4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
4YMUA 4IDQA 3OAAA 3NBFA 4HLUC 1SVWA 3FDIA 1MJCA 3D31A 3QPVA 1SRUA 4JS0A 5LD2B 2J0SA 3QENA 3LXRA 5FTNA 5CJ2A 3CRKC 2WWHA 1IOZA 2A6HD 3W1BA 2XJ9A 1DELA 1KSJA 1CR4A 2OXCA 3P4XA 4X64Q 4KITB 2AWOA 3W6PA 4PO1A 3PO3H 3NBZC 4TYYA 3S1AB 3I4LA 1GKHA 1D9XA 2OG2A 4EPYA 1VQ8A 1T3LA 2MSCB 2J46A 2JQOA 2B8WA 3IQXA 2NO9A 2FWRA 5DLQC 4R4OA 3JAMi 4GS3A 3K53A 1E2WA 4Q5IA 3HOYH 2EVWX 5FBVB 5E7NA 3KF6B 4HAVA 4ASUA 3A1VA 4B75A 5AUPB 2YWEA 4LJ9A 3HGBA 4M2LA 3S24A 4Y7NH 1NKSA 1IN5A 2JEAI 4UP8A 1CKNA 2ZJ2A 2YKGA 4EQ6A 4DR5L 5AJ3Q 1N9WA 1K8AC 3AVYA 4RVCA 4R7ZA 5FOVA 2K5NA 5DHFA 1I4LD 3KQKA 2A68C 2QE7D 5AK0A 1KAGA 2NN6G 6Q21A 5EZ6B 2OQKA 1BKBA 4IFDH 2NZHA 1S4QA 3FHTA 1RYFA 1WP9A 4NCIA 1E0SA 4JL5A 2VF8A 2ZI6A 3I4MH 5F9FA 5FJ8H 3G71A 2XOKD 3VAAA 4QGGA 4A4IA 1NL3A 4ZDJA 4CEHA 2V3CC 4GOPC 3J7A5 3IHLA 2I5MX 2GETA 3S17H 2YC2C 2ZRFA 2YTYA 3L8YA 3U58A 1JAHA 3HKZE 3E5HA 1OJLA 3CC2A 4KBFA 1L4YA 3SBDA 3EIHA 3CCEA 2A30A 3A1UA 5SZJA 2NGRA 4GKKL 4IVQA 4NCNA 4L5TA 3RN2A 1KI6A 1DAGA 1K0RA 1F2TB 3NDBB 3W6NA 2CWPA 3NWJA 3U4ZA 3WY9A 5LBIA 1SXJA 1TWCH 3RVBA 2DR3A 4BA2I 1K6MA 2ZTDA 3QEJA 2P6NA 3QQ5A 4NZYA 4W5HA 1KYIA 1SVIA 3OIVA 3ZIAA 2CL6X 1PH6A 2E2IH 1EOVA 1HT2E 3CF5A 4BLRA 3U6KA 2WMNB 2IYQA 4Z1MD 2QAJA 4MRNA 4DV2L 1Y8OB 4HAZA 2MFIA 2IYYA 2E87A 4BA1I 2PZEA 1WOCA 4LV6A 3K70C 1ZUNB 2FDCA 2WKQA 1W47A 3W34A 3L7ZC 3T12A 1N5LA 1VYUA 3PEUA 5TV2A 1G7TA 2ZRLA 2FGKA 3GTMH 4V0OA 4DUGA 1W36B 1M1KC 2FH5B 4J0QA 5D3MA 5FOWA 2IT1A 1HA3A 1QUQB 2W0SA 1JJCB 3HOZG 4BXXH 1IJFA 2OAQ1 3GMTA 2BH2A 5H1SE 4P31A 2ZYTX 3K09A 4BBSG 3HU3A 5C46F 5JEAH 1G3MA 3LWUA 2CDNA 4TYQA 4M9XA 5TB5A 2AWNA 4DAMA 2KCMA 4JCVE 1XNQL 1XZQA 2I1VB 5K36H 1VQMA 1FNMA 3PCOB 1ZAKA 3LQRA 4GOJA 4IVPA 5FH9A 5JI2E 3U44B 2BHRA 2IL1A 2PT7A 2OBNA 2QT0A 3JC66 4MGIR 4P72A 1T8UA 2J41A 3B9PA 1QVRA 1TL7C 1UKEA 3RS5A 4M53A 1XEWY 2PJZA 4PTLA 5JECA 2Q9AA 3I55A 3HPQA 3CW2A 5AR1A 1EQQA 3DHWC 4DLYA 2JASA 3SI7A 3I56A 1VG8A 3NH6A 4F7WA 4U02A 1XP8A 4G5GA 1R5NA 3UE0A 5J4LA 3T1YL 4CEIB 2RHDA 3OW7A 4JYCA 4TL9A 3B1XA 2ID0A 2KSQA 1VMAA 1T5IA 3I4NH 2V8OA 4DK0A 4DKXA 2ES2A 1XMQQ 1HNXQ 2GF9A 3EWSA 3LX5A 3CRRA 3BXZA 4QHTA 2QQ0A 5G3ZA 4P4SA 2O5VA 2WJIA 3EX7C 3GO5A 3PENA 2GF0A 4M1YA 3CX7A 4C0LA 2NO1A 1VTKA 2R92G 3EIEA 1NY5A 3OYYA 5EXSA 4DLZA 3U6BA 1PYBA 3P1JA 1LF5A 5C4MA 3PEYA 4DV0Q 4C3JH 3SBEA 2FFQA 5EJEA 4DDWA 2C04A 1YNXA 1NY6A 3Q72A 3SQXA 5C2JB 3AUXA 4DR6L 1N3BA 3B2EA 1GP2A 2G0TA 2VLIA 1D8TA 2UUBQ 3X1YA 1PH9A 4QM6A 4X62L 1GRNA 3PXGA 1KOFA 2HCJB 4N3NA 1X3FA 2ZRIA 4I1OA 3I61A 2D62A 1Q82C 3PO3G 2I0QA 1H8ED 1UADA 1YHNA 2J87A 1TU2B 1Y69U 4M0LA 4NKRA 2F1HA 2XEXA 3MWKA 2GVZC 4QNMA 5JI3E 1S3GA 1DTSA 1VF7A 1I4TD 2KCCA 2GZAA 2IUSA 3S1RH 1W4BA 3VX3A 2BV3A 2B7CA 4URUR 4PHFA 3WYFA 2CL7X 1KY3A 2I4IA 4W9MC 2NO6A 5FTLA 1YIJA 3CRMA 3BOSA 3W5JA 3OPOA 2VUMG 4JYAQ 3GLFB 1BDOA 1PV4A 1W0KD 2J0UA 4OJKA 1QVGA 3HOUH 4I1VA 4DR1L 1NIJA 2VYFA 4WW0A 2IHBA 3QG1A 4CEJB 1H9MA 4OI4A 3WP1B 1XJVA 5CLQA 1R4AA 2J7KA 5FPYA 4C0AC 4EJSC 4ZDKA 2CHQA 4Q1FA 3WNDA 4KVGA 2F6RA 4DVGA 5K8TA 1G20E 2CFMA 1U9IC 1G3UA 1WI5A 1YHQA 4Q21A 3W8NA 1KNXA 4NONA 4AG5A 3KJPA 3I8SA 3AVWA 2J0VA 1OT3A 1WA5A 2MMGA 3U4QA 4XD7D 1F5NA 1XNQQ 2AHOA 3IFTA 1BYIA 3CMAA 2XAUA 1U8YA 1DAMA 3KFVA 2ZRGA 3LH5A 3PUWA 4A3GG 2UUAL 3ULPA 2ZR9A 4X65Q 4C2MH 1NMXA 2X8AA 4PPGA 4E22A 1TWHH 2CCZA 4NXML 2OQ0A 4TQAA 2ZE6A 1T3HA 3UK6A 3THWA 4M21A 4C0KA 2IYTA 4B3TQ 4PG3A 4DV4L 3FHWA 3LW8A 4QC2A 2V1UA 3EC1A 1NLFA 4H44C 1NN3A 4GZLA 4NPSA 3IIJA 4GFDA 2XZLA 4UNSA 1DE0A 4DV5Q 3GTGH 1Q1ZA 3K9NA 2AD5A 1P62B 2A3RA 2A5FA 4NH0A 4DR5Q 1KDPA 2WOJA 4ZCIA 1N33Q 4HI0E 3W8RA 1RPZA 4MYTA 2GXUA 1QVFA 4V0ME 1Q1BA 5FOTA 3BU2A 2B3GA 3ULJA 4OQNA 1ZIOA 3WBJA 2VL7A 3KFXA 3V9PA 4YHHL 2UUCQ 2VSOA 2H92A 1K3RA 2OBLA 4ACBA 1FGUA 2HUPA 1XJCA 4OGQC 2WWFA 3QG5A 4NYJR 3ZH9B 3TGPA 4JI8Q 4FWIB 1E2LA 2XZPA 2ZU0C 2ZREA 3A8IE 4MGKR 1VYTA 5D3MB 2I5LX 5DN6A 4Q4LA 5K8LA 1IONA 4IPDA 2NZJA 2QAGA 1DAIA 2BKEA 3OFND 1GZSA 3D8BA 4W5WA 5FBQB 4ASUD 1QHGA 3FFAA 1PH5A 1FUKA 1LVGA 3LX8A 4BBSH 1CU1A 4G1UC 4NBSA 4YY3Q 4DV6L 1JQJC 4LDJA 3LW7A 2ZSAA 1WCV1 1I3QH 5LMNQ 2K32A 3QF7A 1OF1A 1A6XA 2AMCB 1QG4A 1XCPA 3B1ZA 4KVAA 1XCGB 3U60B 2VRWA 4OO1H 3J80c 4TWZA 2ODBA 2GJ9A 5M5YH 1I2DA 1K5GA 1E1RA 3U7HB 1KK0A 2IBMA 4JJZA 3J81j 1HNZQ 2AXPA 2PCLA 4RCNA 1Z6XA 2QTHA 2VP2A 1Z06A 2NO7A 3M4QA 1YE8A 5E7MA 3TW4A 3R9WA 1IHUA 2OCAA 4I81A 4A3BG 1TX4B 2VHQA 4O2LA 4UJ3A 3ND9A 4BY1G 1TF2A 3O8BA 5CYPA 1GKIA 3E2IA 1V1QA 1Z2AA 3W3AA 1P2UA 4MKGA 2WOOA 4D81A 4JI1L 1YQTA 2OO7A 4KV9A 1N33L 1QVAA 2BDTA 2WTUA 1T5LA 2CL0X 1IL2A 