4J0KA

Tannin acyl hydrolase in complex with ethyl gallate
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
454
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 159
structure length 454
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0kA00
2OGZA 3PF9A 4BCDA 4AN0A 5J3JA 4AN1A 1R50A 2J4FA 3PUIA 1N8SA 5AI8A 2GZSA 1XQWA 1FFBA 4PSDA 4DGQA 3WK8A 5IVIA 4DTCA 2VJAA 3N2ZB 3DOIA 1MAHA 4X93A 1ODCA 3V1LA 4MWSA 3B12A 1EK2A 1ZD3A 4FTWA 3BIXA 5AK5A 4EA6A 5EIEA 3W2TA 1P0QA 1EDDA 4Q82A 1A8SA 5HZGA 2PPLA 4BAGA 3WYDA 4B9AA 1UKBA 3FBWA 2PSFA 3Q8WA 4UHHA 5LLSA 2XLCA 4BAZA 2QXTA 3BJMA 4YX9A 4K5QA 5AKXA 1VLQA 1XQXA 3ZPXA 5HF8A 3FYUB 1PJAA 4G4JA 1MU0A 1ZD5A 2XUDA 3VISA 1Q0ZA 2WG1A 3M81A 4BATA 1SFRA 4AB1A 3V48A 2OPHA 2ZJ7A 4C89A 1WCYA 5HK9A 1JU4A 4RNCA 3QBJA 3Q0TA 1F6WA 2ECFA 4J0DA 5AKYA 4G1FA 4DLNA 2AJCA 4I19A 1TCCA 4QDXA 2OQVA 5AHXA 4DSZA 2ZVDA 2JGFA 1CEXA 4EZIA 4B81A 3O4HA 4Q3LA 1UK8A 3QMWA 4QLAA 5AP9A 2OXEA 1JKMA 2Y6VA 3I2FA 3H2HA 3D5EA 1VXOA 2VT6A 2GBCA 5DYWA 1YA8A 1L7AA 2XQIA 5IVKA 1EB9A 5ALMA 5AKJA 1TRHA 3EF3A 4H7JA 3JW8A 4GLBA 2C4HA 4OB7A 2ROQA 5I8PA 1JJBA 4QZVA 3DL7A 1QFSA 1C4XA 3HEAA 1HL7A 2WG0A 4NVRA 1HQDA 2XQJA 1EVQA 4ARBA 3V1MA 4EUSA 2E3JA 5A62A 2C0QA 4IQ4A 1LGYA 1WHSA 2D5LA 4UHCA 5K3FB 2GZRA 1ZD4A 3G9TA 4KACA 4FHZA 5EFZA 2C7BA 1HBJA 2Y1KA 4X71A 5CMLA 5DYYA 2HFKA 3IUJA 3I28A 4F5ZA 1AQLA 5JADA 5BV7A 1K5PA 4X6YA 1OCEA 2C58A 4LYDA 2HM7A 5AOAA 1YAJA 2ZYRA 3AIKA 2EDAA 4X97A 2QUBA 4MXDA 3NGMA 1LPPA 4H0CA 1BRTA 1UK7A 3WK5A 5JAHA 5DJ5A 3BL8A 1XRPA 4BZZA 3I2GA 2JEYA 4EY6A 4JYMA 4Y2JA 1NU6A 2PVSA 4FLFA 1HDEA 1ZJ4A 3BE8A 1XZJA 4V2IA 1ACLA 5HKBA 4BC0A 4P08A 1G5FA 3O95A 4I4CA 1ZD2P 1JMYA 5LZ7A 4NS4A 5JAUA 1BROA 4BB0A 4C87A 3AUKA 4UBIA 5A7FA 2WUGA 4QLOA 2XMRA 3K6KA 4ARAA 3A70A 3HRHA 3BJRA 3QITA 1EX9A 5CT9A 4H77A 1DX6A 2ZSHA 1CUDA 3C5WP 1ZGBA 4FOLA 1HPLA 2JGIA 3CXUA 4B84A 1H2ZA 1MX9A 4G9GA 4M0MA 2HA3A 1EINA 1U4NA 4X3CA 4KE9A 3F67A 3ZI7A 1WPXA 2DQZA 2K2QB 1YA4A 3R3VA 4H7EA 1OXMA 2WQZA 1ACJA 4GHWA 2DHEA 5FPQA 4JUIA 4X92A 3G02A 1QIMA 4FBMA 4PO3X 4C6HA 1H2YA 3VJMA 5A7HA 3G0CA 2BGRA 2ONCA 1ZICA 1P0IA 4AXBA 3PE6A 1TCAA 5D3KA 1QIGA 1ODTC 5JALA 2V97A 5AIAA 1VOTA 2RGUA 2G63A 1UT6A 3WKAA 1C7JA 2G5TA 3HLKA 5H3HA 1RP1A 3R40A 3KD2A 3ZWQA 1CUWA 2ZJFA 4H7FA 4UFOA 2CUTA 3G0DA 3VKFA 3FLEA 4WJLA 5FV4A 2HU5A 3DD5A 1N5RA 2B20A 2WFZA 5HCUA 7YASA 1CUVA 3H2IA 5ALJA 2XUKA 4U2GA 5CT6A 1T2NA 3VDXA 3PFBA 1YR2A 3WK6A 1EDBA 4P93A 3EIOA 1THGA 3HZOA 2HRQA 4KRXA 4YASA 1AURA 1D07A 2QOEA 3C5VA 1YASA 3RLIA 4BVJA 4DNFA 3W05A 3TJMA 4DMHA 4K2AA 4GW3A 4MJ3A 5A7GA 4L3WA 1UOOA 4WFIA 1LPAB 5JD6A 4W63A 5ALTA 1XZLA 2Z8ZA 4CCYB 4O08A 4X00A 3ANSA 5ISMA 4Y2UA 3EBLA 4BP8A 3IA2A 4KAFA 3CCBA 1XRLA 3IB3A 3A6ZA 2XQFA 3G0GA 1MTZA 1CUCA 2D0DA 2DR0A 2XUOA 4J03A 5JANA 1GGVA 3JYHA 1QFMA 3DYIA 4ZI5A 1R9MA 1W4LA 1FFDA 5K3BA 4EY7A 4C4ZA 5EHZA 4YK7A 5ALVA 2O2GA 3WK7A 3A2LA 3ZLVA 3BF7A 1NX9A 3VJLA 1CUFA 4KR0A 2DQYA 3AZPA 4HZGA 5K3AA 4FWBA 5DLPA 1ZJ5A 2QVBA 5CURA 3K9BA 3WIBA 5EHNA 3ILSA 4J0KA 4WY5A 3TEJA 5E4YA 3TRDA 3L1HA 2B61A 5ALPA 2WIGA 2WTNA 4IH1A 4EBBA 4FDMA 2PM8A 2CMFA 1TAHA 4UBMA 4OB8A 2XUPA 3WKCA 2YYSA 4U2BA 1CUGA 1K4YA 1W76A 4J0IA 5AH0A 1YS1X 1GKLA 2R11A 5ALUA 3V9AA 3D2CA 3WI7A 4ZXFA 4D9JA 1CUSA 5FXMA 1XQVA 4B9EA 1RYYA 1UK9A 1TIBA 5K3CA 1BE0A 3DNMA 1IUNA 4GI1A 5AKIA 4HRYA 5D7BA 2XUIA 1QOZA 3SK0A 4H7IA 2WTMA 2AXEA 2JGJA 4X90A 3FVRA 1W52X 1GQSA 1MNQA 3WJ2A 2WHQA 3G0BA 5F4ZA 1CUIA 4B85A 5EIAA 4BYMA 1L7QA 2QR5A 5FP0A 3OTQA 2IX9A 2QJWA 1AC5A 5JAOA 2FX5A 1HKHA 2VATA 4EY4A 3T4UA 1XLWA 3QPAA 5ALXA 2O2HA 1WOMA 4KE6A 1TK3A 1CUBA 2JIDA 5SYNA 1FJ2A 3QPCA 3STVA 4M0FA 4DM7A 1MPXA 3R3UA 2UZ0A 4H7HA 3D59A 5LP1A 2ES4A 3R3ZA 5AICA 1WB4A 5BWCA 1LPSA 1PV1A 4BE4A 4CG3A 1E5TA 5LIPA 3W04A 2H7XA 3MUNA 3MVEA 1QONA 3GROA 1CIJA 2XLBA 4J7AA 2XMQA 1DQZA 1IVYA 5AKHA 2C0PA 4BRSA 4RE5A 3QH4A 4X94A 5CT4A 1L7RA 4YPVA 5C8ZA 3HXKA 2VQ6A 5DTJA 5FOQA 5FRDA 4B0OA 4LXHA 4X85A 4E46A 3GZJA 4BRZA 3E4DA 2WU3A 2G5PA 3OURA 2I3DA 3GBSA 3STXA 2LIPA 1P0PA 3HABA 1AKNA 6YASA 4NZZA 4UFNA 4BVKA 3FYTA 1QTIA 1LZKA 4JH0A 2CKMA 4W1PA 3WWOA 2HIHA 1UOQA 2CB9A 3UUFA 4OUKX 1AUOA 1CUYA 4ITVA 2H7CA 3OPMA 4DNOA 4OB6A 1MT3A 4AZ0A 5JIBA 4NMWA 3OM8A 4TGLA 4C88A 4W1QA 3IUMA 4Q3KA 1QO7A 1QJ4A 5DYTA 3F98A 1CPYA 4QNNA 1QE3A 1BU8A 4ZV9A 1XZFA 1J2EA 1LZLA 3LS2A 4PF1A 1E89A 4J0GA 4TVKA 4MYSA 3F9CA 4H35A 5AK3A 4PNZA 5T4BA 4INZA 3VVLA 2QT9A 2WUDA 1CUEA 4RGYA 1R1DA 3U1TA 1WHTA 5EHXA 1CRLA 4DMFA 4KAAA 3FAKA 4G4GA 5C8VA 4QEKA 1XRMA 4ZREA 2BUAA 4LIPD 2HRRA 1XROA 4XWGA 1E8DA 2WJ3A 4LKOA 5AM0A 1X70A 2BFNA 4IH4A 1XZEA 1VA4A 1UK6A 2WJ6A 3QMVA 3C87A 3LCRA 3ICVA 3NUZA 5K3FA 2ORYA 2J3DA 4J0CA 5JYCA 1VE7A 2V9ZA 3O0DA 2Y6UA 5IVHA 4C4XA 2XMBA 4JYPA 4W9RA 3I1YA 5ALIA 2AJDA 4Y2RA 2XUAA 3G8YA 3D0KA 4QDUA 1K63A 5HK8A 2J3QA 4BVLA 4DNQA 1B41A 3W06A 1ZI8A 1ZIXA 1UZAA 3C6XA 5HF6A 1JJFA 4QDOA 2VF2A 3H1BA 3WIOA 1JJIA 1G42A 3AFIA 5E2IA 2WG2A 4HXGA 4X6UA 1CQZA 4OYLA 2WIDA 2I78A 3EQ9A 4DSAA 2RONA 4GBGA 3M83A 3R3YA 4HXEB 1XZBA 5AI4A 2ZYHA 4MEAA 2FJPA 5AKGA 2CJPA 3BDIA 1Y7HA 