBZA 4LE1A 5K4HA 3AKCA 3HYNA 1QE0A 1UJ5A 1RQLA 2BKVA 3KOMA 3O91A 2A35A 4XVRA 4EHNA 4XQCA 1XMXA 3MPOA 5DH9A 2MR6A 3ZWVA 4QXMA 1G8FA 1O94A 3BICA 3QI2A 3WIEA 1NW8A 2F3QA 3GW8A 3OIWA 5LBIA 1R0WA 1S4QA 1CZKA 2BM9A 2P3SA 2YJ3A 3JWPA 4PZ0A 4P5DA 3H9GA 1D2GA 1AS2A 3PNKA 2D2EA 4LCEA 4LQCA 2XHZA 3FWPA 5AKLA 1TA0A 3EPJA 1K7CA 4DY4A 1YZQA 1QTQA 1FDOA 2ZJFA 4GR5A 4AK9A 1QKJA 4MQBA 3T3MB 5DBEX 3PNOA 3RVOA 1LH0A 4IDEA 4KRYA 3VU3A 4MV8A 1U0FA 2HO4A 4TLLB 3DZBA 3IBSA 3E3MA 3AHJA 3HUTA 2Q2WA 3MWEB 3NG1A 3OEED 2JZCA 4QFMA 4BMOB 5KQRA 1R0ZA 5ULLA 1BTOA 3DBLB 1LX7A 1FLAA 4MJ7A 5HVNA 2AMYA 1GTL1 3HSSA 1H8EA 3ZDEA 3ET4A 1GAEO 3SK0A 4EYEA 3LRPA 5WRFA 4A92A 4ZA2A 1FTYA 1N8SA 4BRZA 4K2AA 1GCUA 1YZLA 1HNXB 1R8YA 5E8RA 4M89A 2RHLA 3CJRA 1SBZA 1E64A 4UTOA 5BV7A 5T3UA 3I12A 5T4BA 1QGOA 3ZD8A 2JAUA 1XEXB 2ZPAA 3HCPA 2HH9A 4G24A 4JCOA 3PQ5A 4FNGA 4M1EA 4G8BA 4QDXA 4QPDA 5KVAA 3TR6A 2ETVA 1ODCA 2C3OA 2Q99A 3T3OA 3UJ8A 3AMVA 3GHHA 1ZD1A 1QB7A 2AFRA 3W3AA 4FGSA 1KHTA 1NI3A 1PQ4A 1S2LA 4OUDA 2EQAA 2C07A 5FEMA 1AZTA 1N1EA 3ZVLA 3AVUA 5KSYA 1A77A 3E70C 5KSPA 1LSJA 2B5VA 1DAKA 2FG6C 2GETA 4GBJA 4K1XA 4O4LB 5G0VA 4C0BA 2VK4A 3EDCA 1E1QD 3EA4A 1CQWA 1WPXA 3M6XA 9LDBA 3B2NA 5LA6F 4IHJB 3SEQA 1RWQA 1CB0A 4X6YA 2B1RA 2HQSA 1BMTA 2ILTA 2IVFA 4EW6A 5ARDA 4I55F 1QYCA 4RWZA 3HP4A 4HEA1 2XF8A 4DKJA 1JH9A 3S2UA 3ZBPA 2CD7A 3LVBA 2JFVA 3OT4A 2ZSKA 4PZEA 2W4MA 1ZU4A 4B45A 1HDYA 5LFAA 4UKDA 3FSGA 3HRHA 4Y30A 5T64A 3KQQA 1J7JA 1LDYA 1P9LA 2C4WA 2NVWA 1RPJA 3BA6A 4JHLA 4LYFA 5HMLA 5U1PA 2B69A 3KVNA 1LI4A 5FBQB 3U0VA 3UAYA 3QITA 4N3GA 4MI3A 3IOEA 3VH3A 4MO9A 1L5NA 2B9VA 2NU6A 4B6QA 4CJXA 3VI4B 1DAHA 2ZRQA 5L7WA 1Y8RB 1L8QA 2JJ1D 1YDFA 2XZTA 3BK1A 5T67A 4ZAXA 3E8MA 2QZ4A 4EUSA 1WU7A 1TFUA 1JG7A 2N1BA 2OV8A 4NBRA 5BN3A 5IFKA 1IN1A 5BWMA 2JFGA 5JNTA 3HHPA 1ECFA 3QKRB 3AVOA 2WVHA 4ZO9A 3RKSA 1CJVC 3Q6NA 4JYBA 2QD3A 1OQAA 4HAUA 3KG2A 3SX2A 4DYVA 2BTEA 3FDZB 1ZONA 3PHIA 1FYDA 4NI5A 3WIOA 2QPTA 2QYSA 1VYHA 4NJMB 3TLEA 4A82A 5AHRA 2IEBA 1ENPA 1MC8A 2Y0CA 2P30A 4OGWA 2C3YA 1GZSA 3AVQA 3M5PA 4HC4A 4OHVA 3V46A 3EGXB 2H59A 