1E96A 1KJZA 3EW9A 4CEHB 4MRSA 2QL6A 1GUNA 1MKYA 5F9HA 3MMPA 3K0XA 4YCWA 3KKQA 4G5OA 1CULC 4HAWA 4A0GA 4AIMA 1M7HA 4ERNA 4JI4Q 1FFHA 4QGFA 1F2UA 2XNSA 1UM8A 2CVFA 4NCJA 4TLCA 1NMFA 1Y14B 1ZCBA 4NCHA 4AYTA 3KKMA 2V55B 4MUAA 4F38A 5F3WB 2EJFC 1N0VC 4O2DA 2AN9A 1G16A 4ZO4A 1N32Q 2IF2A 5CB8A 4O0AA 1F3OA 4NYJQ 4A3EG 2WAYA 1OV4A 1P9WA 2ATXA 2JA8G 2JDID 5FPSA 1EIYB 1SXJD 4TL7A 2IUTA 3UG6A 2K52A 4Q00A 1YJ5A 2FF7A 4Q01A 4C2TA 1LACA 3OESA 3PO2H 4DNTB 3IIKA 1GITA 5DI3A 2JDIA 3HKSA 4GT1A 1F60A 5A0FA 3TVTA 1TADA 4C7OB 1YBYA 2BBTA 4POFA 1ZU5A 5TXGA 4DLUA 4FMBB 1XMQL 2ZRBA 5JJKA 2D2FA 2ONJA 3GCGA 1E7ZA 2CXXA 2BE5C 1VQGA 2IWRA 4A8JA 5ELOA 4N1AA 1L8QA 4G7ZC 1B23P 1W0KA 1N6OA 3GLFA 4QIWE 4L5BA 4YMWA 5KDLA 1DPFA 1G41A 2CJWA 4Q47A 2YJTD 2JATA 4LBVA 2QQEA 2DYKA 2HJGA 4QBIA 4P75A 3CNOA 4GOXA 4Q9LA 1NG9A 5K36G 2CHGA 2DFTA 1X3GA 1HZAA 1ZBDA 1UFQA 2BM1A 2NTYC 2Y8EA 3BC1A 4BRUA 2PJRA 3VNVA 1D8LA 2DN8A 3MWYW 3FPAA 1N6PA 4OQFA 4LOAA 1BIFA 3CF2A 1AKYA 3NEMA 2UXBL 4HB2A 4W5JA 5HE8A 2ZI3A 3THXB 2LKCA 3AM1A 3PF4A 3K8YA 2FN4A 4A3FG 4Q1CA 3REGA 2CBZA 1JBKA 5JHHB 4A3JH 2JJ2D 3Q8DA 2F9MA 4LHYA 4OWWB 4QBGB 4GNXC 1G291 1HR0L 1UDWA 2ZS7A 1Z6YA 3K9GA 5DE3A 1X8KA 2JJ1D 4YXWD 2ORIA 2PLFA 1COWD 1AA9A 2PX0A 3SU8A 1Z83A 4TKOB 2ERXA 4CT4B 2V6IA 1PH1A 3ZVMA 3OTOQ 2PZFA 1KDRA 2XSZA 2VP5A 5BYKA 1G51A 4A76A 3ULLA 3A4MA 4YONB 2NO0A 2CK3D 5AJ3L 1M1YE 2J45A 3W1GA 3C5HA 1B9MA 4OONA 2ZU6A 4CZ2A 1FL9A 3CWZA 2GXQA 2KHIA 3UMSA 1H9JA 1V8QA 3DDCA 4V0NA 3OZXA 5GADC 2NZOA 1RW4A 3MEFA 3KZ1E 4URWR 3IQWA 2A8VA 3GLIE 4DNIA 1P5ZB 3CF0A 4D0GA 1YU9A 1KRSA 1JJVA 2IXEA 1DS6A 3RSOA 1MRSA 4WZAE 4Y52H 2C03A 3KF8B 2FGJA 4DIEA 1YR9A 2WV9A 2ZRJA 1N5JA 3MGCA 5B57C 2XTZA 3KTAB 2A2ZA 4LFCQ 1IW7C 1VQOA 2A9KA 1OFTA 2MMCA 2ZRPA 1K5DA 3M0EA 3NENA 3DM3A 1O3YA 4KFTA 3OIUA 4D2IA 1X3SA 1I50H 4O2RA 4OWTB 2Z4RA 2VP4A 4AI6A 1N5KA 5JJIA 1NJFA 1HYQA 4B3DA 1NG1A 4POAA 5SZIA 3NIBA 2QUZA 2XNDD 1XEWX 1XTRA 5EE9A 1UBFA 4Q03A 4C0BA 4JT4A 1EK0A 4Q4HA 3DXJC 2NVYH 4B3SQ 1P2TA 2QRNA 3K9LA 4QNRA 1KSGA 3X2SA 4UXHA 1XD8A 3J81c 2PL3A 4HLCA 4DCVA 3BFVA 2RGNA 4DV7Q 1KTVA 4FCTA 2KE5A 4EPVA 4B3MQ 1J99A 4GNXA 5FBRB 3TREA 4KYIB 4DV4Q 1R0WA 3AB3A 2DNCA 3DKPA 1SMYC 4LV5B 4JI7Q 2YC4C 1E2QA 1NY4A 3M3YH 1FZQA 3DEFA 4GOPB 1VIAA 3DM9B 4A6PA 1KKMA 2CNWD 3ZDQA 4YY3L 4DV6Q 1GG2A 4X8OA 2A6EC 4GOPA 4LF7L 1G6HA 2UXCQ 1TU4A 2VBCA 3RANA 3UXMA 4LY6A 1E94E 3GFPA 1W5TA 5J5CA 3CZQA 3ZD7A 2NVQH 1TEXA 1LY1A 1S3OA 2W2XA 1FMJA 4Q4AB 1AKEA 1CSPA 2ZYWX 2WB1E 4FDBA 3FMFA 1K8GA 3PCRB 1XMVA 2RGAA 2F1RA 2QROA 1YHBA 1IBML 3E9IA 3TW8B 3WMEA 4B44A 4D4MA 1D2MA 3NEYA 2AUJD 4P33A 2GZHA 2Z83A 3AKDA 5CDFE 1OH6A 5GJCA 4KFRA 3DOFA 1MO4A 2VHJA 2IS1A 5FOSA 3ASZA 1KD1C 5EZ5A 3HOVH 3B1WA 4C2UA 1YVCA 2W2VA 5DLQE 2FZ4A 4JI1Q 2P67A 2ZJ5A 2XX3A 3F2BA 1U0JA 4GRAA 2CLSA 3DLLA 2PPBC 1E2ZA 1HJPA 1LTQA 4Q18A 3OHMA 1S0UA 2FV8A 2VNUD 1AS3A 1VF5C 3KUCA 5GROA 1A1VA 3TQCA 2PQAB 1W1WA 4PSVA 4HJ7A 4PZYA 2ZM6Q 1S72A 4X65L 1T9HA 5C44G 2JLSA 4XVQA 5FR2A 4BASA 2A69D 1S9HA 2JA9A 2HIVA 1HURA 1KHTA 4A3LG 1XPOA 2BMDA 2ATWA 4MYCA 5FUXA 3VQTA 3ONWA 4HLDA 2ZR7A 3L0IB 4XSGA 1YZLA 1GUOA 4A93G 1KI4A 3EPHA 3EA0A 2C99A 4A8JC 4V0MA 3U7EB 1J8YF 4WVFA 5JWHA 5LPNA 2MSEB 2KA7A 2HXSA 2ORVA 5JEDA 1NBME 1XXHA 4LF9L 4HB3A 3WP0A 3HYTA 1BMFD 1A63A 1DO0A 1VYVA 5DI9A 2WWXA 4OBEA 3KL4A 2BMEA 3FTQA 4JT2A 3PFIA 2WWYA 3G82C 2GJSA 1L1OA 4JI8L 1O87A 3TVDA 1EXMA 2JLYA 4FMDB 1Z0IA 4KMUC 2K5HA 2QENA 3HR8A 3ECCA 4JKYA 2O0JA 4UNNA 4JI2Q 2H17A 1AH9A 1G6OA 2BCJQ 2XTIA 2AKYA 1IXZA 2JA5G 2EFHB 2G77B 3GJXC 4R4CA 4I7ZC 4I1SA 2UUBL 2OEPA 4JZKA 1Q57A 1TF5A 2WHXA 2QPAA 4NU0A 1DVRA 2K75A 2ZITA 1LV7A 2GK6A 1D7QA 4ILEA 5E4FA 1ETUA 3U5ZB 2JIZD 2CJWB 1FJGL 4KBGA 4EPTA 1G5PA 1LB1B 1GL7A 3WRYC 3TJZA 1Z0FA 2YWHA 1H9KA 4OO1I 2PLRA 1SVMA 5IP9H 2VEDA 3Q7QA 2C9OA 1UEBA 4Q1AA 4YWKA 2JIZA 1J70A 3J81k 2UXDQ 5BYJA 5GAGC 4JG2A 2ZT9C 3SDZA 4TMTA 5CITA 3MXUA 1WQ1R 4DLRA 4Z54A 5J4YA 1L1OB 3EARA 4P32A 5TARA 1E6CA 1HZCA 4RFSA 2RHQB 4B2IA 2ZI9A 1OXUA 4RD0A 4DBLC 1C4OA 1XB2A 1UE6A 3ZYCA 1US8B 3K70B 3UDFA 1JXOA 5C4JH 4QHYA 5G53C 3CZPA 1HEIA 1VQAA 3FKSA 3RAPR 1L0WA 3FE2A 1VQBA 4D4JA 3TIFA 4FMDF 1CTMA 1XMIA 4RJLA 2LSSA 4IJHA 4L8GA 4O25A 2R93G 1P72A 1Q12A 3S1QH 2YWFA 5KSPA 1PUIA 2OTJA 4A6XA 2OAP1 2VP6A 3L0PA 4DLTA 3PIPA 2K7VA 1YZGA 1NKTA 3AB9A 2Q21A 1WMSA 3B5JA 4DT1B 1U2RA 1J8MF 4PHHA 1CKEA 4EAQA 2ZRCA 3D0FA 4JOIC 2GXSA 3KB1A 4LV8B 4JBMA 2Q3FA 1S2MA 2ZR0A 3AP3A 3QBVA 1W2GA 5HZHA 5B2ZA 4RD1A 2YOHA 2IS4A 1OIXA 3QKSA 2ZTEA 1KO7A 4LK2A 4WBSA 2QN6A 2R44A 4AKIA 1GL9B 4DKAC 3AVVA 1BMFA 2D5DA 1NF3A 4OHXA 1ZUHA 4AK9A 2NVXH 1XDBA 