2AJBA 2G4LA 1ORVA 1Q83A 4X91A 2QKYA 5K5EA 5AKLA 3FCXA 1VE6A 5DNWA 4E14A 3AZOA 2XQKA 3R3XA 3KDAA 3WKBA 4GDMA 3SX4A 2QS9A 1IZ8A 5YASA 1XZAA 1GQRA 2OCKA 4PQEA 3BWXA 1XRNA 3NOXA 2BGNA 3OC0A 2HU8A 2V96A 1LNSA 1QTRA 3WL8A 4Y2SA 2X8BA 3HI4A 5IVDA 2IITA 3FLAA 4OYYA 3VJKA 1IUOA 3O9VA 1UKAA 5ALDA 2JBWA 1S8OA 4Z49A 3QM1A 5ALWA 3P2MA 3M3DA 5DNVA 5HFNA 5AM1A 3QYJA 1R9NA 5AOBA 2CEKA 4FKBA 1MN6A 3D4LA 2WFMA 2PSHA 1XFDA 2QTBA 1Q0RA 2YXPX 2O7VA 2ZSIA 4ZGBA 4GWLA 5ALZA 4B7ZA 3HACA 1W75A 1EVEA 5IKXA 3T52A 1R4ZA 1XQYA 4AMYA 5JZSA 3E3AA 1WPRA 2GYUA 4ROTA 4PSUA 4QWWA 3D7RA 3L1JA 4BCCA 1KU6A 3FYUA 3C6YA 2VEOA 3FSGD 3DCNA 4Y7DA 4WFJA 2CBGA 2JGEA 2Z5GA 1VZ3A 2HA7A 5FKJA 1CFJA 4A5SA 5HFAA 2CZQA 2PKYX 1EI9A 1BS9A 1W1IA 3U0VA 5CRIA 1O6GA 3R3WA 3AZQA 4BDTA 5BWBA 5CH3A 3LIIA 4C4YA 4XIIA 5JARA 3ESAA 1T4MA 2GBFA 2BJHA 4QA9A 5EGNA 5CT5A 2XUHA 2WU4A 4F21A 4KJXA 4AQDA 4W1RA 2C5FA 4L9AA 2HDWA 3O4GA 4Y2QA 3AIOA 1C7IA 5BOVA 5JAPA 3LLCA 4KE8A 4K6KA 5DNUA 4FBLA 5KBYA 1VZ2A 2ZYSA 3AINA 1SCKA 3FOBA 4WDQA 1UOPA 1XZHA 5AI6A 3WLAA 4B82A 3PI6A 3N0TA 3KXPA 2GYVA 1K6EA 5C81A 1B6GA 2XMCA 1E8MA 3MGAA 4QDZA 3HC7A 4CIBA 3WA6A 4Y2VA 1GPNA 4AO8A 2OCGA 3TGLA 3H2KA 4LHEA 3W9BA 1AMNA 1XLVA 1DQYA 5ALOA 3WZMA 2QXUA 3K2IA 3PUHA 5K3EA 1BCSA 4EB0A 1XZKA 1BN6A 2YASA 4RE6A 3YASA 1SC9A 4U2FA 1CUAA 1IMJA 1H22A 3D2BA 4AMZA 3RM3A 2H9YA 3I2HA 1DTEA 2WHRA 1DWQA 5LZ2A 3STYA 2FJ0A 3L1IA 4BTLA 3FCYA 2I03A 3LIPA 3HJUA 2OLEA 2HFJA 2O7RA 1J07A 3R41A 1QO9A 1SCIA 3X3HA 4Y2YA 2BUBA 2OCLA 4FLMA 4PSCA 1VA5A 3CCCA 5ALGA 2XB6A 2WIKA 5C7YA 3V1NA 3WJ1A 1VXRA 4Y2PA 4XVCA 3QPDA 2VJBA 3IBTA 2W22A 4C01A 1SOMA 2ACEA 4F60A 2DFPA 4EY5A 3ZV7A 1CR6A 4J3JA 1N1MA 4DMKA 3V1KA 2RI6A 4IHAA 3MUOA 4Y2XA 1LLFA 5A71A 5KWJA 5CXXA 4AX4A 1JI3A 4FMPA 4H18A 1BEEA 3WL6A 2HU7A 4BCBA 5LZ4A 2JGLA 5HF9A 3RK4A 2WFLA 1GPLA 4Y2TA 4HRXA 4LXIA 3HYSA 5JASA 3VXKA 3WK9A 1MNAA 1F8UA 5LKAA 1MO2A 1LPMA 4E15A 4HS9A 2XUGA 1I6WA 1LPBB 1UXOA 3IVMA 4G5XA 5AI9A 2VJCA 3I2IA 3WWDA 5JZBA 1SCQA 3ED1A 1R88A 5CW2A 3ESCA 1EA5A 2PL5A 3C8DA 3WYNA 3QMMA 4IH9A 4A16A 3C8HA 3ICWA 2NW6A 2HL6A 4Q34A 1LPOA 2PBLA 1LBTA 3I2JA 4UPDA 1BCRA 3ESBA 1GT6A 3EQ7A 4G8CA 1DX4A 4IO0A 1EB8A 1X2EA 2WHPA 2VA9A 5A6VA 3FLBA 4S0XA 2PSEA 4RPCA 1USWA 4QDTA 3E1GA 1WB5A 3D3NA 1AGYA 2XI4A 2HA2A 4DYHA 4K6HA 2QMQA 3OOSA 5FPPA 4CIAA 3F8SA 5JZ9A 2Z8XA 5ALRA 3S8YA 3IUQA 5I7UA 2RIPA 2HA5A 3H18A 5SYMA 2HHAA 4UBLA 4M0EA 5HKAA 1UKCA 5HQ3B 2XMSA 4CCYA 1A7UA 2OQIA 1KU0A 1YAHA 1CUZA 5ALLA 2B4KA 5FDFA 1XLUA 3IURA 5AI0A 2VTVA 1TCBA 1F0NA 4CI9A 4U2CA 4LYEA 1LBSA 4KRYA 1ZOIA 4L0CA 4BZWA 3FYUC 1U2EA 3BIWA 3WQHA 5I9IA 1AZWA 1JU3A 1MX5A 1QGED 3SC2A 1A8UA 1E8NA 1THTA 2YH2A 1YSCA 1BN7A 2PU7A 4X7BA 1XZDA 4LXGA 2VAVA 3IULA 1FFEA 3JWEA 1NU8A 4UUQA 2ZYIA 3KOOA 3ESDA 4Q3OA 1P0MA 2QUAA 1MX1A 1XZGA 3STWA 4N5IX 5C8XA 2XUJA 3H1AA 1XKTA 4KEAA 1QIDA 3GFFA 1GPKA 1ZI9A 4FNGA 2I3ZA 4WY8A 1WM1A 1DT3A 1UWCA 3GELA 2Y2UA 2BUCA 5T4HA 4JEIA 3M82A 4EHBA 3G0IA 5DWDA 4BBZA 2FUKA 4B0PA 2AJLI 2Z3ZA 3E0XA 2OG1A 2WSLA 4HAIA 2PUJA 3FWHA 1CQWA 2WKWA 1E3QA 4Y9SA 1QLWA 3C6BA 5T4FA 3WK4A 3WKEA 1PFQA 4CFSA 2JEZA 4UHDA 1FSSA 1E66A 5AKKA 3WZLA 5JATA 4CCWA 4AZ3A 5LKRA 2OAGA 3KWJA 4XJVA 3QZUA 1MAAA 4UBNA 4HTAA 4J0HA 2H1IA 4KE7A 3WMRA 5CH5A 3ZLTA 4X6XA 3UUEA 2XUFA 5LZ9A 1EHYA 4BDSA 2PU5A 3IUNA 1XKLA 5ALSA 1G4HA 3IIIA 3B5EA 4K6GA 5FUMA 5AKEA 3DQZA 1QIKA 5FLKA 3W9UA 2XQGA 3ZLUA 4QWMA 1XRRA 3BDVA 5CXUA 2H7YA 1QIEA 5A2GA 4KAJA 1XZIA 3F97A 4E11A 5DTIA 5ALFA 3PDCA 4DIUA 5AK6A 3H0CA 1M33A 3DL4A 1LPNA 4OD0A 2XDWA 2PSDA 2GBGA 5E4TA 4MYDA 1JT2A 2HA4A 4HXFB 4MQLA 5EHQA 2AJ8A 4J0JA 1TQHA 2QRUA 2EEPA 1J1IA 1FFAA 4UBOA 2HADA 2QZPA 2WJ4A 1F0PA 1KEZA 3O9MA 4HVTA 2WHPB 3I6YA 5KWIA 1ISPA 5JD4A 1ORWA 1BEZA 1G66A 3WWEA 2GYWA 1X2BA 5CH8A 1DWPA 1K8QA 4N8EA 3DYVA 2JGKA 4OCZA 3R0VA 3FVTA 1ETHA 2X5XA 1EH5A 4B83A 5LZ5A 5AIBA 3PFCA 3EQ8A 3C70A 2QJRA 2XT0A 3DKRA 4KYVA 1VKHA 1U65A 1ZGCA 5AJHA 3DEAA 4G9EA 3OG9A 4UBKA 3SWWA 2HA6A 2ACKA 1GXSA 4U2DA 3KWFA 1HLGA 3H17A 3HSSA 2BCEA 4MEBA 3O4JA 5AM5A 1IUPA 4MWTA 4X95A 4OU4A 5LZ8A 4H7KA 1EXWA 1H2WA 5D6OA 1N5MA 2J4CA 5ALYA 1QZ3A 4FLEA 3WL7A 4UBJA 5D3ZA 5EIHA 1EK1A 4FFVA 5HF5A 3STUA 1FFCA 2QM0A 1ZIYA 2HA0A 4ZRDA 5ALQA 3GUUA 1JFRA 1DU4A 1RWQA 1CUUA 4Q1VA 1OILA 4UHBA 3G9UA 5HQ3A 3H2GA 2PSJA 3CN7A 4N8DA 5E4JA 1YB7A 4P92A 2VSQA 4DNPA 4GECA 2ZJ6A 4FNMA 4F0JA 2XE4A 3D2AA 3NWOA 5JD5A 1CV2A 2WLSA 4ZV7A 3WWCA 1QIFA 4I3FA 1DINA 2VJDA 4GEGA 5AO9A 1R3DA 5AI5A 3B3QA 3CN9A 5AM4A 1UFOA 3H04A 1CLEA 2OAEA 2P8SA 4L72A 4ETWA 1CVLA 1WB6A 4BAUA 4B80A 2GBIA 1MJ5A 3RARA 1Q84A 4U2EA 5AK4A 5T4EA 1EDEA 3A2NA 4P9NA 4DMCA 2RAUA 1QIJA 3A2MA 4MQMA 5CTAA 2JF0A 2WFLB 3DOHA 5AOCA 1A8QA 2Z3WA 5CT8A 1ZI6A 4QE3A 2X76A 1GZ7A 2XMZA 2BKLA 2XMDA 1H23A 3GA7A 3ANTA 4BC1A 2WILA 2WUEA 1YS2X 4AO7A 1CUXA 3H19A 1CUJA 4CG1A 3C43A 2JGMA 4UFPA 3I1IA 1IZ7A 3DS8A 1CUHA 2RHWA 2WM2A 5LYYA 2Q0XA 3WA7A 1YCDA 2Y2VA 5ALKA 4G4IA 4N5HX 3BF8A 4OPMA 2B9VA 5K3DA 4WDRA 2DSNA 2C5GA 2W6CX 3I2KA 2PUHA 5ESRA 2DHCA 4UHEA 4Q05A 3WWPA 1A88A 3VVMA 3AILA 1VJ5A 1Y37A 2VAXA 3PF8A 2XUQA 4EY8A 4ZWNA 2VT7A 2WIFA 3G9ZA 2IIVA 5EI5A 1DWOA 2WUFA 4H7DA 4AO6A 3S2ZA 2OGSA 1XZCA 1XRQA 1ODSA 1QIIA 1W6RA 3STTA 5AM2A 4W1SA 3G9XA 4PW0A 4WFKA 2PX6A 4GXNA 3H2JA 3O4IA 4WCVA 2DHDA 1Z68A 2RHTA 3IDAA 4JNCA 5KREA 1H2XA 1DT5A 4A23A 5ALNA 1J06A 4CG2A 5CBKA 3WL5A 3C6ZA 1Y7IA 4G8DA 1TKRA 3LP5A 3DLTA 3BXPA 4XX1A 4OU5A 3QVMA 1U8EA 4UHFA 4FFWA 4BP9A 2V98A 1AX9A 3KSRA 2R8BA 4B6GA 3G7NA 3I6ZA 5AM3A 2DCMA 4TPKA 3FSGA 3FNBA 3F96A 2OCIA 1O6FA 1XZMA 1YB6A 3RKSA 2O2IA 2BAGA 3WKDA 2OGTA 5IH7A 4BTVA 3DDUA 2WIJA 4OSEA 1QIHA 5ALEA 3DJYA 2XMGA 3DKKA 4PV7A 3PICA 4G8BA 5ALHA 3UMJA 3C45A 5AKZA 1JMKC 3I6MA 4N8SA 1GKKA 4BE9A 3AJAA 3AIMA 2EDCA