3DEHA 1ZFNA 2Y1EA 5FI3A 5DNUA 2QMOA 3BHIA 4G36A 4IILA 4L95C 2PUEA 3V4VB 2EFDB 5EJ2A 4OFWA 3E03A 2P6OA 4B3IA 1KO8A 1QNLA 1LQUA 3VVCA 2VATA 1P2UA 3S5JA 1Z33A 1N5KA 2JK0A 3H8WA 4YPVA 1Q7EA 4OXIA 1JDPA 3BB3A 1UR5A 5SYMA 4HG2A 1ZICA 1ACMA 3REQB 3KSBC 3VNUA 3BWDD 3P5SA 2ZRHA 3MB5A 3QVSA 4O25A 3R8CA 1TC1A 2MINB 2XMBA 1Z17A 5KNDA 4G0QA 2BSQA 3PXUA 1NC1A 4DYDA 4RF4A 1NUUA 4NS1A 2OP1A 4UAJA 3SR3A 2DBVO 1Q84A 1KE2A 2RC5A 1PHRA 3JVEA 3KT3A 3DMDA 1J5PA 1JQBA 4Q1BA 3SKVA 4BTVA 4NFSA 4NJEB 1CY4A 1YE8A 1Z37A 4MWBA 4PYLA 5GWXA 4RJJA 3C8ZA 2YKGA 3MXOA 4OIFA 1XTBA 3Q7QA 3MOSA 1K5GA 4EYOA 4RTMA 4U02A 3C41J 3PR3A 2Z8YM 5FOQA 4UTRA 4ANFA 1Z9BA 2ZJ4A 3WLHA 2WWRA 1CIJA 1CZLA 2BELA 4DV1B 3MBOA 2YOGA 3AUJB 1QRUA 2YV3A 3K0AA 1H9CA 4IWNA 1QFXA 1WULS 3EVGA 1X7GA 1ORVA 3L8CA 3RTCA 2RGNC 3S1LA 1JSZA 4JITA 4QYTA 3I73A 4Z2AA 5GTDA 2XSZD 5JJ5A 1Q22A 1BE6A 2NUBA 2QORA 4CIDA 3FZQA 5JS1A 3L0PA 1YQQA 3BIJA 4LC0A 4LXYA 1HNWB 1YVPA 4IJQA 3OZUA 3HNOA 2CUKA 2ZUDA 2PBZA 3AFHA 3IYLW 4FW9A 3ZVRA 2BGIA 4R1QA 1EUDB 4ETNA 2IZOA 3C3CA 3F97A 3FYUB 2FDCA 2G63A 3DWGA 3WGYA 1DBSA 4FJ2A 1JPNA 1HG1A 5I7VA 1KBZA 2FPPB 5FKJA 5C5DA 4US2R 3LUJA 1RFLA 2ZBUA 3BB4A 3DYIA 3JWIA 4MROA 3KC2A 5FB3A 3TL2A 2VG8A 4ETIA 2YJNA 3BULA 1P62B 1PDVA 5JBNA 3FFWA 4MRRA 1LJUA 5BR7A 1B8OA 4QGBA 4F4FA 1ITZA 1AGPA 3AKDA 5DHSA 5TIIA 3BH6A 4LJ4A 1ZM2A 2DY1A 4FS3A 4Z9YA 1E1CA 2Q2VA 5EMLA 2IZ6A 3ELYA 5FUWA 2OR3A 5IDYA 3EZ7A 5K1ZA 4NENB 3DBLA 4DARA 4EHHA 2C98A 1YR8A 5GVRA 4PGHA 1VSUA 1W36D 1IOZA 1GXSB 4XDGA 5FO1A 3JQBA 1T2CA 2HWXA 1JLSA 3K1TA 3O3OB 2GESA 2XUJA 3ENQA 1UCFA 4PO1A 3L4SO 5LMCA 2J0EA 3EOBI 1XZQA 2FXIA 1NWCA 2OCIA 2W2OA 3CRMA 3DZFA 3KXKA 4H1TA 4TLEA 2H4FA 4OV6B 3RROA 4KQKA 1C5KA 4CCSA 4C87A 4KWEA 3P2EA 4EY4A 1CBUA 3JYLA 4GBMA 1C2TA 1WABA 3KHSA 5D7NA 1Y5MA 2AA3A 3OMXA 4IVQA 2BUAA 1QWOA 2VJMB 3W6UA 3EY9A 4WOCA 1GCAA 5EWLA 3D5EA 5IYZF 1ZUHA 2VNKA 3QMVA 4QRHA 1PQUA 4IMIB 3O8RA 4Y9UA 4RCYA 1XU9A 4P9NA 2P77A 4CR6A 1UKAA 4DJTA 1E1LA 5C8VA 2OBMA 3OQBA 4QU5A 1ZH6A 1X0XA 1MJ5A 4QHTA 3DVQX 1SOMA 1C9MA 1I7PA 5A3JA 3S2SA 1AC5A 4KO2S 1FDUA 3F1KA 