3CKLA 4RFSB 2F3IA 1Z5ZA 4M22A 5ANRB 3TBKA 4QGUA 2EYQA 4KYUA 3WRXC 2JLUA 3IPXA 5C3EG 4AKEA 4YHHQ 2UUCL 2IHYA 2W58A 1XXHE 3HU1A 3UKDA 3E0EA 4OK3A 4UXIA 4TQ9A 4BZQA 5LMNW 2R92H 2ZETA 3VKGA 1PH8A 2YOFA 4KHZA 4LF5Q 1L7VC 1E2HA 4MKHA 5HZKA 1IN4A 4YMSA 3A74A 1X8LA 4ARZB 2RCNA 1NVXQ 3KQHA 2ZM6L 1VIYA 2WM9B 2WWIA 3BAFA 3BWDD 3CX6A 2GCNA 4WAUA 5FTJA 3A8TA 3BGWA 3CD6A 1B70B 3H3VH 3LDAA 4BBRH 1TXYA 1OYWA 3BK7A 3LBNA 2K5UA 1FP6A 4AD8A 3F2CA 3K0AA 2QZ4A 4PO8A 3L8ZA 5C4GB 2LKDA 4TMZA 4CW7A 1N6KA 4LYHA 3T1VA 2QNRA 1SE8A 4LBWA 1JJGA 1NRJB 4JLVA 3BS4A 5IYBH 3CRQA 3UMRA 4PAOA 1S3SA 1VKJA 3WHKA 1KXLA 3ZJYA 1FX0A 4B3CA 1FVIA 3O8CA 4G5SA 1JQLB 4NB3A 3BH6A 2GJ8A 3JZAA 5CIWA 4BUJA 5AUQA 4F93B 2ZROA 4RY2A 1FTNA 1ZP6A 2QGNA 3NHBA 2RGGA 4OQLA 4PZ6A 2BC9A 4P71A 4RD6A 2Z5FA 1XWIA 1R5OA 1Q90A 3CCJA 2QEQA 1D6JA 2MSDB 2IF0A 4S2EA 3TLXA 1FMLA 1KSHA 4Q7KA 5IDVA 4TMWA 2WIBA 3BD9A 3GJ7A 3T35A 1Y1WH 2WJYA 1AM4D 4UPAA 1VQLA 1E2DA 1TQDA 2FE4A 4BLOA 2ZRHA 2JLWA 5IHPA 3RR5A 4OL0A 4B2PA 3N2EA 1Q81C 2WJJA 4TL8A 4ZKDA 4QKQA 1K8RA 2O8EA 3VA7A 1QZHA 1CKOA 1N5IA 3K0FA 3CBQA 1Q8KA 1MKHA 1VCNA 2DWOA 4PXAA 3Q8XB 3TKLA 2P5SA 2WJVA 4XJXA 3U3KA 1Y1VH 4A3EH 3QKSB 1RJ9B 3S2DH 1DGSA 3C41J 5G40A 4DK6C 3GLIB 1WBDA 3LBHA 4PX9A 4IOKA 2QT1A 4JBYA 4TZ0A 1H8HA 2B29A 2N1BA 4L5SA 1HQYE 2JA5H 1VQCA 1KI8A 1OFUX 2A5GA 4HZUA 1Z6HA 4G01B 4KN7C 1QVCA 2OBMA 2O8DA 1C0AA 3ZIAD 3KB2A 4AURA 1G17A 1U0LA 2QI9C 1MO6A 1HH4A 2Z43A 3F2DA 4DR7Q 5L3QB 1G8YA 2ODNA 1OXSC 3EXAA 4JBXA 4MNOA 4PC6A 3H0GH 4DPGA 4U00A 4NTZA 3A8JE 1EWHA 3CPFA 5KDDA 4KKSA 5AJYA 2K5VA 2VUMH 3SHFA 4CF7A 2P6RA 2QGQA 2R7ZG 3EBEA 1XPRA 1IXSB 4B2LA 4QFMA 3KYHC 1EWRA 2GEDA 4M9ZA 3SR0A 1E24A 5JCPA 3CC7A 5JEAG 4UY8C 2FG5A 3S1NH 2WZQA 3NELA 2EDGA 1CR0A 2ZE8A 2J0UB 3TEHB 2EWWA 4DUZL 1NSTA 3KXLA 5BN4A 1E1OA 2E2HH 1GL6A 2WJGA 4NPHA 4RZXA 1NLYA 3U3OA 4KN4C 4ZI2A 3A1TA 3I5XA 1NMYA 3M6AA 4IPCA 4DEXA 1OH5A 221PA 3NBYC 3KOJA 2RB4A 4EFNA 1CS4C 3O8DA 3K0CA 1RIFA 1KAOA 1IJEA 2UXCL 5J40A 2GTPA 1G3QA 4DCUA 1SKQA 1P73A 4GNXB 2OHFA 2RGDA 1JPJA 1ZD1A 2JA6H 4JVLA 2FOLA 3BORA 3MJHA 4OYHA 4H02A 4A3LH 3V4RA 3K8AA 4LK1C 4UJ5A 3EZ7A 3CPHA 2PNRC 1CBUA 3HDTA 2XITA 4HLUA 1HR0Q 2YNMA 4C9BA 4LF8Q 4OQMA 2Z6KA 1QHNA 1VS0A 3L82B 4ZIRB 3MG9A 4M8NE 1JB7A 4YXWA 1UBEA 2ZJZA 3AF3A 2IHEA 2VL6A 3W5OA 4JLMA 4JSTA 1U81A 4KAXA 2J7PA 2ZS9A 4PAMA 4Q9HA 3IBYA 4LZZA 1DAFA 3M1IA 1G8FA 1E9RA 2F9LA 4HR7B 2X2EA 3HWSA 4XWOA 4DCTA 4HIDA 2ZE7A 3AFQA 2RGCA 2FX3A 3TSWA 1OPXA 1XTIA 1EFWA 1JB1A 2IEYA 2R6AA 4U5XA 4AQYL 2YU9H 5BW8A 3OF5A 3PIRA 4LUVA 2F52A 4TYNA 4LFCL 3SJAA 3CCRA 2ZJRA 2W6IA 2R6GA 4LHXA 3U3MA 3DL0A 3RC8A 3QI2A 4RZ3A 1Y8NB 2GAAA 1HNWL 3GLIA 4ALPA 2BEKA 4JK1C 4IPGA 4QJ5A 4KKUA 1MT0A 3VX4A 4C0JA 3BG3A 4E09A 1R2QA 2BM0A 4IJLA 3PIOA 4BZPA 4EFMA 3TAUA 3C5CA 5LB4A 1JMCA 1E0KA 5EE0A 2K4KA 5IYBG 5EXTA 2OILA 2NPIA 1XD9A 1G7SA 3SJZA 1HTWA 4KKTA 4BY1H 4V03A 4Q9JA 5EAYA 4OX9L 2FJUA 5FPKA 2V6JA 1IBKQ 3RRMA 4AWXA 3LBIA 4QBFA 1G9XA 2OM2A 2OCEA 1XFAA 4UP7A 2QSZA 2VQFL 1OFHA 1G1MA 1VQHA 4W7SA 3AGPA 4F4CA 3N70A 2QMHA 1NN1A 1K83H 5P21A 3D4RA 3ZZUA 4UQOA 1BS1A 4AYWA 1T91A 3KDFB 2GKSA 4UNRA 1G4AE 1CEEA 3MXNB 1CRPA 2AFHE 3GJ8A 1ZVQA 4A75A 4ZCMA 2CKZB 1NE3A 4YWMA 2Q2UA 2UUAQ 1F6BA 1Q22A 4DSUA 3KKPA 3PUXA 1E2MA 2FSFA 3GLHE 3I8XA 3DZDA 4JL6A 1BYUA 4JI4L 2BBOA 3IBGA 2OWOA 5DYGA 2CQOA 2JEBI 4IFDJ 1YRBA 1KI6B 4KLZA 1E0AA 1P8LA 3HPRA 1LTLA 3EZ2A 1KO4A 3HFZB 2A5JA 3FKQA 1Y1VG 1COWA 1E79A 2BCGY 1U0HC 1RIPA 4HIKA 4A3JG 3VU9A 4LPSA 3EZFA 2OTLA 2DCUA 2REOA 1MO3A 2HCBA 1PMRA 3L0OA 3OEEA 3I72A 3NC0C 4X6AH 4QJFA 2YWGA 2R7FA 1QZXA 1EWIA 4TVAB 4FMCF 4PFSA 2FXQA 4GSYA 3TUZC 5HE9A 1M90C 3QJYA 4DSTA 2CEAA 2MQHA 3FMIA 2GESA 4IFEA 4Q19A 4Q4HB 4KLNA 1NBWA 3ZJYC 4C3IH 4PV1C 3VDYA 1F48A 1H8EA 2VA8A 1AZTA 2C77A 3H0GG 2NQ2C 4IHQA 4US0R 4R2HA 5DGXA 1Z0AA 3TAHA 3UATA 4BFZA 4JV5Q 2X19A 3WNBA 4ZV4A 2P65A 4EDHA 5EP2A 1XMOQ 4KI0A 2ZTCA 1E0JA 2QP3A 2VHTA 4NHOA 2QMEA 5CJPA 3QSYA 4AYXA 2HDNB 3OFNA 5GAEC 5KSOA 1Z8FA 3HOWG 1EFTA 3KF6A 3VTKA 3M9BA 2G1JA 3M7NA 1X56A 4APVA 2EVBA 1E2FA 1NJGA 4D26A 5IYDH 4D0NA 3EZ6A 4LUCA 4I4LA 4LSGA 121PA 2GVDC 3LWNA 5M04A 4BPBA 1BH2A 1IM2A 2XNDA 4EFLA 3IKJA 4JLKA 1GVPA 1ZKOA 1GVNB 1Z0KA 2C9CA 3ZS8A 4CT5A 3THWB 1AGPA 1OH7A 2NN6H 2OCYC 1SQ5A 1KNQA 1SULA 2W6JD 4MUBA 5EP4A 4A0FA 3RHFA 8OHMA 4IOCA 3CF6R 4A3BH 1UBCA 4YCUA 3EIQA 3I4MG 2WVJA 1AE2A 4QJ4A 1UKZA 3UDXA 1J5EQ 4GBMA 2KCTA 3S1AA 2F4VL 5GQOA 4B3RQ 1W0JD 4DHEA 5M5XH 2Z0MA 2KJQA 4UXJA 2F3TA 1YITA 5BQ5A 4LFBL 3KKNA 4MKFA 3GLFE 3B13B 2JLZA 2YZ2A 1E2PA 4JLJA 2IS6A 1CKMA 1ZM7A 1E32A 5JRJA 1CXZA 1R10A 1OXXK 3SN6A 1NVVQ 