chains in the Genus database with same CATH superfamily
2OEPA 1RQ2A 3A1TA 4EHFA 2R7KA 3WRXC 3LMKA 1UQTA 4R2LA 4MZDA 4GM0A 2C5SA 2GZ1A 2ZYTX 3BUSA 3VYWA 4E2ZA 4F7WA 4ZYTA 2PL9A 3NTRA 4V0OA 1S3FA 1E20A 3DBRB 2ZPAA 3TIGA 1N8SA 1JV2B 2FZ4A 3SEFA 3ADBA 4UTRA 4DGQA 4DTCA 2O2EA 3RSGA 4WOKA 4AJ2A 1JRLA 3NTXA 4Y3UA 3GFOA 4QO7A 4FFSA 4GLJA 2GPWA 5FUWA 2J0UA 3RSCA 4LFBB 2IC5A 2O54A 1RRKA 3HEMA 2ZUCA 1EUDA 1BGVA 3N7AA 3AYZB 1EXDA 4KN8A 5HUHA 2XBUA 4FTWA 3INYA 2O8EB 5BSUA 1CY1A 1KIFA 4GMFA 1ZITA 2PGOA 1YMVA 1U5BB 1XB2A 3PU6A 2POQX 1Y5MA 3OE4A 4MIYA 5JE8A 4EYQA 5EJ4A 1OX4A 2XCIA 1EDDA 3NV9A 1QH8B 4Q82A 3LAWA 1A8SA 3BFPA 1LY1A 5BQPA 5HZGA 3AY0A 1KRHA 2D3WA 2GPAA 3P9SA 1E5LA 4FMCB 3FTNA 3WYDA 3I61A 2RG7A 1U99A 3DTVB 3PZBA 2WE7A 4D4KA 4EHLA 4REQB 1FVFA 5LDHA 5LQAA 3Q8WA 1FP6A 3GG2A 2AEMA 3PK0A 3A6HA 4A6DA 1PEAA 2AZ4A 1NBAA 4GBMA 4LN1A 4BAZA 4YNBA 5L7TA 4Z7OB 2EBHX 1NOIA 3BJMA 1TK9A 3MTJA 4L5CA 3UFXB 1MBZA 1RPZA 2B3TA 2P3SA 3CC8A 3ICPA 5A02A 3ZPXA 1V3QE 3FYUB 1PJAA 2JFPA 3ZHOA 1MU0A 3FMVA 2CV1A 1YQGA 4US2R 4EKDA 2BEUB 4GDFA 3REOA 1WKBA 2BFDB 3UPDA 3I01A 2R6R1 3SX0A 1NMQA 2GCOB 4FGSA 3EF1A 3TRFA 2JFXA 2P9HA 5FTMA 1C4OA 3BMOB 5JDCC 4Q4JA 3G8DA 5FUVA 4I1RA 2WWXA 3IP9A 4X1KB 2IYSA 2OPHA 4DWJA 4GL2A 1D2CA 2ZJ7A 4C89A 1WCYA 3GLKA 1KS9A 4D99A 3P0HA 1NBMA 4G1UC 3Q0TA 3RJ9A 3OD5A 1O08A 1QFZA 4TTIA 3SYTA 4M89A 4J0DA 4CMEC 5AKYA 3RABA 4TRRA 3ZHXA 3MOSA 1FRQA 1ZC3A 3MOIA 4CEHB 3RTBA 1XLTA 3BIJA 3IXQA 1UZMA 5C5EA 1KPHA 1O4VA 3FPEA 3W2IA 1JT9A 1R8YA 4HH4A 3AB3A 5BSRA 1NXQA 1A9PA 3B1XA 2C9MA 1GNVA 4JYBA 5AHXA 1FP7A 3BHNA 3DTYA 4KU4A 3TIVA 4EG6A 2VCEA 4IDCA 4OBBA 3O4HA 3NWPA 1VHJA 1ZONA 3QXXA 1UJNA 4Q3LA 4WACA 4YRFA 4LTDA 1SOAA 4UZSA 2ZS8A 2AMLA 3IUSA 3SF8A 1M3SA 3BHMA 5JAQA 2WD9A 1G8FA 3QIAA 3U31A 3I58A 4L7QA 2QROA 5H59A 5AVZA 1V6AA 1VFPA 1DC4A 1GZHB 1SD1A 4ZOCA 2CYBA 1LI7A 3CG0A 3PC2A 3ULKA 5AWFC 2J87A 4YMHA 3V4ZA 1Z6QA 1HDOA 1YBMA 1FX1A 3CUUA 3VH4A 4YEDA 3ZYCA 2BDUA 4ILKA 1LDGA 2GBCA 4KVGA 4YDSA 1T3LA 3KTFA 1Z37A 2OV8A 3B6JA 4M1YA 2QSYA 4ZOEA 1KMCA 5AKJA 3R9WA 4HGNA 1TRHA 1ABFA 3OCXA 2VDOB 3BRWA 3HXLA 5CYOA 1VSQA 4WZBE 2PZBA 1KTIA 1A50B 1RWPA 2R87A 1ZNXA 4I1SA 2M1ZA 2OKGA 4MWBA 1HT0A 1SJ9A 3K9LA 4WRRA 1B8VA 4V24A 4EFDA 1T9CA 1REQA 4G5YA 2P8JA 1EUQA 3HEAA 3GN1A 3T0IA 1NJ1A 4RVCA 3TZQA 1Z34A 3WWYA 1OROA 1FUEA 4HGZA 3WGLA 3AEKB 3V1MA 3PFHA 4ZZ2A 1PUJA 2C3MA 3EK2A 2PNFA 1RLUA 3TSYA 2H2GA 1Z7WA 1GZ3A 3M8KA 1PR5A 1X0XA 3SHQA 3D4PA 4IHQA 1OV6A 4ZYYA 5A62A 3FPLA 4IQ4A 4D80A 1PU2A 2E9SA 1EP2B 1Y4UA 3C3PA 2PZEA 3GNSA 4HVCA 2GZRA 4YRAA 3SSNA 2GN6A 4NOKA 2QJOA 3G9TA 4I5DA 4KACA 4INJA 4X84A 1WZNA 3WGYA 2C7BA 2R48A 3CRRA 1HBJA 1KKLA 3B3AA 4B8ZA 5DYYA 1YQ9A 1O9BA 2B83A 3WYCA 2WWVD 3J81A 1K5PA 1A8PA 1NNLA 4EAAA 2L19A 4IL5A 4GOKA 3UB4A 3GIWA 4PG6A 5AOAA 4OREX 4U7DA 3SEQA 2IH5A 1XMVA 4DILA 2EATA 2GRAA 4O4JF 2OYSA 4DQXA 2OBMA 1FPMA 1HE4A 2EDAA 1YQWA 3AJRA 3C97A 4X97A 4LDAA 3SDSA 1PVVA 2VZLA 1GU7A 2QUBA 3R44A 4DJAA 5L4NA 3VPAA 4TLDA 1LPPA 2HWKA 1KDTA 3UA4A 1X1DA 1TYDE 4LF6B 1E1DA 4MIKA 1IJEA 3RT9A 4ESOA 1GG5A 4FX2A 1OVGA 2PKEA 5LYJA 3OHPA 2XIJA 3TLAA 1G9XA 5DJ5A 4H3KB 4P36A 1XRPA 1W49A 2BZSA 3EA0A 3LDHA 2V58A 2QZJA 5A0VA 3PSHA 1OGIA 4KDRA 2NO7A 1K7XB 3UJHA 5TQ0B 4JYAB 2CFSA 2IXDA 4JYMA 2RGRA 4Y2JA 4OHYA 1NU6A 3IE2A 2Q5IA 1A69A 2X3FA 3BS4A 3CGWA 3JWJA 3BMQA 4D26A 1HDEA 1LSJA 4F1JA 2HMUA 4GKJB 3BE8A 5KVQA 2Z5LA 2GTHA 4P08A 4DXAA 1ZD2P 4LHYA 3HVUA 3VDQA 1JMYA 1I7QB 4AZSA 3ZKAA 4ZHQB 4ZQEA 4YV7A 4NS4A 1BROA 4A26A 4IZIA 2XGGA 5D7NA 1YA6A 1UPTA 1G2IA 2ZTSA 4FW8A 3RVNA 1G291 1UBOS 1GG8A 3AUKA 3NQ41 4UBIA 2V6FA 5AOVA 2FDCA 3RD5A 2Z4SA 1IZYA 3ZDFA 1C7ZA 2NU7A 2Z2JA 3A70A 3K6KA 4RXTA 1G38A 2VXBA 2PMDA 3LWDA 3IQIX 4GYWA 4R1SA 5DM1A 1N4AA 3FKSD 1EXNA 3HB1A 1NQWA 4OGLA 4YN3A 3K70B 4YAJA 3Q8LA 1XCGB 4FKMA 5H68A 2EW1A 1BDMA 1PG2A 1W6UA 2QT1A 4KFRA 4LYAA 2ZSHA 4Q7LA 5G3YA 3VU8A 5KJCA 4RADA 1I0IA 3DD1A 1V8DA 2J5BA 4MR8B 2X0FA 4B79A 5JSHA 4PWZA 2BFEB 2O20A 2QLLA 3ITKA 1VL1A 3UKDA 3KXDA 4MRPA 2W6PA 3D4IA 3FYHA 4YV0A 4P3XA 5LMNB 4EITA 2QPOA 5KKNB 5F9FA 1KK1A 1NVMB 1RRMA 3OO0A 3QNWA 4QHSA 1JGTA 1U8TA 3CXUA 3T9CA 1DNPA 1QF6A 4MVCA 5TVKA 5K0FA 2DJIA 1K27A 1MX9A 4G9GA 1PJQA 2ENUA 2A9JA 2GGSA 4XGRA 3PP8A 1V3VA 5HUQA 1M6NA 3QF4B 4MS3B 3KYCB 4TSRA 4PHCA 1VPTA 3I5XA 3WLJA 3JSAA 4GZMA 4J3FA 4LX8A 1G8SA 3GRYA 3VZQA 3O2SB 3CLTD 4FMDF 4TTPA 3ZI7A 4OHKA 4B3DA 5BSVA 1FJXA 5KSPA 1RWBA 