3U19A 4B73A 5EWLB 5F2OA 1BGWA 3AF0A 1YB2A 4I5EA 3EWAA 4C4PA 2I7XA 2MYPA 2JLBA 3HY4A 3UGTA 1QYWA 1K6EA 2Q41A 3P9XA 1XI2A 2VA9A 4ND6A 2BKAA 1RI3A 2J3QA 4KACA 5LC1A 4E3WA 2V9ZA 5K7SA 1BQEA 1K08A 1X9IA 3Q3IA 1VHDA 3LBYA 3DQQA 3CVXA 2WTBA 2Z2IA 3LDFA 3KSUA 5J3JA 1RYFA 4EZEA 3IDSA 2IV2X 3HABA 4J1TC 4DMCA 1LRLA 2C9ZA 2X0RA 1NN1A 4NG4A 3ZGOA 4IF4A 4CMKA 4ZVSA 2Q0QA 1GZVA 3DPIA 1I0LA 2EBFX 3E5NA 3SLRA 1MIOB 1E3JA 4RMNA 2I54A 4CKYA 1XHEA 2WTMA 4KLAA 1CQXA 1NJ2A 1Q83A 2BZSA 3DKIA 4IIVA 4R1TA 4V0ME 3PYLA 1I2DA 2ATXA 4V0MA 4UNQA 1XXHA 2EJTA 5B7PA 1RT9A 1AZSC 4IH4A 4UARA 1U1IA 4G4SP 3MT7A 3N74A 1ZJJA 2BUBA 4HKTA 1JPJA 4JBIA 4UFOA 5DX0A 3N3AC 3COYA 2PV0A 3L5KA 2WIDA 3GJ5A 5ABPA 5K20A 3SC2B 1GGFA 1PZNA 2EJWA 3FGPA 2QJWA 5CP8A 1LQ2A 1X8KA 1A9SA 2J5KA 3SM9A 1O58A 4N76A 2BYTA 1W5FA 4JD5A 1H3NA 1I4EB 2ZSFA 1UMDA 4QBKA 4C1BA 1WB9A 4MS1B 3CZAA 4QQFA 4HH0A 2G77B 3SFTA 1ESDA 1U3DA 3G2IA 3KQSA 4ZI7F 1E9BA 1AIPA 4X1IB 2OB1A 4H08A 4H7JA 1DLIA 4MCIA 9LDTA 1PZHA 3BRWD 3A4VA 2PUTA 1ND5A 1IN5A 3IHWA 1BQ3A 4Y9DA 4KXVA 5B3KA 2JJ2A 3KYCB 4UOEA 4B31A 1YA6A 1E0JA 1KTVA 2I2BA 5KHLB 1OAOC 4XOIA 4N1AA 3T1QA 4B7UA 1DGQA 5DO9A 4LSZA 4P38A 3NIWA 1MC4A 1U80A 3A3YA 3H2YA 3F6YA 1E9EA 3I4LA 3TXYA 2AOUA 1X8JA 2JRLA 4BP3A 5JARA 3CVWA 4AZ0A 3UUFA 3RSGA 1O87A 3R8XA 4FBLA 4F8EA 2R7NA 1W2GA 4LYDA 3T9FA 3N59A 5DTEA 1XU4A 5L7TA 4IIEA 3A25A 3EQ9A 3K1ZA 3CUEF 1MB2A 5EEGA 1RMQA 1QIFA 1NKVA 1ZPDA 3VH1A 4DS3A 4G5YA 5FX2A 4DCGA 2BEVB 5LMNB 2PGIA 2J3KA 2R6CA 2W6JA 2Q6IA 5J4YA 3IESA 4AJIA 1BDJA 2FEWB 5EJGA 5SICE 1I3LA 3LDAA 3UT5A 4MJXA 3IB3A 3EC7A 1O77A 5EN4A 3A9CA 3ABSB 4L4YA 3NTQA 5B2ZA 1BHO1 1UBJS 3JVIA 3EMKA 4AZ3B 2O2ZA 1ZKMA 5EHNA 3FNRA 2YQ4A 2CHFA 4KXLA 3B9PA 3HBMA 4H18A 4I6EA 3GJQA 4WPGA 4YB8A 1ADGA 1G17A 2GBIA 1K98A 3HP7A 2FSVA 4ZREA 4QG3A 2DF8A 1DJPA 1VLQA 3A3OA 1PYDA 3DDZX 4DAOA 1GAXA 3Q6MA 3M82A 5AM4A 3VJLA 1EUQA 2PMFA 2EKPA 5AKJA 3VVLA 4G5XA 1DKNA 3QX8A 2VQ6A 1EVJA 3FUWA 5KJFA 1YVDA 1QP8A 3H1BA 2HRZA 2R86A 2REQB 5T5QA 2NO1A 1Y9ZA 1T5IA 4HAOA 1ZVJA 3V6MA 4DBZA 5CIYA 4NCIA 3CY6A 1O8BA 2BFWA 4FGJA 3CX7A 3TOXA