3GD7A 4OI2A 1I4DD 1TEVA 4DLSA 2CCGA 4AH6A 2EYUA 4L9WA 4LHVA 2R6FA 5FBWB 5KNDA 2XJ4A 3ADDA 3SZRA 3T56B 3A8KE 3KJOA 2Z4SA 1VDZA 4KFSA 4EJSB 3A6PC 4NXNQ 1EFRA 2VW9A 3R9XA 2B8GA 1PA6A 3NE5B 1ELOA 2P5TB 1R8QA 4QY7A 4K46A 2ZQ5A 5FTMA 4DXAA 4LWZA 1PLLA 3J81i 1HE1C 4F4JA 1ANKA 4IXNA 1UKYA 4M9QA 5FPHA 3GLGE 1KIXA 3EPLA 1OB2A 3A36A 1ZM2A 5H70A 4H0LC 2QAGB 4OX9Q 3ZQ6A 5L3SA 1Z63A 4OK5A 4HDOB 2GJAA 1HY3A 4C0SA 2WFWA 1JR3A 4GNKA 2PNHA 1HNXL 4JLOA 1QG2A 4M9SA 5J47A 2PT5A 2E75C 2YV5A 2VO1A 3E1SA 1DARA 4TLDA 5UKDA 2QA5A 1TPZA 3LXXA 2ATVA 4M1MA 2IYUA 4DUGD 1IBLQ 4LF6L 2GWHA 2WSSA 4HYYA 3V4FA 2O52A 1FR3A 3ICEA 4DR4Q 5JCZA 3RN5A 1XXHB 1L2TA 1LS1A 1PZNA 2WB1G 1KGDA 1R5BA 1ZM3A 4CYMA 4PQFA 3I3SR 4AY2A 3RRZA 3TS0A 1C9KA 4B3GA 1A4RA 4AYBE 4KCGA 3ZVNA 2QRZA 3FB4A 1KI2A 5EE1A 2Q3MA 1PLJA 5E7JA 2O8BB 5HY6A 3AF4A 2ZYUX 3CO5A 1Z07A 3R7WA 1H9SA 1CJKC 4YMVA 1W46A 3SYNA 1GUGA 3AUYA 1WDTA 3LAWA 3NVAA 4KXFB 3W5IA 1NVVR 3IIMA 2N3SA 3AEVA 2E2JH 2C78A 4LWCA 4A93H 2F1JA 4M1KA 4DV2Q 1R7RA 3IEUA 1SGWA 1ZW6A 4EX5A 1VQ6A 1BO6A 4QL5A 1O7IA 1H65A 1KO8A 1N0WA 2BOVA 2CCJA 3IPYA 2EFEB 3KQUA 4CEJA 2B8TA 3CAMA 1F2UB 1QHHB 1TWGH 5C3EH 2DPXA 2AFIE 2OSBA 4A3KH 3I4OA 4MZ9A 2Z6KC 2JA7H 2FPLA 3KLRA 5TY0A 4B3FX 4A3MG 1AK2A 3K7AH 2E74C 1TWAH 3SE0A 4QL3A 2C96A 4A36A 3THYB 4AYBG 4ZIRA 3HOVG 1H8HD 2W2TA 3B1VA 4M1WA 3U7GA 3RS2A 4EPRA 2Z0SA 3UANA 4FWTA 1E2JA 1OIVA 3JVVA 1VQIA 1QRAA 2J59A 1S8FA 4G5RA 4PPNA 1SVLA 1WRBA 2NPFA 3GTPH 3CMEA 1PUJA 1WFQA 4YWLA 2FFBA 3N2IA 3T1TA 1R9TH 1G6PA 1E9BA 3AKYA 1XTKA 4LC1A 1GSIA 2Y0SG 1VHTA 1E3PA 3F0TA 2TMKA 2K14A 1X8JA 5GVSA 2REBA 4K0KL 3Q85A 4UKDA 3A7AB 4GKJL 1ESMA 1XF9A 3AF2A 1NVUQ 1IBRA 3VR4A 2ANCA 3CRLC 2W83A 1N0UA 3NXSA 3R20A 4GZYC 2ZVQX 1P9RA 1L2FA 1M8PA 1XD2A 3CM0A 2KBNA 2AD1A 4FMCB 3FMCA 4LW1A 3HYRA 4EUNA 3K0SA 3VR3A 3FKIH 1G8GA 3ADBA 3CCLA 2RHMA 3MD0A 4V0LA 3CCMA 3D6TB 4PC3A 1OXVA 4PZLA 5C0XG 4BFVA 2CE7A 4FCWA 5EE5B 5L3VA 2BEJA 1LNZA 3C16C 2E9SA 4TTPA 5JEAJ 1K9MC 4RD2A 4TLEA 2E76C 1Q20A 3AF1A 2O8DB 2H1LA 2P2LA 3RLOA 1XNJA 2QG6A 4TLAA 2ZSEA 2KI5A 4LX0A 5DI3B 4DWJA 3ND8A 3TQFA 3O8RA 3PUYA 4CEIA 1VCIA 1CR2A 5C18A 4QXAA 5IYCG 4H9GA 1ZC3A 2HT6A 1ZMXA 4YDSA 4R4QA 1U99A 4GLXA 3KX2A 1FNNA 3UWKA 3AVUA 2GCPA 2ZRMA 4Y0AA 3AF0A 3GLHA 4DB2A 4DK1A 4GN4B 3CNNA 4AQYQ 2JEOA 2OFOA 2RAPA 2ZUDA 4HZUB 3LD9A 3B6EA 4KSCA 1ZD9A 4KHPL 2V9PA 3N5CA 3DMNA 2QP4A 1SXJE 1PJRA 2D4HA 3K0CC 1KC8C 1HNZL 2R6CA 2KENA 2O8CB 4ON9A 4WJ4A 2R62A 1LYLA 4UNQA 4ZCLA 3LLMA 3LQQA 2V4DA 3ER0A 4LJZC 1WCMH 4DV1L 2FEMA 2IYRA 2HF8A 2JGNA 2Q9BA 3K0FB 4Q4JB 5EUMA 2G9NA 3NEJA 2WWGA 3P26A 5IWAL 3AGQA 4KO8A 2L0XA 4DDTA 5IP9G 4LI0A 1JEEA 3CPJB 3S15H 3PUVA 3LO5A 1Z0JA 1JAIA 3SNHA 3NKVA 4IDNA 4B32A 4C3ZA 2O8FA 3U2QA 4FINA 4LFBQ 3RS4A 5KTYA 1FUUA 3F5FA 3O47A 4JLDA 2F43B 2W6ID 4MITA 4Q4AA 3UWOA 4BLTA 4BEJA 3SQWA 1GNPA 1PH4A 4TMKA 1R0YA 4B43A 2GCOA 3WNCA 1XD2B 3A5UA 1C9OA 3HOXH 1KSFX 4GZMA 3FP9A 3AVQA 2H7VA 3MWJA 3CRVA 4G0NA 2ZRNA 3KXIA 2VZAA 3EPJA 3CWQA 1WJJA 3QPUA 3MLEA 4BEBA 2ZAMA 4G3XA 1MJEA 4B48A 4KJZA 1F2TA 2VSFA 3CUEF 3K7UC 2BE5D 5A5GA 1A62A 2ZJBA 3W6OA 1YVDA 1ASZA 1A0IA 1W3SA 1C1YA 2EJGC 1GRQA 4C0QC 2ONKA 2JJ8A 1QDEA 1W0JA 1WBBA 1II0A 4L5QA 1CFMA 5GAHC 3Q5EA 5FL3A 5KUTA 1HV8A 2D3WA 1QHYA 2I1QA 4TMVA 4E07A 1G18A 4K8OA 1E4VA 1W36C 1VQNA 3GJ5A 4B71A 2QSYA 1BOFA 2XB2A 4TQUS 3KKOA 4XH9B 3TK1A 1HH2P 1NBMD 1KJYA 4DR3L 1X1RA 1VHLA 3EA5A 5FR1A 1G7CA 1UBGA 3LRPA 3M4PA 1IBLL 1CI3M 3RLNA 4LF6Q 1E98A 1OW3B 2ZI5A 3RRNA 3KTAA 3WMGA 1Z47A 2JA7G 3B85A 2N8NA 1V43A 1CKNB 5E7IA 4OK6A 2BBSA 1GFIA 4B3ML 1E1QD 4XIGS 1ASYA 2C8VA 4Q48A 5GADl 2XZOA 4PR0A 1W36D 3T1HL 4B33A 2BH8A 1KO5A 2E1RA 5DYIA 1N36L 1S1MA 2N49A 4HDQB 1AQYA 3VR6A 2EIFA 1XX6A 2D0OA 1XNRL 3AP1A 1UE7A 1R0XA 5KSYA 2AHOB 3T51B 1NMGA 4DV3Q 1A5TA 1CR1A 1PLKA 3ADKA 4MGYR 4GDFA 5C0XJ 1G8HA 4Q1DA 2LMCB 5J3BA 1Z6TA 3SS8A 1J2JA 4LNQA 5BR8L 4WJ3M 1W5SA 2EFGA 2OXRA 3W90A 1GUSA 1N6RA 4CIDA 3IGFA 4CRWB 3HR7A 4BE7B 3CX8A 5G41A 3HOYG 4BLSA 4QBHA 1KI3A 4LF4L 2DWQA 4IDPA 4Q4JA 4BY7H 2XXAA 2HEIA 2REXB 5IP7G 2GEVA 2H8KA 4E03A 1A8VA 1LUZA 1UPTA 3KQNA 5A4JA 1US8A 5EUQB 2OE2A 3TR5A 2OLKA 4TSFD 5K8IA 3EQLC 4JYBA 4X66Q 3WBKA 3CQZH 2PI2E 2JCSA 3CH5A 5AJZA 4JL8A 1VQ4A 2G83A 5JRZA 4TTQA 2Q2IA 3BB1A 2J5XA 1IYJB 4LFAQ 4JVNA 1HT1E 1P16A 2CWAA 3QOFA 3T1HQ 1XPUA 3THXA 2D2CC 3HP1A 1GUTA 1IW7D 3CCQA 3T1OA 5IK2D 1IN6A 4IVRA 1JEDA 3A7LA 1P60A 2RGEA 1KRTA 1KJWA 1ZC4A 3REFA 3QKRB 4JVSB 3KJHA 1DAKA 1MR3F 1NSFA 1FW6A 4LJAA 2FFAA 2OESA 3BE4A 1CUKA 3GEHA 4MH0R 3RNLA 3M4YA 1VQ9A 3CPEA 3A5ZB 2UZ3A 1FPMA 2CW0C 1ESNA 2WSMA 4BQSA 4JV5L 3QVVA 4K81B 1KMHA 