2CHFA 2QVCA 3GZNB 3RC9A 1IOZA 3UC9A 2FG6C 4UXIA 4KRFA 3GCGA 1D1PA 1KI3A 2VIIA 1JBKA 2YY7A 2VXCA 2ZYAA 4E5DA 2BR4A 3CKMA 3HSYA 2Y1EA 4IIHA 3R75A 4BVGA 1DFHA 1FBNA 3GLHB 3HCPA 4RVDA 1CZLA 3NOVA 5EQFA 5KTSA 3O38A 3A4VA 1C2TA 4UAVA 2WQZA 1V1RA 1UKEA 4GHWA 5FPQA 1OWOA 2AMVA 2KLBA 4CMIA 2ICAA 2BONA 4XCVA 4NFHA 1F7UA 3R6DA 2ETXA 4KN5A 2HIGA 3IOYA 4C0JA 4LRTB 4ALJA 1IPFA 2JC3A 3MQ2A 3CHYA 4A82A 2N47A 1V5IA 4JC5A 4ROSA 5L6MB 1Y4SA 4GWKA 4LZWA 4UM9D 2M6KA 1WCIA 1ZGZA 2OFPA 2ZUDA 3A6KA 4YC7A 1H2YA 1GSHA 2V1XA 4OHBA 3GDOA 3VJMA 1ZRMA 5IAJA 3LZ6A 4QJ4A 4M8NE 5CB0A 2FSPA 3N3BC 3O8OA 3B7PA 4YLGA 3BWCA 4KBFA 4JL5A 1P0IA 3CLSD 4ZAYA 4OAQA 1PGPA 2IEBA 3KL2A 4AXBA 3JWPA 1R0LA 1ZM2A 3PE6A 1TYEB 2XGMA 3IE1A 4M0CA 4KQGA 4QUHA 4EMTA 3DBIA 3I4CA 5GGYA 1NVTA 4BLVA 3QXCA 4KB5A 5JALA 5F33A 2P6OA 3H13A 2CDAA 3VSDA 1VOTA 3OX1A 2X6RA 2FE1A 2H1RA 4RA6A 1RQXA 4O4IB 3VR5A 1KOJA 3JQ8A 4OGWA 1AUXA 2GN8A 4TLCA 1FMLA 1NMXA 4PG4A 5TSDA 4A1FA 2X5JO 3IDZA 3HY4A 3PIDA 4TMTA 5B6IA 1L9XA 3QWFA 1HK7A 1QQTA 3KVVA 2BEVB 3UJAA 4W4TA 3E9ZA 5EXXA 2HR1A 3PPYA 5ENVA 3BXXA 5B1HA 2A35A 2CUTA 2ZI6A 4RDHA 4UFOA 1N5LA 2CXUA 5C8YA 1WSDA 3GBVA 3AX6A 3FLEA 3GPCA 3RAPR 5FV4A 3KDSE 1COZA 2ZXFA 3CSSA 4LTNA 1I1HA 2C82A 1XWFA 4L3OA 4MMZB 3O6VA 4GD3Q 4H2DA 4N0EA 2P2NA 4B7CA 2ADMA 1P73A 3ZLBA 2OZVA 2Q6VA 1IHOA 1Z0ZA 2P0YA 3EGDA 5GWXA 2HSEA 1T2UA 1I4DD 1DFIA 4EA8A 2UZ1B 2XVYA 4YCDA 3SM3A 3VDXA 3D43A 3EMBA 1YR2A 4KLZA 3SC2B 4K9OA 1EDBA 4IDQA 4E2YA 3WLRA 1XVLA 2OXCA 2Q27A 4OIFA 3FVVA 4FYWA 1THGA 2FWRA 1MDBA 3GCZA 2HRQA 3N2KB 4AX8A 2OZLA 5G0SA 3T5PA 4CF6A 1Z6ZA 3CBGA 3FFBA 1SIUA 3KD3A 1RWNA 1Z2NX 3C5VA 3M34A 3SIXA 1NZFA 1J25A 2P1ZA 2QSZA 3RLIA 4BVJA 5J4KA 3OFND 2UZAA 2NVUB 1EA7A 4MOWA 1WB9A 4G1EB 3MWYW 1OYWA 4GW3A 3QXHA 3VR3A 1AS3A 1PUXA 3DP7A 5HPYB 1DTWA 2CK3D 1E79A 5GVSA 3EVAA 4YFYA 3RW9A 4UNQA 1ZA1A 2UV8A 4A6PA 3HRKA 4YRIA 5K8UA 3RH0A 1DX9A 4RK7A 2Z83A 5H70A 3THSA 2PXCA 3D4OA 3VZCA 4BRUA 4NCAA 3RGWS 1DEHA 1H3NA 2RGNA 3KVYA 3DBOB 1VLMA 1XZLA 2JHCA 1O9GA 4BVHA 1Y6QA 4CCYB 4O8CA 3W6ZA 1JF8A 5JSQA 2WHEA 2R5NA 1HLPA 1X39A 4KQ9A 3RUCA 1USGA 4MA5A 3EE6A 3JQQA 1JHVA 1COWD 5CHEA 1QTNA 3MMXA 1O95C 4EKYA 1VJDA 1L5MA 1U3DA 2RSLA 3AM5A 4BBJA 3IB3A 3IODA 3VOBA 2EJBA 1P5RA 4ZZ0A 1MTZA 3HHEA 1FPQA 5DNAA 4IDAA 3AONB 5KTTA 1GUBA 1PE0A 2ZTVA 2FP4A 3OUTA 4L08A 2W2XA 4ZTUB 3DAFA 2XUOA 4OLHA 4BNXA 4J03A 5K0ZA 5LB2A 4II3A 1WXEA 3HBLA 5DDIP 1GQOA 2CD9A 4FONA 4FFOA 3M49A 1T0JB 4S1OA 3UFBA 3ZHZA 4EEXA 3W5CA 3CLVA 3FTQA 4ZI5A 3UWDA 1W4LA 4RZHA 3FBGA 4ZCPA 2IPMA 5JO9A 2O8DA 3TD9A 4JA2A 4NS1A 4NONA 2CBZA 2J5QA 3SHVA 2H1WA 4E1VA 3NHJA 2MMGA 4TLMB 2V6MA 5I7EA 1Q7BA 1S5PA 3VI4B 2VJOA 4FZJA 4YK7A 3WK7A 4B32A 3QA9A 4HWRA 1OIXA 3Q0EA 1WZIA 2JIMA 4RFVA 4NCHA 3AR2A 3VJLA 3PT9A 4KR0A 2W43A 4BNDA 4HLCA 1W36D 5K3AA 2WTXA 2XNHA 3H2SA 3HBNA 3JYLA 3Q2OA 4FWBA 1CT9A 4UE2A 5CURA 3OJFA 3B9BA 2C88A 4EEZA 1G9TA 3ET5A 3VZRA 4MUGA 1E6KA 2VQSA 1D2GA 1J0CA 2X0EA 5KOHB 1EWVA 2BGGA 3TNLA 3ADPA 3HN2A 4TXNA 4UUOA 5DZSA 1RQPA 5F9HA 2BHNA 3P0RA 3IBGA 4IH1A 4FDMA 1PR0A 4EVSA 1FMFA 1TAHA 4ZC1A 4IKEA 3ENNA 3QPBA 3ZK8A 4EF6A 2IXBA 2XUPA 3K9CA 3CNHA 2YYSA 1XKQA 3SXJA 4U2BA 2E4VA 3JALB 4LBWA 3ZNOA 5D3QA 8AT1A 2V6IA 5CG1A 2EIHA 2C1ZA 3B78A 3CF6R 3LCUA 3OEWA 1C1DA 1SCDA 5E3IA 3S44A 4Q5IA 1ZESA 1EGVB 2GS9A 2I6GA 3FMGA 4BO4A 4V02A 1O94C 4YGXB 1KTVA 3G1WA 2ZWMA 4HY3A 4ZJZA 5A4AA 2CC2A 2NXJA 3E22B 5CVCA 5JS6A 1LFDB 1T5SA 2OOKA 3NS7A 4Q7QA 1SMKA 4KRGA 1U4SA 3T1OA 5AVYA 1PTKA 4FN4A 4IKPA 1LTHR 1M2WA 2RGDA 3AO0B 4QOGA 3ZNPA 4CZ2A 4YECA 2XCRB 3HXOA 3V9AA 4LBYA 4HDSB 1X9HA 4HDMB 4ZXFA 1CUSA 3BFJA 2RGAA 4OUDB 3T99A 4HDNB 3R8CA 1S3IA 2RH4A 2WTBA 4JSTA 1XJ5A 1K9SA 2I7CA 3DWIA 4P3NA 4B9EA 1Z3IX 3NBFA 1RYYA 3UAWA 3IJPA 2PXXA 3WLEA 2EKPA 1HEIA 4PXSA 4DJDC 5BY2A 2NM0A 4Y1RB 4Y1GA 4Z2AA 1A82A 2W2KA 3LQRA 2QM7A 5DTMA 4QJ3A 4ZZ1A 3EF0A 4E2FA 1ZOSA 2ZRBA 4Y6PA 2YIVX 3X0DA 2IYAA 1BE0A 4LVNA 3U17A 2ECKA 1T2AA 2OCBA 2UVPA 1IAQA 3C14C 3W3AA 3LUJA 2A57A 3NG1A 5FOXA 1PX2A 4A6XA 2XUIA 3SK0A 2J08A 4H7IA 1QE0A 1L1QA 2WTMA 2K2WA 4NFSA 4Q4AA 3ORQA 5A4MS 5HJ5A 3AM1A 1EVYA 4MGHA 3EEBA 1HE3A 2X14A 3NHPA 1S0UA 5JVDB 9GPBA 1V4BA 1XL1A 3U49A 1C0LA 1CTQA 2BCJQ 1Z0KA 2JGJA 1PD1A 4FFPA 4MRSA 4MI9A 5C0OE 4BX9A 4POAA 1Y1RA 5IK2A 1KDZA 4BNTA 3IEUA 5ESWA 5LA6F 3T9FA 4PXYA 3RUDA 2R6JA 1XTVA 1TM5E 4Z7JA 5BUSA 3LT5A 4X8LA 4PO8A 2IIBA 4HLQB 3AY6A 3G0BA 5F4ZA 5IXYA 1GUZA 4HAUA 1CUIA 4B85A 2IJGX 2NQ2C 3T5BA 1DIOB 1NSFA 2FPSA 4WZBB 3NIGB 3A37A 1ISIA 3LBYA 3NHAA 3U6KA 2OP0A 1E1QD 1W87A 1P18A 4R7GA 4AJLA 5LL6P 4FYKA 4Z0PA 2QJWA 4R31A 1T5BA 5BSWA 1N3YA 4JD5A 1E1CA 1H4VB 1QZUA 1XCJA 4IGFA 4IOLA 3EIWA 4L8GA 3WE7A 3THYB 1MG0A 2OD2A 3QQ5A 4CKEB 1XEFA 5KX5B 3ZUGA 3AHCA 3MLBA 1J97A 1V1RB 2GEVA 3PEUA 3S68A 1HXHA 2XXAA 2QAIA 2FW9A 3H5AA 1FS5A 3Q3IA 2EFHB 2NYAA 3C74A 4JJFA 3NTOA 4WESA 3NXSA 4WADA 5AJXA 1LJUA 4XM1A 1KI6B 1CDEA 1V43A 1Z3CA 1C8KA 1TK3A 2OFXA 1QU3A 5CIQA 1T2CA 3A3YA 4R5HA 4E4YA 1T8YA 2BTEA 2Z6QA 1A4UA 2R8RA 3AKEA 3PDJA 5F3DA 5J1SB 2UZ0A 5DSZA 2F3QA 2ZB4A 1P4RA 3RSOA 3B38A 4QGAA 2ES4A 2JVIA 1YS6A 5LP1A 2WIAA 5AICA 4FILA 3ZGYA 2C4VA 5JU6A 1MC4A 2QRJA 5C1OA 4ANFA 1BSVA 3GUHA 3HO6A 1DBWA 4KQWA 2RH5A 5JPIA 2JI9A 1E5TA 1IY2A 1AGPA 4HQOA 3PS9A 4MVJE 1TL7C 2L0XA 5CDFE 5LIPA 1GV1A 2H7XA 3O5AA 4IR7A 3A0UA 3JD4A 4D3DA 3SQXA 1KMMA 4I50B 3O2QB 3MVEA 1JJ7A 1Z2AA 5I47A 3KAQA 3VKWA 1BXZA 3R5SA 1QONA 3GROA 3ZK9A 2YBEA 5DHUA 3VR5H 2C00A 2BI4A 1PJ2A 4J7AA 2QYSA 1M54A 2DF8A 1X7HA 3TAXA 3CNNA 3ZWNA 1MQAA 4UEJA 1IG0A 2ZIAA 3OZRA 5LNK1 1M8PA 2EF1A 2C0PA 2YQ4A 3IHKA 3M1LA 1J24A 1ZH0A 4KWCA 2C5HA 4RQBA 1LI4A 1O1YA 4C4OA 1H6DA 4RE5A 1KP3A 4I4TB 5DNCA 1CQJB 2N46A 4X94A 4IIJB 3VC7A 3E9NA 3K9QO 3M2TA 4YPVA 1W4BA 3GJ4A 4X3OA 5FDFA 3CF2A 2AWOA 5D01A 4CLEA 1T91A 3L02A 4MYUA 2WUWE 1TXGA 1ODFA 3LC0A 3M9XA 3MS4A 2C92A 3FJ1A 2GD6A 3NNNA 4LXHA 2V74B 5B7PA 3KX2A 6REQB 3TKAA 1JFVA 3P9IA 1RYMA 2J5KA 4DCMA 3TKYA 3GRAA 2QZZA 3AWDA 3L7NA 2GFQA 2OB2A 4QD3A 2CHUA 3B1VA 2ZT6A 3HABA 3NHYA 4ZAWA 1UODA 4WA7A 3WNVA 3O94A 4JXKA 1D3AA 2YFHA 1GUAA 4BGEA 4DYVA 1LZKA 3WL3A 3PNSA 3T3HA 2PUEA 5ENZA 3SC4A 3Q88A 5EG5A 4XIGS 4YCSA 5HKKD 1X92A 3SICE 2IUTA 5TXGA 3ZZUA 1XPJA 3KLNA 3CBQA 3EEIA 1YRAA 1RW4A 1YDGA 2CB9A 2JHGA 3IILA 3JVVA 2BH2A 3UUFA 1A4XA 5CYPA 4DKJA 4LGYA 5DCUA 5D85A 1EK5A 1Q3HA 3LQKA 2GJAA 2XRYA 1T5TA 3MW8A 5B1IA 4BVEA 3PQ5A 2IBMA 4P0PB 4FEEA 5EYPB 2JANA 1BAPA 5C1PA 5FPTA 1QHNA 2OBFA 2QUIA 1J5EB 3DBLA 4MP6A 2ZCJA 5H83A 3DONA 5EN4A 1MW8X 1TU3A 2ZUEA 1YXMA 5M29A 1AV6A 4BQFA 1U9YA 2O2SA 4ZARA 1A8HA 3CWQA 1WBDA 3OM8A 5LOVF 3QEBZ 4E1BA 1Q0HA 1UMBA 2IE8A 1G17A 1S96A 3RYFA 3OESA 3H86A 3FRIA 1K06A 2QI9F 1K7CA 3K30A 5EMMA 4IUBS 3ER8A 2IOFK 4F9GA 3W4KA 1JAIA 4NYJQ 4RJLA 4F4FA 5FHQA 2ATCA 3ABOB 3F98A 3KWLA 4OJQA 4CF5A 1TZKA 4U9IS 1QE3A 4LXUA 4QRDA 2VP3A 5DLYA 5HTKA 1NJ5A 1UBUS 4RC9A 1K7SN 4IOMA 5HNKA 2CLCX 3ZTYA 1LZLA 4TS1A 3LS2A 1EUDB 3X1YA 4V0ME 4ZZ3A 4PF1A 4ZMSA 1E89A 1KRWA 2OSBA 2CJXA 3HU1A 4PGAA 4FEAA 1RM4A 1DTWB 1U9IA 2QMZA 3AFNA 3TQFA 5C2JB 3N5KA 3TR6A 4PBTA 4AG6A 4OK3A 2GJ8A 3L7CA 4XWAA 5F5LA 2GQ0A 4F6RB 4PNZA 1X3LA 4DV3B 3JQCA 3F7TA 2H5LA 3I6QA 4INZA 3WO1A 5IBRA 4YQEA 3VVLA 4TLEA 2QT9A 3NEAA 2FOXA 3Q72A 2WUDA 1IH8A 2AUTA 2FFRA 4RGYA 4YCAA 5CIYA 1KDRA 4PSAA 1AF7A 4R1TA 3ZHQA 1PX0A 3UK7A 2O59A 1CRLA 4OAPA 3EUEA 1X80B 3LI2A 3MJDA 3ORRA 3VNRA 3VO2A 3FAKA 1UBFA 2H51A 1E3EA 4I6JA 2VG8A 5C8VA 4F5YA 3EUAA 3I9FA 3I9V1 5CK5A 1PKEA 1S8AA 4XB2A 4ZREA 4CIXA 1X8JA 4LIPD 2REBA 2ZSFA 4XWGA 1LCIA 1R8XA 2FQQA 3EASA 4IS3A 1X70A 4AZ3B 1T9AA 3FTEA 3VKHA 1E58A 2WNIA 2YWCA 3N28A 1AD2A 4IUYA 2WJ6A 4GX2A 1T1IA 1WZUA 4P7JA 4TTQA 4IQ8A 1UBJS 3TBKA 5JO0A 2YW9A 4HNRA 1BWQA 2ZAGA 4LYHA 2E89A 2ORYA 2V4MA 3GN2A 4M37A 4IIJA 4RVHA 1L5RA 3RS7A 4CNQA 2AFHB 5AUNB 2WTUA 1VE7A 4NABA 4B4KA 4DDKA 1WMAA 3WYBA 4ETMA 2C9CA 3GRUA 5KYWB 1NNEA 5HXAA 1Y9EA 4CEIB 1CULC 3JATA 4C4XA 3IAUA 1TC2A 1DKLA 4ND8B 5CXSA 1DHTA 2PKRA 4M6WA 1IATA 2WVJA 3DZJA 1V3UA 2NTEA 1JHZA 2DQKA 2XUAA 3D0KA 4QDUA 1K63A 2V6JA 4DADA 5F76A 3EMDA 3OZTA 1L5QA 4O33A 4BVLA 4DNQA 2QYTA 5IKPA 1XE3A 5ECWA 3PKIA 4Y6RA 4D0GA 3VSEA 1F17A 2NSHA 4CLOB 4X62B 3ZCVA 1EEHA 2O14A 1XHFA 1S7GA 2A92A 4G84A 3R9IA 4UPEA 3PYMA 4OHCA 3IR5A 4XSGA 4QTYA 4R81A 4HN9A 2P4EA 3TL6A 1ZIXA 4LZJA 3TFWA 5JS8A 2WA2A 4OQDA 1IWOA 3F1LA 1L7DA 2ANBA 1K5GA 1UZAA 1G21E 2DZDA 1CE8A 1NY5A 2IKSA 3C6XA 5HF6A 4BMDA 4QDOA 3LX4A 2P68A 4K0KB 2GFIA 2AOUA 3B7WA 1V47A 4RVUA 4LRUA 1G42A 1CQIA 3DHVA 1UANA 3MINA 1QFXA 1Y34E 3IELA 4EAQA 1T13A 1CJUC 2WG2A 1CEQA 5F51A 3ROEA 4JJ7A 4HEQA 4DRZA 3OD1A 4GQAA 4XR9A 1TJYA 4ZOLF 4B2IA 2PZMA 1HDCA 2NTVA 1YOBA 3KHSA 4QX6A 4BFTA 4CLDA 4EJ0A 4N49A 3MWGA 4OYLA 4EL5A 2B6HA 2RDMA 3CRMA 4OQNA 1KSGA 3EQ9A 2Q6IA 3Q6MA 3CZCA 4MQFB 2DEUA 4GBGA 2AOVA 2UUAB 2V4UA 3UT5B 1KJ9A 3EOBI 3LZDA 4MQ5A 4OQXA 1W0KD 1NNUA 4HXEB 4NECA 2ZYHA 2YINC 4NPCA 3CURA 4RD6A 1XKXA 3OZSA 4MJLA 3E3OA 3LPCA 3RVKA 2VJMB 2JIOA 3MGKA 2AJBA 3L4JA 4EKIA 4F11A 4ZYLA 1Q83A 3QX3A 4FDAA 3RG8A 4CV3A 5K5EA 3E9DA 1HRDA 1RKXA 3MT0A 5AKLA 3NEYA 3SIWA 4Z4QA 1NPTO 4QGHA 3AZOA 3NH6A 1PFWA 1YT5A 3KDAA 4PYIA 4Q24A 4RKQA 3S99A 4EPTA 1M1ZA 4CEJA 5CLHA 4G81A 1E1CB 4A1OA 1HKUA 4DLYA 5YASA 2Z0MA 5A4KA 2Q5OA 1X77A 2HLHA 1GQRA 2ZYDA 3LJKA 3PJEA 4PQEA 1XRNA 2PIDA 4M1MA 3G6KA 1WXHA 4DIFA 3SNHA 2ZITA 1JYSA 4LRXA 1YACA 2C4WA 2K4MA 3CZQA 5JS2A 2H57A 4DLVA 4CQMA 1BX0A 3MK31 4Y2SA 4KR6A 3EVTA 3KYIB 4J1TC 1QAQA 3HI4A 3P71T 3PQ4A 2QTVB 2LIVA 1PR2A 3REFA 1P39A 2EAUA 4Q01A 5CPFA 3DCJA 3SEZA 1JBQA 5HHTA 4RTKA 3DZHA 4CMKA 3KSBC 1L1RA 1MLDA 4TUYA 2AJTA 5D86A 2O07A 1ZNWA 3CW2A 3UVEA 1Z0UA 3EGEA 1H2BA 3K8QA 4ZRMA 3VJKA 2VAPA 1IUOA 5B5SA 5LP6B 5DV9A 1UKAA 1FFWA 4MV1A 2YJZA 3ER9A 5HTOA 2GZAA 2YC4C 3LDUA 3O75A 1P91A 3QM1A 4HRAA 1L0BA 1KPIA 2DBYA 1JR2A 5E8JA 1M1YE 1PFKA 2DRIA 2IVZA 3P9KA 3QYJA 3G8CA 3E05A 5BUCA 1F2VA 2YXBA 3BCSA 1YJAA 4H17A 2XVMA 4CKEA 3NT5A 4RH0A 2CEKA 4U02A 3X1WA 2VRBA 2R47A 1MN6A 3D4LA 1COWA 3L06A 4MGKR 5GIOE 2AZDA 4Z1MD 4BVBA 4JX9A 1XFDA 4RS4A 4XA8A 1AGRA 1SC1A 1UMDB 2V5VA 2ZW9A 2O7VA 3D8UA 2ONJA 1OHHA 3Q7IA 3CH5A 1GRQA 3C5EA 4GM4A 5ALZA 5DHFA 1AS2A 1V16B 5IKXA 4PYMA 1H6CA 1T3SA 1XQYA 2EBFX 