1YKSA 3G0HA 4IJMA 4QJ3A 4XTCS 1E1QA 2F1IA 1G21E 2JA6G 4R4TA 2D74A 2V7QD 3DZ8A 3BJUA 3U3RA 3DKVA 3CR8A 4D6PA 4LJYA 4PO9A 1CF4A 1TQ2A 4Y0VA 1U90A 3NG1A 1YNJC 1R8SA 1LABA 1CJMA 5BR8Q 1KDOA 3VMFA 4P4SB 4Q7MB 1ZD8A 2H5XA 2QY9A 4IPHA 2Q0HA 5SZKB 2O0HA 4B35A 2G0NA 1OYYA 1TQ6A 4HJ9A 2V54A 3OE7D 4XOIA 4R1JA 1ZRHA 5EE3A 2WKRA 3T5DA 3C4JA 5F2EA 3TSOA 1NN0A 3BFKA 4PSKA 1RKBA 2H57A 1NLZA 4DR1Q 3TZUA 5L3QA 1OIWA 4KLKA 2YOGA 1EFCA 4PMWA 2LCFA 2QPTA 3T34A 4B6EA 4F4IA 5JEEA 2ZANA 2WP8J 4B3RL 1M74A 2WJHA 2O8CA 4L9SA 4URYR 5K8UA 3GLGB 5BN3A 1YZQA 2ASEA 2C2HA 3SHWA 2BIFA 2WIAA 2B8FA 1A7JA 4EQ6B 4GKKQ 2ZXUA 5JHGB 2WPDA 1JPNA 3RDPA 3WYAA 1E69A 1G8PA 2KBEA 1IY1A 3NBXX 3RWOA 3U44A 2Q3HA 1EFHA 5IK2A 2HV8A 4P4UA 2WSSD 3GPLA 4P0TA 1I6HH 1TUEA 3QIAA 2JXMB 2UVQA 4A4DA 1U94A 1FQKA 2OZEA 4JJKA 4MKIA 3S14H 1UEIA 4GLAC 5E3HA 2C98A 2MNAA 5JJLA 3P32A 5AJXA 1X6VA 2VH5R 2ASBA 5DISB 3FKSD 4HSEA 3U4QB 2N78A 1GIAA 1SVKA 1G3RA 2EXDA 4RFVA 1E2EA 5L3SB 3RZOH 2R8RA 2FPKA 2B63G 3BDOA 2PI2A 1ZIPA 1ZNWA 5JFGA 2UU9L 4IEIA 1YHAA 4JLAA 3AP2A 3KXKA 5C0XH 3L0SA 5G3YA 2OUKA 2YINC 4LJ5A 1JI0A 2F3RA 4LBZA 4URZR 2G88A 4JI5Q 4B74A 1PFSA 4D25A 4GI7A 4IOJA 5LMUL 3GJ0A 4WA7A 4JC0A 1ODFA 3MUFA 2PX3A 1Z0DA 1MOZA 4WZBE 4IRUB 4A2WA 5JWOA 3SJBA 1UF9A 4Q1EA 4MRPA 4R4IA 5FTKA 2IHFA 2ZJPA 5JWRA 3KUDA 2R9VA 1NMZA 4JI0L 1T3SA 2F55A 4NE2A 1U9IA 3OAAD 4JOIA 1KMHB 2DGYA 3QE0A 1SROA 3G6EA 3MCAA 3PVSA 1TU3A 1RRCA 1YRAA 4X8HA 2D06A 4RKEA 1L1OC 1NJIC 3PGZA 1ZCAA 3KLWA 3TE6A 4LF7Q 3UDIA 3MWLA 4BRWA 2FU5C 1XTQA 3H94A 2WKPA 4HUQA 1X9NA 4BLQA 3RSLA 3ZZTA 1II9A 3SEAA 1XEFA 4MGZR 4Q1BA 3G5UA 2PEYA 1QHHA 4IDHA 3IRBA 4BY7G 4EIWA 2E8GA 2IEZA 3SC3A 1CSQA 5IP7H 3AH8A 1BBUA 3QF4A 3FHCB 3HJNA 1GOTA 3GEIA 4XWAA 2LWIA 4TT3A 5M5WH 1RE0A 4HLQB 3W9YA 2E5LL 1Q3HA 3BH7A 3VR1A 2RHSB 1EYGA 2GBLA 2RKOA 2I5HA 1SMXA 4V02A 4X8MA 3PG5A 3EAQA 4DEYA 4YLGA 2VHCA 3OEHD 1S40A 4JI6L 5FFMA 4O0MA 3LNCA 1SHKA 3BRWD 4ZPXA 1N36Q 1XMJA 3P20A 1DD2A 5SZHB 1IN7A 4PSAA 2P3SA 1YI2A 2W0MA 3GDEA 3N6RA 4RSGA 3FWYA 2QA4A 2ZUBA 3UIEA 3FOZA 5A35A 4EPXA 3QXXA 4YQFA 1D2NA 2J9RA 4HATA 2K33A 1DOAA 1E9CA 2N42A 1DCZA 1XZPA 3NHAA 3ZQJA 3AVXA 3UE1A 3JAMc 2CCKA 3B9QA 2ZYVX 2WAQE 4FW9A 1YNNC 2QF7A 3TSZA 4WZ6A 4GL2A 3X1XA 5HKKD 4A3KG 1E79D 5KHOC 2F4VQ 1Q1EA 1KI9A 4A0RA 4DAYB 4O3MA 1KKLA 1P4SA 1SKYE 5JS8A 1GAJA 2GAOA 1FQJA 2NOAA 3CW2C 4US1R 1LFDB 1YZUA 4NXNL 4IO9A 1P7CA 1G19A 2IYSA 2ZS8A 3F3YA 4LFAL 3ZVRA 1UE1A 1VCMA 4JI3Q 1Z08A 4G7OC 2ZSFA 3BH0A 3ETLA 3AQQA 3L43A 3BFXA 3QXJA 3CONA 4V0KA 4NMMA 4KSBA 5KPJA 1ZYRC 2VF7A 5AJWA 1W49A 3BB4A 3UMFA 2NVTH 4L16A 1K8OA 1X1SA 4XTRA 2B92A 4FI3C 5EP1A 3STBD 4PC1A 4A9AA 2BJVA 4EJSA 1HNWQ 1SXJB 2YHSA 4D82A 3TQYA 1T4GA 2BMFA 3GJ6A 4Q9KA 1WYDA 4B3TL 1OHHD 5IE8A 1MABB 2GBLC 4IXMA 1Z29A 4JKIA 4WXPA 1XJ0A 2J0QA 2DNEA 4TSFA 4OO1G 2Q2TA 4YMTA 2QMUA 3PV0A 3BBPA 1VECA 2CLCX 2EU8A 1CTQA 1D5CA 3P4YA 2QE7A 1GD7A 2DUDA 3STBC 1E2IA 1YEZA 1KZ7B 2F43A 1Y1WG 1JXMA 3IILA 5AWFC 1AE3A 2ECKA 1OSNA 4S35A 3RS0A 2MO0A 2NZ8A 3ZLJA 2FSHA 1GDDA 1EUJA 2VQFQ 1E1RD 3OEHA 4OHVA 1ONBA 2IUUA 3VR2A 3FYHA 2O8FB 1B0UA 1D9ZA 1TF7A 3RS3A 2CE2X 5FLMH 1IBKL 5BWMA 1Z6GA 1IYUA 2EWVA 3UPUA 4Q9IA 1A82A 1UEJA 3EG5A 1YR6A 2JLXA 1GUAA 3MJRA 2EQSA 1CIPA 4DV0L 2DFKB 1G5RA 2QTVB 2PCFB 5JLJA 5KSZA 1OB5A 1YR8A 1R0ZA 2HHHQ 1DBSA 2EQBA 2FMXA 3LGJA 1UWVA 1XTSA 2X1VA 2BJWA 621PA 4XVUA 2SHKA 5CK5A 3CC4A 1E9FA 1SN8A 4JLPA 1VQEA 5DSZA 4CDGA 1PH7A 3TMKA 4EKDA 4JMPA 1ZM4A 3X1DA 1HZBA 1XNRQ 4WXRA 4R71A 5JZVA 1JR6A 2BVNA 3I1FA 2JLRA 2PMKA 3A1WA 1DO2A 4X64L 4A3GH 2A78A 2OT3B 2ANBA 3GJ3A 1I94L 4R9UC 3TR0A 3VKWA 2O8EB 4QGHA 5BXQC 4Z1MA 1Z7TA 4PZ7A 2V1CC 3A4LA 3GLGA 2IWHA 3QXHA 1DAEA 1EX6A 4IQZA 3CB4A 4QG7A 2JA8H 4L5RC 3FFBA 3VKHA 4Z8XA 4GMXA 4BFTA 2A19A 4DDUA 3PEWA 1KL9A 5H8WA 1ZYUA 1B8AA 3LVQE 1E2KA 4PZZA 2IYVA 4ABYA 1EG7A 3IO5A 4AC9A 1SLJA 2IW3A 1BVSA 1NN5A 1MRNA 4BXXG 3CCUA 1L4UA 4HAXA 4AG6A 3UDGA 1E4YA 1T0HB 2UU9Q 1X6OA 5C4XH 1RFLA 1TAGA 2J1LA 2ZAOA 3C15C 3C7KA 2GRJA 1O78A 3DOEA 1W2BA 3OE7A 4OJQA 4E5UA 2AKWB 4MYUA 4HJAA 3GTKH 3S1MH 4XWKA 2ZM5A 3HKZG 3RNUA 1U8AA 1TKWB 2P0EA 1MABA 1ZNYA 4GKJQ 1T8TA 3OIYA 4I1UA 4AKGA 1J6QA 1UDXA 4MQBA 3T15A 4LF5L 3MFYA 2JLQA 1WB9A 2BA1A 4UNPA 2H18A 1DEKA 2J3EA 2W6JA 5L3RA 4LGMA 3ERSX 4BFXA 3FPPA 1ZU4A 4NYMQ 4URXR 2IYWA 4LJ4A 3R8CA 1N8RC 1N34L 5IF9A 4IEEA 3IO3A 2CHVA 4DIDA 2ZRDA 5B64A 4DK3C 5TMPA 5DIFA 4C3HH 4L8JA 1JR3E 2XTMA 4PQYA 4ARZA 3LFUA 2FPMA 1T6NA 1ZJ6A 4KHPQ 3I4NG 4N0DA 1MH1A 5FPTA 3G48A 2ZI7A 2ZSDA 3SFVA 3U50C 1N25A 3KDFA 1AS0A 1XMOL 3OW2A 2CVHA 2NIPA 3B78A 3QEOA 5L8VA 3H86A 5FJ8G 2QEXA 3GTJH 3EZ9A 