2NSJA 4XVRA 4IIBA 5E1BA 5JZSA 3E3AA 3UPUA 1WPRA 1GA6A 1QV9A 2H1LA 3BREA 3TLGA 5BVGA 1KYXA 4MUAA 4OF4A 1NZDA 4RXMA 2IL1A 2Q2NA 1SGWA 2Y1FA 1KHTA 2WWRA 2XRMA 2WQ7A 1KU6A 3N2GB 4BP1A 1YU9A 3FSGD 1XL0A 5TS3A 1NC1A 2X0DA 1GLNA 4MLDA 4GMDA 4WFJA 2VZ0A 3FDXA 4YCJA 3F78A 2WHXA 3KXIA 1GPJA 1V2HE 3VYRB 5BNTA 1B73A 1KXJA 3ENWA 3L6DA 3RS5A 4IGKA 2ZRAA 2R5FA 2HA7A 5FKJA 3U19A 4U2KA 2O8CA 3E9CA 1LTKA 4DV6B 3L0CA 1BW9A 1INLA 2IPLA 3HJBA 2FWIA 3KZXA 3R3SA 1P33A 4TROA 4WV3A 5HFAA 1NT4A 4ACAA 1AHNA 1WSBA 4MLCA 2B3DA 1M74A 1YBFA 1ZK1A 3G89A 2BFBB 5DXJA 3WLKX 1DVRA 1XQ1A 1U9ZA 1HE2A 1ZH6A 4DCNA 4AKHA 2HK7A 1EI9A 1Z88A 4FNOA 5EMLA 3D3WB 1JWBB 3ZDAA 5HRAA 1GUDA 5I7SA 4GYKA 3A3NA 1W1IA 1MA0A 4FHCA 1ISFA 4QYMA 4GWGA 4G41A 4QYXA 2J09A 2JFBA 4N5NA 5F3WB 4EO9A 4GQBA 4NHOA 2CDCA 1NOKA 4OHWA 4PLWA 1O96B 1Z25A 1RZ3A 3EWIA 4UKDA 4BDTA 3TB6A 2XKAA 2CXTA 4QXMA 4BQSA 2P3OA 2BPOA 2GPYA 3ITDA 2W11A 5CH3A 3LIIA 5I7FA 4C4YA 1QRTA 4I55A 4JAVC 2NP6A 2FRXA 2I9PA 3BXFA 1N1DA 2IY7A 4ECAA 4N0DA 3JQEA 2CDBA 5BSFA 4QA9A 4F96A 4IWYA 5CT5A 4I3HA 2PMEA 3L8HA 3FSRA 1E7MA 4UULA 1ZBQA 4GFDA 3RDPA 4AG3A 4ZCMA 1E2EA 2E4YA 2J07A 4P4TA 4M9XA 2A5DA 1MABB 3CQ9A 3EVEA 4QXOA 5JMWA 1FJGB 4KX5A 3D6JA 3HCFA 3R5TA 3NETA 2HW8A 1LLUA 2EX1A 5B58C 1C0KA 2AI2A 3H1PA 4QASA 4D02A 4WXPA 4E30A 3QYAA 2AK3A 4M3NA 5BOVA 4DVGA 4WKPA 1L5OA 2MT9A 4EATA 1UPBA 5KOJB 1QYRA 4LYGA 4RTJA 4MRAA 1N7JA 4G67A 4KE8A 1U9JA 4AULA 3N75A 4OKIA 1CKEA 4HCJA 5CNJA 2YXLA 3WV4A 4LSMA 4DCPA 1KJJA 3KIPA 1OZAA 4MKZA 1ESZA 1DIGA 1SCKA 4UPVA 4WAUA 1XZHA 2KWIA 3ENKA 5DB4A 4B82A 3IQEA 3C3CA 3DFIA 2Q21A 1S2IA 1L5HB 4XCXA 5AQEA 1YB4A 1G5QA 1WW3A 1E2UA 3JQBC 3EFHA 5EC8A 1DCTA 1ULUA 1JS1X 3E82A 2R8OA 3HL0A 5DNDA 2DXIA 3OIVA 3DDZX 3EARA 4IFTA 4QDZA 4UOEA 1SN7A 4LE2A 1J21A 5HIMA 1QH1B 3V4PB 3F7NA 1P5JA 2HD4A 4RCZA 3TDNA 1RE1A 1AKYA 2A9PA 3E7DA 3EH2A 2V8BA 2BMWA 3BYZA 1NHWA 1CZRA 2EP8A 1SOWA 1SQSA 2XH8A 3B1ZA 3QPUA 5TQJA 3MC1A 2ZB7A 1RHMA 2YW2A 2A58A 3BGIA 3DUFA 4GZLA 4JVOA 3RYTC 2AMFA 1X7WA 4DLXA 3L0IB 1M6HA 3A25A 3OCUA 3ZS8A 1AMNA 3DFFA 4QUBA 4HNVA 3R7WA 3R0JA 3AF4A 4PO1A 4R2KA 8MHTA 4UDOA 2WBLC 1G20E 2XXBA 5A1TA 4LJLA 4C6TB 4MI3A 3FZQA 3K2IA 4EFLA 5K3EA 3KUXA 1NJSA 3CZ9A 1ILEA 1RPJA 4XLZA 3PA6A 2CGEA 1W0CA 1MJGA 4UHKA 1OR8A 4RE6A 3VR2D 3YASA 4HUJA 1IJFA 5EJ8A 2QRZA 1SC9A 2I3AA 2YHUA 4KPUB 1IZZA 1E9SA 1UZLA 1XIVA 3ADOA 1TJ3A 3I76A 3NJ4A 4E5UA 1HTWA 5FWXA 1IMJA 1X80A 1ZO8A 2HN9A 4AY4A 2XB8A 5EINA 4I99A 4AMZA 2OO5C 4RCVA 3ST7A 2H9YA 3I2HA 2HF7A 1QHHB 1ULBA 4J29A 1AQIA 3AV3A 4J6EA 4LQDA 3IO5A 4Q00A 1DWQA 4A8HA 1QQ5A 4H0FA 4NMHA 4D8XA 2C4TA 4GPZA 1PT8A 2FFAA 2BF7A 1JZSA 2F43B 2ZQYA 3T1TA 4MP3A 1UPAA 5BRNA 4C30A 2X15A 1RRCA 1OH6A 2QENA 4AP5A 3EGCA 4GGOA 3W8RA 3KPVA 5ESXA 3AUFA 3OJOA 3HV0A 4IV0A 1WCXA 3A11A 4WBXC 4B3FX 5AQ1A 1BA3A 1HQYE 2BRUA 3GFGA 4PSVA 5CVVA 1CBUA 5FTNA 1OOEA 1NF3A 2ID9A 1RSZA 3OTHA 2P6UA 5EIWA 3SCZA 4WKBA 2H7VA 3A28A 1MD9A 1VL5A 2VWHA 5C34B 3S5JA 3T5CA 3M4ZA 4UNSA 3ZE9A 5B55A 2V7QD 4Y2YA 2BUBA 4AS2A 3UV7A 4B5KA 1P75A 3ZEAA 2OCLA 4M1SA 2FPOA 3FDJA 3C1OA 4EPRA 4QULA 4PG7A 4D2IA 3I52A 1MV5A 5DNYB 4AJIA 3PSAA 1DUSA 3DUFB 1XD9A 5CCDA 1IOVA 1VXRA 1EWTA 4MMYB 4ND6A 4Y2PA 3QPDA 4PX3A 2QN2A 4C01A 1CNMA 4MICA 2QPLA 2ORWA 2ACEA 5C9ZA 1G8GA 1IHXA 2DFPA 1T8SA 1R0BA 3QVUA 4B3SB 4LBZA 1I5OA 3B3GA 4ZIRA 1RT9A 3V1KA 1KYYA 1R16A 3DXFA 3FNIA 4I9UA 5ELLA 1JR3E 3LQFA 3AIIA 4JOBA 4IGEA 3DHNA 2UAGA 1QNLA 2JIZA 3GXOA 3ZJ5A 1IEVA 4YAGA 4NH4A 1ZUNA 1Z38A 2ZB8A 3UOGA 1FDTA 1PGJA 1NQTA 2COEA 3I53A 4PZCA 4OVKA 2IXAA 4OHMA 1PT9A 2F1HA 1VIAA 2I7DA 4JEUA 3CM0A 4ENSA 3QFRA 1GTMA 9LDTA 1X15A 1AT1A 1BEEA 1U6KA 1UPUA 2HU7A 5KHLB 3I09A 4OAOA 1AXRA 1D0IA 3RK4A 3GGDA 1F38A 4FGKA 2AF3C 5JXGA 2WMNB 2JBHA 4RH1A 5A5EA 1U0FA 4YRPA 5IEBA 4O2RA 1OLXB 3ABQB 3DQPA 4R16A 4EB6A 4B3MB 3EH1A 2POCA 3FCCA 3GP5A 3IV9A 4KO1S 4ZCQA 3V4VB 4MDFA 1E6CA 3AUYA 2WZBA 2LR0A 1QVRA 3D6AA 1EXMA 2AFHA 3EISA 4B87A 2W2LA 3HUUA 1DUVG 3HYSA 3Q5DA 3AUTA 4R6XA 4W9NC 5JASA 1SXIA 5LMCA 3DMHA 4ZTBA 1E9CA 1F8UA 1RKBA 1MO2A 4E15A 3U4GA 4DCTA 4DCUA 2XUGA 1F6DA 1GG2A 5DASA 4HAWA 3UHOA 1L4BA 1GADO 1S3SA 1C1YA 1N6PA 2YS7A 3PGMA 4LCJA 3TLJA 3S55A 5AI9A 3TDMA 1M0EA 3R9XA 2VJCA 1I4OA 3S0JA 1KYTA 3IDQA 4CODB 2V7VA 1EU1A 1YJ8A 4TL7A 4OQ4A 3WP0A 5AD1A 3FOWA 3JQAA 1EP3B 4BXOB 5KNCD 1KO4A 5CA1F 1R88A 3HNPA 3M4NA 1Z2DA 2GUGA 1Z6YA 2NOAA 1Z8HA 4LV6A 1GSAA 4UCFA 5JVDF 2FWBA 2F4NA 2DP4E 1P9RA 1U0OC 4KMMA 2XEDA 3FDIA 2I62A 3J7TA 5CW2A 2WW8A 7REQA 5KU1A 1E1YA 1ZGGA 4N01A 5FA5A 3KDPA 1MZVA 4F3NA 1II8B 5EWJA 3P9PA 3DF7A 4JJKA 1DDIA 2FW6A 3D3JA 3LA6A 1LRLA 3OZCA 4L51A 1IZ0A 4LWPA 2IYZA 4XGKA 1B8PA 1BHQ1 5TGDA 3K9WA 2BELA 1UT8A 1DJQA 2QLTA 2Y0BA 1SQ6A 4FZ5A 4TT3D 1U94A 4FEGA 3SSOA 3WBJA 2I67A 5AR1A 2YWJA 1FU7A 2Q9CA 2VK4A 4RY9A 2OMEA 2XNKA 1S8FA 1KJWA 1T8WA 4ZYVA 4DTIA 1N77A 4D9MA 1PL0A 3AR7A 3UM9A 3FPGA 5GONB 1U7DA 4LHSA 1K5HA 1E3WB 5CEEA 3WRYC 1YDEA 1Q1GA 1G8MA 1Y82A 1LBTA 4JUBA 4I3GA 3B48A 5FFFA 3I2JA 2OTCA 1BCRA 1C0IA 2HRZA 1D8TA 4J6FA 3TQSA 3R5HA 2AK2A 3LOUA 4KO2S 3TQOA 1SCNE 4G0XA 4HBGA 1OXKB 4J9VA 2H1SA 1W93A 4MKHA 4R2WA 2JAXA 4H1VA 3FWZA 2QZSA 1J20A 2QGZA 5CLFA 2IT1A 3EAQA 2FQYA 1PN3A 5A6VA 4CHGA 3TMKA 1ISSA 4NSNA 3IQHX 3NYQA 4QPDA 4RPCA 4S0XA 2CNLA 3MQFA 4DT1A 2I80A 3OZIA 3H11B 3LKDA 2GK6A 3JPWA 3GVXA 3ZZTA 3U3MA 1FUUA 1H1LB 1ES9A 3TIFA 2YICA 4QU5A 3CH4B 2XI4A 4YRBA 3G5UA 5F7XA 4A0FA 4K6HA 5EE0A 3OOSA 4L8WB 1U2TA 2I66A 2QN1A 3F8SA 4BHTA 5NLLA 2PMKA 3JQ8B 1KMIY 2IU6A 2DUJA 2YUIA 2Z8XA 3PR1A 4R41A 3W2GA 1NXPA 2QLBA 1RRVA 5FQNA 4JC4A 3ETDA 4RGBA 1Z28A 3IRVA 3BK1A 2WZCA 2DE0X 1X7WB 1XHEA 2Q3JA 1C8VB 1XSEA 1QF9A 3IALA 4ENTA 4NJMB 4IVPA 5JRJA 3VX4A 4HUQA 3WXBA 2HGSA 3BXEA 2XMSA 3HCDA 1OI4A 1Z16A 4M9CA 3C5CA 3NC1C 1N2HA 3IAXA 4L07A 4TTVA 4HDQB 3CLSC 1KU0A 1ZPDA 2OP1A 3SQOA 3ZG6A 3ILVA 1XLUA 3DLCA 4R9RA 5BSMA 5DYNA 4QEDA 1A0OA 1NQUA 1YJCA 2UXBB 4F91B 4RWZA 2NU8A 5AI0A 4Q4AB 3EVFA 2NUTA 1LV8A 1TCBA 3RIHA 1F0NA 3KS9A 3IAM1 4K9DA 4R1NA 3WFJA 4EHNA 3GAAA 1GEGA 1XMIA 2I2DA 1LBSA 4KPUA 1E9RA 1DRKA 4O2AB 1XVUA 1T9DA 2VNAA 4M4SA 1Q0SA 4OXIA 3TXYA 4EGJA 1GAXA 1OXXK 2WNHA 3N7UA 4MW0A 1JXMA 3FX2A 5FLXA 4K03A 1RZRA 3C1AA 1E2LA 3Q11A 2XNJA 3ZH2A 2WKSA 2ODTX 3QJYA 3K70D 2IDZA 3MB8A 4NNJA 2BE9A 4B45A 3WQHA 1LLDA 4E08A 3VV3A 4KLCA 1ECCA 5DHPA 5I9IA 5KYXB 2A7QA 4Y6LA 3OU6A 4FWTA 1AZWA 2AEJA 2DYKA 1QO0D 2Q2QA 3ZE7A 3HM9A 3ZW7A 4YLYA 1QGED 1V9LA 4ZMRA 5H9VA 1BE8A 1LQ2A 1ZFNA 1ANKA 1QS0B 4DQ0A 3S3TA 2WPDA 1WU8A 2HJVA 2WTEA 3JQGB 2C2YA 1E8NA 1WTAA 4YCLA 1TM7E 4PLTA 3U4QA 5DX0A 4BJHB 3SDZA 3Q3CA 5CB6A 4UUAA 4ZVSA 5DGIA 1PJSA 3A4MA 3KEGA 1KJZA 1TO6A 4JJGA 3VH2A 3ZZ0A 1J0DA 1D2RA 3DLPX 5T3UA 1W35A 4CHTA 3P26A 6REQA 2IE0A 5MDHA 3IULA 5FWYB 9ABPA 2C98A 3A7EA 3HB7A 5EYPA 1N0WA 3JWEA 3A1DA 2QL5A 3AHEA 3NCTA 1RIIA 3FHCB 2VLIA 1R0WA 1GAJA 1W1WA 4IIEA 1WZCA 3HVKA 1CJCA 1XMJA 3V80A 4YAUA 4Q3OA 1WP4A 3F5DA 1DIAA 3HJHA 1VBNA 3NBYC 5DMXA 1KEVA 1MX1A 1P4GA 2YZMA 3G68A 1U81A 3STWA 5C8XA 4WIAA 3GGSA 5DBGA 2WJAA 3LA8A 5TY0A 5AVSA 3R6WA 5DXAA 1E9BA 2FLKA 1MHPA 2XUJA 5BN4A 2PG3A 3H1AA 1N8TA 2PAAA 2G6BA 1KQ3A 1SAYA 2ODPA 3WNBA 2PAFA 5J4YA 1VECA 1ZK0A 3GJSA 3V8EA 3ZU2A 3N59A 1G5HA 1ZI9A 5GGXA 3FHJA 3T5TA 1FSZA 2P91A 4F1WA 4YFVA 1SUAA 3MAGA 5B3AA 5HSGA 1G8AA 721PA 4ZQGA 1PQPA 1O8BA 1HYQA 2HLDD 2PGDA 4COKA 5CD9A 2G1PA 3V00A 3CZAA 1PI3A 4BKOA 1EHIA 3L1UA 3O2JA 4GKVA 1VMDA 4ZXPA 2P3LA 3OQIA 2XDYA 4V3CA 2BUCA 2VBGA 1D6JA 4NZ9A 5TMDA 5LD2B 2XY4A 4E2XA 5GADl 1XA0A 4KR9A 4YRKA 3SVZA 1ZZEA 3W7BA 1FNSA 2WE8A 3BSWA 2RBKA 3QSYA 3OFJA 3BWMA 1DPGA 4N7JA 1YTLA 3PXUA 1SZPA 2Z3ZA 4G0NA 1A9ZA 3F71A 3OEYA 4LZPA 3VHXB 1FW8A 4WK0B 2DFLA 5KX5A 2H54A 1NVBA 2CL5A 3EDCA 4Y9SA 2FZWA 3MEQA 4IWXA 5T4FA 3ZWXA 4IX1A 3ND7A 2H29A 1E59A 3OE7A 2Q1TA 1G64A 4CFSA 3U4MA 3GHHA 4UHDA 1FSSA 1QH0A 2IUSA 1Z2PX 3FETA 3HZHA 1XTQA 5GM2A 1EFKA 4C9BA 5M5BA 3K0EA 5L3SB 4AZ3A 2G80A 2JKVA 2X8JB 4LDNA 3VNVA 1FS6A 1HA3A 4WXEA 1TYBE 2OAGA 3ELUA 1TMOA 1W9HA 5KS2A 1NVVQ 3KWJA 4L5IA 3MCUA 3TLEA 1E4OA 4QOHA 4JB0A 4LPSA 4JLMA 2GARA 4REQA 1DOZA 4TN1A 1UADA 4IHKA 4UBNA 4MIEA 3EPLA 9LDBA 1W36C 1FFGA 3OFVA 4QDKA 3BA1A 2NU8B 2H1IA 1DMSA 3W4JA 3AEZA 1TW3A 5AXDA 3KVOA 2F4VB 3ZLTA 2XUFA 1VLZA 1ZNZA 3TPZA 1XRSB 3I01M 4KQ2A 2BISA 4DCSA 3UY4A 8LDHA 1V7QA 4BRWA 1N78A 3DAGA 4PLYA 1P6XA 2A7XA 4LGCA 1XKLA 2YJ4A 4UW9A 4LDRA 1XCOA 3AEUA 2A30A 1EFVB 3EVBA 4GI3A 1G8YA 3OAAD 5ALSA 1IXKA 1NRIA 5I6DA 1J9GA 1RACA 1JIJA 2ONYA 4K6GA 1I7SB 3LY7A 1USUA 3P2IA 3MUEA 1DHRA 4YJ2F 4NBSA 3DZGA 3LNCA 4BU0A 3QKUA 1M8JA 5B2ZA 5BQ5A 4ER3A 1GLGA 2BHSA 1Z06A 2VSXA 1OSNA 4NRDA 5G2OA 4C6TA 1O0CA 2J3MA 5K8VA 4DSOA 5K3OA 2I0FA 4NJEA 2P69A 1NM5A 5AHWA 4N18A 1GGEA 3BFXA 1MIOA 1NN3A 2HIAA 3GLTA 3NGLA 4R9NA 4EF4A 2BR3A 2H7YA 4CTNA 4O5AA 4AD8A 5KDDA 3L3BA 1HTTA 2ZVQX 4C7BA 1RWMA 4KAJA 2O0LA 1QUFA 3HFGA 3F97A 4JLVA 2FEOA 3TSAA 1Z2EA 3ZXIA 3PTAA 4LF9B 4AKGA 2VJNA 4NU6A 4EENA 4XYGA 3RKRA 3WGMA 1ABBA 4P4SA 2B0CA 2OENG 4BNHA 3CKKA 4RULA 2G0NA 3ROFA 2BEWA 1IB0A 2E1PA 1C81A 3TOXA 3EXIA 3H0CA 1OB2A 1P1CA 2IZ0A 2OXFA 2BEKA 2AOWA 2H2WA 2WM9B 4PBSA 2PANA 3FKQA 3SJCA 3BWVA 4C5CA 4CKBA 3W6UA 1L5KA 1I14A 2WD7A 1EVIA 1WVGA 1WPGA 2F3UA 2P27A 3L0PA 4OD0A 1Z4LA 2QEQA 3HV2A 4MV9A 2XDWA 4C0KA 2PSDA 1EFCA 1T8UA 2EQBA 5E4TA 3UUGA 4DANA 4MYDA 3W78A 2QX4A 5DHQA 3B36A 3ZWPA 4Q02A 4GNKA 2GMWA 4QBTA 1Q1AA 2G9VA 3BMCB 1U0GA 3QLJA 4LHWA 1T9HA 3GJ7A 3NYRA 5EHQA 4C2TA 2OL4A 5IK2D 5JQGA 1UFRA 3NBQA 2DFKB 2QRNA 4XM0A 1E2QA 4I8IA 3VNQA 1FMTA 2D4HA 3HP4A 4H31A 1V41E 1V6CA 4OK5A 1DV1A 2QRUA 3BD6A 2XNCA 3EZ6A 3JAKA 2VRCD 1J2YA 4MV5A 4MV8A 2AI3A 1C80A 2IP2A 2NLOA 1H0RA 3RVJA 3UK6A 5C5IA 4YRTA 4B4WA 5KO2A 2QRHA 4HDCA 2BRUC 3RS3A 4YHBA 1F14A 4OFWA 3GDFA 2QZPA 3IT1A 4AQYB 3QJGA 4CL0A 4DA4A 1KBQA 3Q7PA 1H1TA 4U4AA 4YWJA 3U7QA 2IW3A 3ZIUA 2CCGA 3GUVA 4IMJB 4ISBA 4NE7A 3V8BA 1W96A 3HVRA 2XBMA 2Q3FA 4HVTA 3U6BA 4HX9A 2XCUA 5KWIA 1X1CA 1ISPA 5DIFA 4L4XA 3FCEA 4O02B 2QT0A 4D44A 3BORA 2RHBA 3FZYA 1W8DA 2BE7A 1DO2A 3KG2A 1CZHA 4TMFA 5A3VA 5CGZA 2UYOA 4ID9A 2HSZA 3WWEA 1Z36A 3COVA 3TOCA 1SXQA 2ILTA 1JG2A 1KARA 1L5VA 4XX0B 4DSTA 3CVXA 2CCKA 2JGKA 2A0WA 5TB5A 5K05A 3S2FA 2YWDA 4BPBA 1A04A 2XITA 1YGYA 