1AN0A 2IA5A 2VTKA 4PHTA 1H9RA 2A5YB 2UXDL 5E95A 2J7PD 4CVNA 1AJEA 1SXJC 2JJQA 5IWAQ 2OFXA 4BWYA 1ZNZA 3I5YA 1II8B 1RRPA 2VSXA 2ZUCA 3B60A 4X62Q 4BFYA 2QORA 1HUQA 3U7FB 1S96A 4DUZQ 2DHRA 1E9AA 5CM8B 2OV2A 2UKDA 3BIFA 3C8UA 1VQDA 4DV3L 1KO1A 3FMOB 4N0EA 4WOPA 3UG7A 2Q2HA 4OWXB 4JI6Q 4QM7A 4A2PA 4MDEA 5AJVB 2O0KA 4IW3B 1OH8A 1GHJA 1OKKD 1P6XA 2Q6TA 4GP6A 1GJXA 1HCZA 2BBWA 5DHAA 4HIMA 1Q21A 4B3XA 1ONLA 5KYKA 4A2QA 3E9HA 1JJ7A 3EN2A 3KJIA 4B76A 1OXTA 5IT5A 1UJ2A 1GKUB 2ZJOA 4RZ2A 1HZ9A 3WWVA 2GNOA 4FIDA 4Z8YA 4JYAL 1Q44A 1I94Q 1KMQA 4ZDIA 1SVOA 4A3IH 1E9EA 3JZMA 1XBTA 5CLLA 4IFDI 2LXJA 4NXMQ 1NNEA 1Q86C 3RC3A 1YZNA 3VHLB 2QAGC 4IDOA 4ESHA 3QY0A 2B7BA 4NYMR 4OHYA 1W4AA 3HOZH 2G1KA 2ODWA 5M3MH 1P3JA 5FUWA 3R9IA 1M2OB 1NI3A 4G7HC 4DR7L 1VPLA 4NYIQ 3RS7A 2QU8A 2JLVA 1YZTA 4DR2Q 4MRRA 3OTOL 2W00A 4DJTA 3EPKA 3DO6A 2C35B 4LYAA 4Q02A 4OI1A 2H16A 5EXPA 4QHSA 4BFUA 1P75A 1M34E 3QKUA 4J15A 5FUVA 3THOA 3RABA 5IYCH 2FFHA 2ZJAA 3LV8A 5DH9A 5DNYB 1OTCA 4HAUA 1ZM9A 4RG1A 3WMFA 4R98A 2AXNA 4G5QA 4PC7A 3ICQB 4HUQB 1EWQA 3ZS9A 2VP9A 1E9DA 5CK4A 3PR1A 3DPUA 4LJ7A 3K9HA 1G5TA 1CLUA 3G4SA 1TTTA 1VQ5A 3BJIC 4C30A 1NP6A 2ZTSA 3CRW1 521PA 1QHXA 4A3CH 1IN8A 3SOPA 1Y8PB 1KK1A 3K70D 4XVRA 4ESVA 1S1CA 3DM5A 3T61A 2D2EA 1W4CA 5B58C 2D0PA 2G6BA 2HLDD 2R6DA 5GJWC 4PZ8A 4LUOA 2IYZA 5FI0B 4JSYA 1Y63A 1QHSA 4KODA 1CJVC 3ZVLA 3E70C 1EFRD 1G4UR 4BECA 5JBQA 1JT8A 2V1XA 1YJWA 3LY5A 1ZUIA 2ZRAA 3H0KA 1TMKA 1E99A 4LF9Q 1VG1A 3MRSA 1GNRA 1G64A 3SYKA 3VFDA 2Z6VA 2R7DA 1E2VA 2E5LQ 3HOWH 1GWNA 3WDNA 1X3EA 4GN3B 5LMNL 1VCOA 1M7BA 2ZJ8A 1KDTA 3BB3A 3QBTA 4P3YA 4ZDWA 1A2KC 2ZEJA 4X66L 4EQ5A 1Q3TA 5FUYA 4R2IA 1X65A 5IYDG 2YVUA 2YTXA 1JE5A 3PSIA 3NC1C 1Q7YC 4OHWA 3RWMB 3K0EA 3TH5A 3PF5A 3VNUA 4P74A 2AL7A 4BFWA 3QKTA 2Q9CA 1HTPA 2HHHL 2VP0A 2QPOA 1NVWQ 3QXSA 1FL0A 2RF4A 1E3MA 1HQCA 3EWAA 5CYOA 5M3FH 2KHJA 4C4PA 2ERYA 4DLWA 5GJBA 2ORWA 3AVOA 1M7GA 3LA6A 4LPKA 3NBHB 3GLHB 5C44H 1RJ9A 2NG1A 1S9DA 1RVDA 2BA0A 2GJKA 2IXGA 3K09C 2DB3A 2GHIA 1GRRA 1BBWA 4ME3A 4B3SL 1JECA 1GNQA 2ZRKA 4LYJA 3HOUG 3AQ4A 3AFPA 2F1MA 4IFDG 1N6HA 2WICA 4PQRA 2HYIC 1QUQA 4D0LB 5IT9c 3IUYA 4XD7A 5CIQA 4DC9A 1HE8B 1NIPA 2N46A 1XTJA 2G3YA 1EESA 1J5EL 2ZJYA 4B34A 2RH5A 4Q7LA 1G7RA 4Q66C 1VG9B 4DCSA 4EPWA 4JI5L 2PCJA 3CXCA 4FN5A 3WYGA 1KK2A 4A82A 3F1ZA 3RLFA 3TS2A 4DR3Q 3D7MA 1R6BX 4L4UA 4TTRA 3P27A 4HB4A 3U3JA 3Q3JB 3PJRA 5F98A 3ZD6A 1W2HA 3CP0A 3F8TA 3B6YA 1LF0A 2PMDA 3KDSE 4A3DG 1X55A 4D80A 2F7SA 1O7LA 1DADA 1VG0B 1FX0B 4BGDA 3AVTA 4RKFA 4JBWA 2ALYB 4DSOA 3AKCA 2QM7A 1GTVA 4QOSA 1PYSB 2AK3A 4DLVA 3H84A 3HU2A 4II7A 3K0AB 1WCMG 1P9NA 4MDFA 3K80C 3SFZA 1VQJA 5AUOB 2IK8A 3KJGA 4HJ5A 1N6LA 4D4KA 5DO9A 2PZGA 5B30A 4MRVA 3BZKA 1W7AA 3M4OH 1IYVA 1KIMA 4D4LA 1E22A 1SKYB 3DVLA 3QKRA 2EJMA 3THYA 1CRQA 1J90A 2AR7A 1KZGB 2IYLD 2A69C 1W4RA 2R65A 4I99A 2JE6I 1Z9FA 2VIIA 5H68A 2RGNC 2ZSBA 1E1TA 4LHZA 421PA 5JSZA 2H5EA 5KNCA 2HT1A 1J7KA 3FHOA 2WBLC 2DBYA 1OHHA 2P6UA 3T1QA 5C4XG 2ZVPX 3JVUA 5LD2C 4HZIA 5TDHA 1YJNA 1PVOA 2X77A 1V9PA 1RRGA 2RGXA 2L15A 3HOXG 1N34Q 2B6HA 3EC2A 3GFOA 3SYLA 1YR7A 2QP9X 1KY2A 4DUYQ 3I32A 4GPTA 4KU4A 4IFBA 4BZXA 1QBKC 4MYHA 3MSXA 1KAWA 1ZINA 2VQSA 4DT1A 2GZDA 2PMZE 4JI2L 2GDJA 3X1WA 1D2EA 4TLBA 3CNLA 1EX7A 4JI3L 1TNDA 1Y3AA 4B47A 1H95A 1H9SB 3B7GA 3A58B 1W48A 1CP2A 3CCVA 4CGZA 2AK2A 5KPDA 3Q5DA 3LNNA 2FZLA 2V4ZA 4Q7JB 4DV5L 5LDDC 2QBYA 2GA8A 1Z6AA 2GVBA 3TUIC 2A5DA 2EFCB 4YC7A 2WAQG 2VQEQ 2JJ2A 2YYZA 2A1AA 3I7FA 2GK7A 4RD4A 3SJCA 2KWIA 4YCVA 1RZ3A 1SVSA 5KOYA 4DR4L 4US2R 4PC2A 2XGJA 3Q7PA 3H4MA 4QRHA 1T0JB 1AZSC 5JSZB 1RRFA 4AIIA 4HEJA 4IKEA 1LW7A 721PA 1FYCA 5FBLB 3QUSA 4LJ6A 1VQKA 4RD3A 1Q0UA 2IX3A 4JVMA 1RC8A 2OCPA 4MA4A 2BWJA 3DMDA 4L15A 2GXAA 4DR2L 3C14C 5FLXc 3GQBA 3GTQH 1KK3A 5IRCD 2RGBA 1MIUA 2HQLA 1EGAA 1PH2A 5LMUQ 4GOKA 4PANA 4ACAA 1UKVY 4DR6Q 1I2MA 2DFLA 4DCNA 5HPYB 1MV5A 3CIOA 3QNUA 4PPFA 1HPCA 1IQPA 1TQ4A 4IOLA 1LS6A 1IY2A 3KFUA 3WHLA 5J4HA 4RZUA 3EIVA 4YDHB 4JBJA 3Q9LA 1FTSA 3NH9A 1FP7A 3M85A 2AX4A 1YZ6A 4F91B 1TWFH 1B7YB 3FKIG 1WXQA 2C95A 1X54A 3PO2G 4FD2A 3ASYA 3W3ZB 4HB0A 1DG3A 1A2BA 1SR3A 4LYFA 2GVAA 5M3FG 1T5EA 3I92A 4TT3D 4DNRB 1GM5A 4GP7A 4Z51A 2QGZA 4A0HA 3A4NA 2NMVA 5IY0A 4QGAA 1EIFA 2ZE5A 3ZGXA 2VS1A 2XGTA 5D3QA 3R8FA 4A3IG 1VQPA 1JALA 4ZI3A 2QTFA 1XTDA 2XB4A 1XEXA 4H1UA 2R2AA 3OOCA 4DDVA 1E2GA 2B63H 4C7OA 1KQSA 5HCIA 1KI7A 5M3MG 2VPPA 3CCSA 3I62A 1SFOH 2CLDX 1I5FA 3PITA 1N2CE 2QBYB 4TZ6A 5GJVC 3U4VA 3H15A 1MO5A 2XOKA 2DWPA 4POGA 2WAXA 3FMPB 4DV7L 1CJTC 2WMOB 2PEZA 5FOUA 3EASA 4A92A 1W44A 2IXFA 5J4VA 1IY0A 4HUTA 2PQAA 4JI7L 