2OECA 3FIUA 3OH8A 1EH5A 1BWPA 4RSRA 4B83A 1CG6A 5LZ5A 3ZXSA 3SPXA 5BWMA 1V7ZA 1Y8QA 1OFHA 2GD2A 5AIBA 3I0ZA 4LNHA 4M9QA 2JFHA 2E5WA 4V0RA 3T7SA 1RXYA 1A2KC 1XMXA 3BOSA 3QF4A 4IY1A 3M3PA 1SKBA 1Q22A 3QG5A 4GT1A 1W5EA 1E9FA 2QJRA 2TS1A 3DKRA 1WZ2A 4BFVA 1KRXA 3C4QA 2PUTA 4J76A 2WY2D 3JQFA 2FTKE 1O97D 4UAJA 2VBCA 1USIA 1ZGCA 3CF4A 3ZZ1A 1SU8A 1DCKA 1CDDA 3OG9A 1C4KA 1S3GA 2EFCB 3FNEA 4MHOA 4FYHA 1NJ2A 3SWWA 4Y7CA 4QAQA 2ACKA 3JVDA 4N3AA 1GXSA 4GZ6A 4LHXA 4L9WA 3VPCA 4YJGB 5IDWA 1ZMOA 3KQUA 1RIFA 1HLGA 5K4AA 4EP1A 2VUIB 3HSSA 4MA4A 2Q3MA 4DLBA 3ADCA 3LSTA 1T6NA 3O4JA 1MJGM 2FK7A 1OIWA 4MB6A 3MQ4A 3RC2A 1VHQA 4N6NA 1J8FA 4BEBA 3AG5A 4PRKA 3IPAA 4X95A 4N39A 3IR6A 4MAFA 4F38A 4I2VA 2WB2A 1T25A 1TIPA 2JFOA 3NHSA 1UJ2A 4H7KA 1EG7A 1KEEB 1EXWA 4DB4A 4DR7B 1MQSA 2X5NA 3TK1A 4EUNA 3L41A 5D6OA 2V7PA 4B6QA 4DA8A 5GZ1A 4MWCA 4B3IA 5ALYA 3TAUA 3TTVA 2YXEA 4FLEA 4W6ZA 1JKFA 4NBWA 1XMSA 4UBJA 1GTL1 3P8ZA 1Z0FA 5D3ZA 1TM3E 3IKLA 4WNAB 1IWPB 1RLJA 1RWXA 2FPRA 4FFVA 4K2HA 1ZISA 1QYIA 5KTNA 4N9WA 4WTOA 1T4CA 1YRLA 1ZIYA 1D7OA 2PJDA 2RGWA 3GLFE 3A1FA 3N2GA 1SH7A 1RWQA 2OLKA 4EWLA 5EUMA 1FOEB 1WP9A 2FFQA 2NUAA 2Z9CA 3I4FA 3PKJA 4KSYA 4MQBA 5EIBC 2J6CA 5HIIA 2V59A 3LUFA 4BJ5A 5HQ3A 1HWYA 1X1AA 2C2BA 3IAFA 4OI2A 3RGGA 3ZDCA 1TCVA 4O2AF 4D98A 2HSWA 2A5LA 4MKIA 4RHFA 5E4JA 3IPXA 4DZZA 2B7LA 2HU2A 1DBQA 1DJLA 4C7KA 2VWQA 3NVKI 4MRMA 3IV6A 2DWOA 3Q6IA 3PNMA 4NEHB 3SHFA 3AGQA 3LUDA 4HQRA 3AVUA 2X42A 3HVIA 3TO5A 2F8TA 1WDKA 3VBEA 2ZJ6A 1L5FA 1Y7LA 3KTOA 2CFCA 3NC4A 2CYAA 1JW9B 2OC9A 2OOSA 4NQRA 3U3RA 3DH0A 4CMHA 5LQMA 1WXDA 5FL7A 1U7HA 1XBTA 5JMPA 2B5OA 4C2BA 2CK3A 1N3BA 1ZJZA 5HMMA 2CEAA 1CV2A 1GPWB 2F1KA 2WLSA 1MJHA 5K2MA 1L8AA 3CLRC 4HRVA 2VJDA 2X0KA 3PRHA 5CLIA 1Y9JA 1XQ9A 2PRSA 1OWMA 5CJJA 5AO9A 2QMYA 1X86B 3OOHA 2BEJA 1PZEA 1NUPA 3DSRA 4XB1A 3ACDA 1E2NA 1NULA 3JQRA 4II2A 5AM4A 1Y80A 4D4LA 3WNQA 1VYTA 3H04A 1MC1A 3ZIAD 3ADKA 1D1SA 2ZSAA 4XRRA 4YT2A 2NX2A 4AY3A 1ZD8A 1CX9B 4PIVA 8ABPA 4LOIA 1DELA 3NNSA 1GQYA 2CMKA 2E4AA 1UKVY 2N1BA 2GLUA 3G59A 4ENRA 1X7GA 4KKVA 2C29D 3BTUA 4M1WA 4B46A 2XYVA 4BAUA 1CRWG 4CN8A 2HMVA 5G1PA 2NXNA 4J4HA 3JWGA 4HMOA 5HJ2A 2FLWA 4I1PA 3IAM6 5AK4A 2O1SA 5J58A 3ANMA 1TDJA 1KORA 1NNSA 2SCUB 1EDEA 1RXEA 2C1XA 3IBSA 3NHMA 1SCAA 1R6VA 1UDRA 4P9NA 4BX8A 4YQFA 1FUIA 4EVQA 4A2QA 5LP6F 1FVHA 2YFQA 3D5TA 4K1XA 1QIJA 1JDZA 4I9NA 3W8NA 4E4TA 3LCCA 7ABPA 3A2MA 3KFXA 3DOHA 3BQMB 4X6LA 4TZKA 4X1KA 3JXEA 4B31A 2Z3WA 4GI2A 1SBZA 2YMMA 3RIMA 1AGNA 1ZGHA 1NR5A 2E48A 2VHCA 2MJLA 4EUEA 3PCTA 1GZ7A 1L7OA 2F62A 1MJFA 4YUAA 4Q1AA 2B8EA 4LF8B 3JARB 3SEAA 4ZT5A 4U7TB 3E3LA 4CT0A 5C8YF 1RWWA 2B4YA 2ZUWA 3ERCA 1MB0A 1PHPA 1X9GA 5CX1B 4DR6B 2W9XA 3FWYA 2QNRA 3QFFA 1RABA 2C9DA 1K89A 4TXJA 1KVSA 1CIPA 2ATEA 2QE6A 3TFOA 2QR3A 2X0NA 2J45A 1KKMA 1HYBA 3SXUB 1WMDA 3C4JA 4M1OA 1DB3A 3X44A 4F8YA 5TPWA 1O7JA 3WGJA 3T0GA 3MTDA 2BHRA 1XF9A 2WINI 3P2OA 2PPVA 1D09A 4EQ6B 4CG1A 4NBKA 2XYQA 4MPJA 4Q3AA 1QH8A 4BLTA 3GVPA 5BV0A 4X1OA 4R0MA 1SC4A 1LDNA 2CXPA 3QLUC 3VU1A 4BFZA 3I1IA 1UWVA 1IZ7A 2CHGA 4J91A 3DS8A 3EVZA 4DM4A 4RTRA 2WM2A 3P0FA 5IMSA 5FNVF 1KI8A 3OO1A 2WHYA 1KE2A 3GI1A 2HTFA 1YCDA 1YVDA 1H2AS 4BNZA 1F9AA 5B7QA 1DAOA 3B8HA 2F3PA 3KR1A 4JJEA 3DB1A 2P9FA 2C20A 5F2EA 3TTXA 4O4HF 1E18A 2FFJA 2M6SA 2WLTA 3FVWA 4EDHA 3BFVA 3RI3A 2B34A 3U4IA 1HURA 1NXSA 1NSTA 5IANA 4ER6A 3ZDEA 2X4IA 3A6LA 1RLIA 5JCPA 5K3DA 4WDRA 2DSNA 2F3SA 2W6CX 4OGKA 3BB4A 3DG9A 4UVDA 2PUHA 4WXHA 5CFNA 4OGGA 2BSXA 1WQ3A 2H1CA 1ZM7A 2R8YA 2H00A 3F3SA 4Q05A 2IEYA 2QGFA 3M9LA 2QTRA 3H1TA 3OEED 3T38A 2IUEA 4B3CA 5EWMB 5HW0A 3PEEA 3WWPA 5KYYB 2F3TA 1RM0A 5DH9A 2ECPA 3WMFA 3E5RA 4ETNA 4F8JA 2X58A 2XA9A 4OLBA 3GLGB 3LRPA 2MR6A 5F2OA 5JISA 1EESA 5KQMA 2G7MC 4JC8A 4POOA 2QTNA 1T3GA 2ZIVB 1XX6A 3AILA 4JVNA 5B6PA 1HOTA 1FDUA 3CUSA 2O1EA 1VJ5A 2NYRA 2VAXA 2OMKA 4L5JA 2V6GA 3I45A 4MI1A 1GLVA 4K88A 4R05A 4YB8A 1ZJ6A 1FVOA 2AD1A 4KI0A 4ZWNA 3K53A 3TTYA 3ZIDA 4F4JA 4EY8A 4QT4A 1JB1A 2C3OA 3DE0X 3E9QA 1MIOB 1QGZA 2CJFA 3G8BA 1XVVA 3K09A 3L8DA 3S29A 2HQSA 4F2HA 2WUFA 3AHJA 3FBTA 2PJRA 4ND2A 3T35A 1A76A 3EIUA 3GJ8A 3NFRA 3BZWA 3ESRA 4RTNA 2ENWA 3E9EA 5BNIA 1ODSA 2A1IA 3Q3VA 5IC5A 3STTA 4DFDA 5AM2A 4W1SA 4DV1B 1D1TA 5EKXA 1JHQA 1OU4A 2YCBA 2FGKA 3ILHA 3ZX5A 4D57A 3ONFA 2KMLA 3D4NA 1XTTA 3WISA 2PX6A 4GXNA 2LXNA 5B1EA 2J7PA 1PR4A 3H2JA 3O4IA 2V5AA 3L8FA 2O7SA 2Z2KA 2FGJA 2B5WA 4JNCA 4P22A 3BHIA 3KB1A 4MJ7A 4MSUA 1J06A 2RGBA 3OQNA 3I3SR 2LZ0A 1MDFA 3NC0C 4J0EA 3BE5A 3CB2A 4NIMA 3C6ZA 4YPFA 1G3IA 1L5NA 2W6NA 4R2IA 1IIRA 4G8DA 3HDYA 4CKXA 2UZ4A 2ET6A 1TKRA 3L49A 4RHCA 1YZNA 3HYCA 1HMPA 1PJLA 1S2MA 5KYKA 3CINA 1NMYA 1KPGA 3BXPA 2I54A 1PR3A 4L74A 4XX1A 4HNTA 5KWVA 3QVMA 3Q0IA 5L53A 4TWBA 4OP2A 3F6SA 2FN4A 4LJ6A 4PVDA 2P4SA 3GPDG 2Q4TA 3HWRA 4REMA 4UQPA 3R7BA 2R8BA 3EAGA 5HR5A 1IDN1 1W29A 3G7NA 1TM4E 1V8PA 1ZUD1 2OV4A 3CVUA 3OKPA 2VVTA 5AM3A 2XIQA 1DFGA 2FMKA 4KV9A 3H84A 3RYHB 3KHKA 5T41A 4N41A 1PVOA 4G5GA 1QHSA 3AR3A 3VPGA 4HNSA 1S7CA 4BN4A 3IEVA 3CLUC 5BRAA 1BFDA 1MENA 1O6FA 1U11A 1XZMA 2FSUA 2QVXX 2FOLA</