2R93H 4K0KQ 2ZPTX 4TMXA 5KDOA 3CLVA 2EW1A 2Y0SE 1N6NA 4UP9A 1XRJA 2HLDA 1SHZA 4M1SA 4QQBX 1EQRA 4A3DH 4B6FA 3T1YQ 2JJ1A 3LLUA 3B82A 1OFIA 1WE2A 2L5TA 3T53B 1OKKA 3GEEA 4P73A 1QHIA 1FJGQ 2PH1A 1CJUC 3S16H 1TUIA 2FNAA 5CM9C 2GILA 3AKEA 5FL7D 4A3MH 5EXXA 4DSNA 3QPWA 3T06B 3A1SA 3OEED 3L2OB 3QF4B 4JIMA 1JNYA 3TRZA 1IXRA 2ZIAA 3H2YA 1QZGA 3TUJC 1G3IA 2HYDA 2A6ED 4GLVB 1PH3A 4PAQA 5KO2A 4TYPA 3VHXA 1Z22A 2IS2A 2QM8A 1RYHA 2ODEA 1C7YA 2UZIR 2D7CA 5DN6D 1PHJA 1KI1A 4H13C 2O5IC 2IY5B 4DUYL 4C0HA 4HIOA 1K73C 1JR3D 4HAYA 4LC0A 1HQMC 2I3BA 4X8LA 4OI0A 2HXYA 5FOXA 2R7ZH 2K50A 2JAQA 2OCBA 2RMKA 4OKSA 3TRFA 5HCNA 3VU9B 2EFDB 4A1FA 4DRZA 3GJ4A 3J80i 4M1OA 2QMOA 4IOMA 3FGNA 2WPDD 3A0JA 3GTLH 1HR0W 2LXKA 5EQTA 4URVR 4A15A 3SGIA 4GN5A 4BBRG 3QVUA 4LCBA 4TL6A 2UXBQ 4P4TA 4B3BA 3QXCA 1YZKA 5BN5A 2JA1A 4KFUA 5KU1A 1OE0A 4DV1Q 1U8ZA 1U5KA 5ELNA 2IX1A 2FSIA 1KHIA 4NL4H 4OXPA 3LVRE 4NYIR 2MO1A 4A3FH 3U61B 5C0XI 5ELXA 1AS2A 4DB4A 4PHGA 1P61B 4LBYA 4DZZA 1QF9A 4DLXA 3IEVA 4TN1A 1Z3IX 2D7DA 3VR5A 4AKHA 3ZZ0A 4FXPA 1AGRA 1WF3A 3AEZA 3NTUA 5HR5A 4M4SA 3RRYA 5FI1B 4JBKA 3GP8A 3A37A 3GTOH 1DG1G 4RMFA 1N6IA 4FCVA 1VQ7A 3U9SA 1Z2CA 2V7QA 1GO3E 4ZKEA 3KJEA 2AUKA 3K81C 2CNWA 1VQFA 3X1ZA 2OLJA 4JI0Q 1Z28A 1IZ6A 3L2PA 1E9SA 3S2HH 2CK3A 4LJ8A 1UAAA 2XXAB 4B73A 4OHZA 4GMDA 2BMJA 4NDZA 2Q8IB 1M6NA 5FL7A 2FEOA 4ITRC 2O8BA 3PUZA 2CMKA 1YJ9A 1AIPA 2YTVA 2BKUA 2HF9A 4BFSA 5JMTA 821PA 1NTGA 5JS7A 2NN6I 1RL2A 5HTKA 3BERA 1XJQA 2XTNA 1XEXB 3B1YA 3AYHB 4JLNA 2A68D 1GILA 2ZJQA 2AKAB 2DFNA 2VQEL 1GKYA 4RCYA 5CDFA 3R7WB 1AQUA 3NDPA 1II8A 1IAQA 1Q46A 1XU4A 5J4KA 1I6VC 2IX0A 1SZPA 4WIAA 3H1TA 3I73A 3RYTC 4LF8L 3CR7A 2GEUA 5CB6A 1JJ2A 1DAHA 2FA9A 1P2SA 3K1JA 2X2FA 3WXMA 5AUNB 1GHKA 5C1BA 1V5WA 3I2ZA 4XSHA 2HIXA 2C9YA 5H1YA 2VY3A 1N32L 4TYWA 1DXMA 3PEVA 4HJ8A 4PPQA 3J7ZC 3OIWA 4IOAA 5KNBA 1E2NA 3PQCA 3KQLA 1Q1QA 3B8HA 3H3VI 5FLMG 4F92B 4H1VA 2KBFA 2O5JC 4LHWA 4BLPA 2FSGA 2IYXA 4JLBA 4NP6A 3T5GA 3FVQA 1FOEB 3IDQA 5EP3A 1QJOA 5LB2A 3MAAC 3ADCA 2ZI4A 2KB0A 2A7QA 1B9NA 2OFWA 5GVRA 3AVPA 3D3QA 5HKKA 3GFTA 4LRWA 1XMSA 1X86B 3CH4B 2HJVA 4LF4Q 2WWWA 2GN5A 2IC5A 4HDCA 3TNFA 3RZDH 3V00A 1P2VA 1UE5A 4A3CG 1LM0A 1BKDR 1U98A 1EFUA 3CPWA 1OLOA 4M1TA 1ZNXA 4A8JB 2A6HC 4MTNA 1IBMQ 4NCKA 1XCMA 2PBRA 2XSZD 2BDOA 2VHUA 4RCZA 4OQXA 2C5LA 1K8MA 2JK8A 3BZCA 4LUZA 2B21A 3AV0B 1NBMA 3IHWA 5TVKA 5HGQA 2DY1A 4U7DA 2GCOB 1IXRC
chains in the Genus database with same CATH superfamily
1IE3A 1ZKMA 1RI3A 1SVWA 5DRYA 3D31A 3LXUX 2KM1A 5EVJA 1BWSA 1LLFA 4OHFA 3QENA 1VMKA 1X42A 3RE1A 2WWHA 2VPZA 1AT1A 4KE6A 4HT3B 4XDGA 2GYVA 2A6HD 3W1BA 2XJ9A 3MUNA 3DMGA 4X64Q 2VPQA 2B69A 3TZHA 2RA4A 3P1HA 4LE1A 3W6PA 1GD1O 2OD2A 4KN6A 4OP3A 4Q16A 2WB1B 4TYYA 3I4LA 3DL7A 1M2GA 3S28A 1V8DA 4HCJA 3PIIA 2QQ5A 2ICEC 4HKTA 4OHRA 2FRDC 1B1AA 3SF8B 3HRZC 2JQOA 2QVCA 3IQXA 3QV2A 4IAOA 4Y1RA 5DLQC 3SX4A 2I03A 4UUAA 4FB4A 2I2BA 1E2WA 4XQJA 2JA7B 2HUNA 1U0BB 3KF6B 2PQMA 4HAVA 3MC0B 5AI8A 1KEEA 3A1VA 4LJ9A 3WB2A 3CJTA 4M2LA 4Y7NH 1NKSA 2DM6A 2C0QA 2JEAI 1L5KA 2YKGA 1PYOA 1BF4A 4DR5L 1DMSA 2CBGA 2H11A 3EGDB 3AUTA 3FCCA 3V48A 5AJ3Q 2X4GA 2O2SA 3GYGA 3PC8C 4RVCA 4R7ZA 2K5NA 1ZR4A 4DDMA 4BKUA 4NULA 2FZEA 6Q21A 5EZ6B 2W2LD 3D64A 3FHTA 1WP9A 1GO2A 1UODA 2MT9A 1JHPA 1E0SA 1FP4A 4H0CA 3S7ZA 3WIUA 1P8JA 2ZI6A 3I4MH 3MM4A 4X7RA 3G71A 3VAAA 4PGAA 2ZWVA 5FDFA 3WLQA 3IHLA 3NTKA 1I0ZA 3IKVA 2GETA 2CXRA 4H0NA 4TWAA 2A0XA 1M6VB 1MU0A 4JCCA 4Q9DA 1JAHA 1MLDA 2GD6A 1GSAA 1M54A 2QRUA 2XWBF 1ZAYA 5CU7A 1L4YA 2A30A 1KBZA 2A9RA 2C59A 2NGRA 2PSFA 4LA4A 4Q15A 1WZIA 2GLXA 3GVXA 3L4JA 6REQA 1K0RA 4OUDB 5KNBH 4F12A 1NYRA 1WCXA 2ECPA 3U4ZA 1CHNA 3RVBA 2R97A 1CM9A 3HY4A 4JNKA 2AW3A 2ZYRA 4BA2I 3W5HA 1YI0A 4RTQA 2G4LA 1K6MA 3QEJA 5LXTA 2P6NA 5CURA 2R7ZB 1BH6A 4OAOA 4XW2A 1V1PB 1OYOA 2OQRA 3ZIAA 4DCGA 3NP9A 1UQRA 2XIJA 1HT2E 1M0TA 2R84A 3CEJA 3FWHA 1LV9A 5A2QL 4BLRA 1PTKA 4EL5A 2QAJA 1EWKA 3SVZA 1I5EA 1Y8OB 1YS1X 1STGA 2V45A 3T3DA 1P7WA 3R76A 4BA1I 2J4FA 1WOCA 2PZEA 1ZUNB 3GUHA 2WKQA 3K32A 2FDCA 4EQZA 1KRWA 3MOIA 1VYUA 1FUYB 1PAUA 1PTJA 2YIJA 2Z8XA 2GOYA 2ZRLA 2C4WA 4O2AF 3UWPA 4DUGA 2PD4A 4UTRA 3ZDFA 4ZK9B 1W36B 4AG3A 4IJUA 1NCVA 4BXXH 3HZZA 5ALKA 2CJYA 2IU4A 1TMOA 1NM5C 4JU8A 1X1DA 3C43A 5C46F 4BBSG 1RTOA 1BAPA 2BM8A 1G3MA 1F2ZA 2E4AA 3R0QA 3R3VA 3AR5A 1OFUA 4QRIA 1QG6A 3HB5X 1XNQL 1XZQA 4S1TA 1I50B 5TB5A 3ZJ4A 4YRMA 4BQOA 1PFUA 1UOEA 2FPOA 1FNMA 3QQPA 2ODTX 4IVPA 3PXAA 2R8ZA 4HN9A 1RP1A 2OHIA 4FUQA 1DB3A 3IOYA 2B2UC 4R5MA 1YOVA 3A2MA 5DBGA 2AFHA 5JMPA 3ZGVA 3HK2A 4P72A 1V41E 1ZOOA 4C7OA 1QVRA 1UKEA 1E5TA 4N5IX 3S2SA 5C8YF 1BBXC 2C4UA 3I55A 1PT8A 2I87A 4HTAA 2BEUB 2DPMA 2AZ4A 5D6OA 4E22A 2Y77A 1C2YA 3DHWC 2DSTA 3KLBA 4BDSA 3RU2A 1IDOA 3HKZB 1HKHA 2M98A 2P2ZA 4U02A 5HQ3B 4G5GA 1R5NA 3BA6A 4NQZA 1ADCA 1WVLA 1QTNA 2WNHA 3E6AA 4JYCA 4P53A 4TL9A 4ETMA 2MOKA 4RTSA 2GS9A 3QU5A 1A15A 2P8SA 2V8OA 2EC5A 2ES2A 3FUTA 5AW3A 4JP3A 4X1OA 3VPFA 1LBIA 4RKRA 3BFPA 3LX5A 3EA6A 3BYZA 3OICA 4QHTA 3TMYA 2X6QA 2CQAA 1QE5A 2GF0A 4PG7A 1QTIA 4X93A 3ILHA 3OY2A 1WD1A 2IX9A 2NO1A 3L05A 1JFVA 3EIEA 3OYYA 3KE9A 1LF5A 1GPJA 4DV0Q 4CF6A 2Q2NA 1NHWA 3U26A 4FFBA 1RI4A 3QXGA 3JALA 5I9PA 1N3BA 1BVUA 1PL7A 1GP2A 1RI1A 2G0TA 1J09A 1RDFA 1D8TA 2ILVA 2VLIA 3AEKB 2HOQA 4OF4A 4PAWA 1PH9A 4ZVOA 5K1ZA 4X62L 1GRNA 2HCJB 1J0CA 1W25A 1XQWA 1CQIA 3ELUA 3QOWA 4TLMB 1JDJA 1X80A 2D62A 2Z9DA 5EEGA 3PO3G 3V4ZA 1E8NA 3BEOA 4N5DA 4LFCB 3UT0A 5JI3E 4KYVA 3HFGA 3HHEA 2GZAA 2MTBA 3OOEA 3U16A 1Q6YA 5IC5A 3VX3A 3GTQB 3EBPA 4UUPA 3EJWA 4URUR 2GD2A 5BSWA 4GX2A 2I4IA 2QDXA 4QREA 4W9MC 2G25A 2AUNA 4UUBA 1CUZA 5K8TA 3EISA 1U7OA 3ANXA 3GLFB 2PNJA 3QWFA 1PV4A 2J0UA 2Y05A 1XC7A 2VKQA 3CLSD 4RAUC 2XMRA 3Q9SA 3FFTA 2R47A 1QFSA 1XJVA 5CLQA 1R4AA 5FPYA 4CIAA 2OQ2A 4Q1FA 4EW2A 4KBYA 2CFMA 4Q21A 3T7SA 1YHQA 4L8YA 1HFJA 3I8SA 2J0VA 4Z4HA 2MMGA 2TECE 2Y1EA 4LDZA 2VHZA 1XNQQ 3K6SB 2WTMA 3I2IA 3PX7A 1ZJWA 4OOFA 3KFVA 2ZRGA 1WDLA 4HEDA 2UUAL 4YP6A 2XLBA 4TQAA 4NXML 2PZAA 3I53A 3NI2A 3UK6A 4NIMA 3EIXA 4A27A 3ABZA 5AQEA 2YJ6A 5F2DA 4IJVA 4EHJA 4QC2A 4OH7A 3A2KA 2OG1A 3ZU4A 1MB0A 2E48A 3N58A 2AQ2B 5KKCA 4UNSA 1KFCB 4BFCA 2F62A 1Q1ZA 3ZCTA 3BHJA 4F8JA 3K9NA 2AD5A 5KNLA 2A3RA 3QWIA 2A5FA 1KDPA 1YBFA 1ZQ1A 3FZEA 5H83A 3VDNB 2NV6A 4UTNA 1WOMA 4ENRA 1ISGA 1PZFA 3AG5A 1P4RA 1Q1BA 3GCXA 5FOTA 2FWAA 2WQZA 3U7QA 1PDQA 1ZIOA 1NNXA 2VL7A 3L4EA 2UUCQ 2VSOA 4LQDA 2H92A 5DHPA 1ICEA 1K3RA 2OBLA 1XLTA 1FGUA 2HUPA 1BW9A 3X3HA 3ZK9A 2IU0A 1XJCA 2WWFA 3CV3A 4NYJR 3SKVA 3ZH9B 1TJPB 3OQMA 4K3UA 4OXQA 1QKIA 1K6JA 2XZPA 3HJCA 2ZULA 3I09A 3N6VA 1VYTA 5DN6A 5LZ7A 2A1TS 2C92A 2FR0A 4J75A 2BAGA 4Q4LA 5TT0A 2EFJA 3VTZA 2QAGA 3G49A 3PJGA 4P2CB 1R0LA 2B7LA 3GA7A 3OFND 1L0BA 4JT8A 5LXTB 4YY3B 3RUFA 2C5SA 2OR3A 1PH5A 2HY7A 1WTPA 2QD1A 4LVOA 3NEPX 1AZPA 1PL6A 1U2EA 2CHFA 4E5NA 5G0UA 1MD2D 4U7WA 3LF2A 1H0HA 3LGAA 1IZZA 2E2DC 5LMNQ 1JIUA 1EX1A 3ELWA 3F97A 2IYAA 3RFXA 3QF7A 4AZTA 4Y2PA 1OF1A 1A6XA 1XCPA 3GZ4A 4I8DA 3TLMA 3FPGA 3Q10A 4BOYA 2I33A 3J80c 2XMQA 4CXMA 3RQIA 4YQFA 1Z6XA 1MV8A 1U2DC 1Z06A 3KUXA 1YRLA 4Q0FA 4J7AA 4YRDA 4C6HA 1PJ4A 5HJ5A 3IEMA 4WZBB 5C7YA 2VHQA 4UJ3A 1ZIYA 3N8IA 1TF2A 4I50B 4OHUA 3MJEA 1FP4B 3E2IA 3ESBA 2EXXA 1KOGA 1Z2AA 1G20B 1P2UA 1KQNA 3VHXB 3W5BA 1O6ZA 2HSZA 4D81A 1QO0D 2VAWA 4B6PA 4GXNA 1BQEA 3WAKA 1GCAA 2O3QA 2ON6A 1IL2A 1XK7A 5E2AA 3RSZA 4BNKA 1Y0BA 1NULA 1X92A 1MKYA 3VM6A 3K0XA 4YCWA 2O14A 3KKQA 3LX6A 4CDMA 2P79A 1FFHA 2REQA 3CMMA 4NCJA 2CVFA 4C01A 5HW0A 1NMFA 1Y14B 4AYTA 2V55B 3P9YA 2PUFA 1HL3A 3H1FA 2GN2A 4BX8A 4G4KA 1IQRA 1INLA 1YKFA 3P2IA 5JMOA 1AHHA 1U04A 1F3OA 3EZLA 1L8XA 4RGTA 1NRXA 3UVEA 1DCFA 1X15A 1UFRA 1Y8AA 2Q49A 1TT7A 3G13A 2B1QA 3RYCB 2XZTA 2IYPA 4DMHA 3S8YA 2EY1A 1V39A 3PO2H 5AHRA 4WGGA 1JHAA 3ER6A 3WLEA 3F71A 1FSPA 3IDSA 3RVKA 5JNLA 5K6AA 3TVTA 3DMHA 1TADA 4H35A 4QU9A 3WXBA 3M81A 4ZVMA 4D6XA 4DABA 1P1FA 1VGRA 3UCFA 4C7OB 1YBYA 2BBTA 4POFA 2VRNA 5TXGA 1B74A 4NDXA 4DLUA 4G0XA 4S2UA 4NE7A 1IUKA 2BFOA 3LE8A 2D2FA 5EVCA 3BILA 1C14A 2B36A 4KXMA 4DRXB 5IKEA 1BA2A 1O77A 2PE5A 4MW7A 2FR8A 2RONA 1VQGA 2IWRA 5ELOA 1R6DA 1N6OA 3CA8A 3EEBA 4BAGA 4QIWE 2ABWA 1EU3A 3HCBA 3Q0TA 2EDAA 4KQWA 1G41A 3BMQB 4Q47A 3IEKA 4KP7A 1MENA 1C30A 2JCYA 3HBJA 3KQPA 3ZDRA 5JBIA 1T6YA 5FNVA 2DYKA 2HJGA 1TKCA 1DP4A 1E1CA 5H3LA 3UF0A 1ZGZA 4ARBA 3FUUA 2J3QA 3CVVA 4M0FA 4Q9LA 5L3SB 2Y8EA 1X3GA 1HZAA 2BM1A 1CK4A 3B20A 2Q3LA 2XECA 1NI4B 1YNOA 4MW1A 2DERA 1GV0A 2W71A 3PWZA 1GY8A 3NEMA 2UXBL 4YYZA 3UHPA 1D5WA 4JT9A 2LKCA 1BQ4A 4QNNA 4E32A 1G8KA 1J2RA 4AVYA 3MTDA 3REGA 3EVNA 3NB0A 1JEQA 1N2CB 2CBZA 3I9LA 4CBVA 5EQJB 2D5BA 5T3UA 4IJWA 3ROZA 3Q8DA 2F9MA 3NX4A 3MCVA 4OWWB 4DYHA 4GNXC 4JK3A 1YCGA 5EIBC 5HIKA 3E9ZA 3K9GA 1H2AS 2PT9A 2BELA 3NGLA 2PYZA 1TK2A 3NUZA 4H6PA 2ORIA 2PX0A 1COWD 2HJWA 4UULA 1VL8A 3AF6A 4TKOB 4YT5A 4B5KA 4CT4B 4MVJM 1PH1A 4OTZA 3ZVMA 4Y2UA 1KDRA 1CW2B 1P31A 3QEKA 4JASB 4JLUA 3G79A 1ITZA 1R9GA 4ML3A 5LQUA 1DOKA 2H2IA 2VZEA 5BSTA 4YONB 5AJ3L 5KTTA 2NP6A 5CFLA 2ONCA 3I4NB 1DDGA 5B6IA 1M1YE 1WTQA 2L1BA 4D1YA 5IC4A 4RHXA 1RCVD 1FL9A 5GV8A 4YRBA 5KMGA 1K6XA 1H9JA 4DA4A 4V0NA 1SXPA 4KHVA 1QGUB 2O05A 2MSKA 3OX4A 1RW4A 3MEFA 3KZ1E 1SFOB 4IIUA 2JGRA 3IQWA 3O21A 1OVGA 3GLIE 4JX9A 4OCZA 1JKFA 1M8GA 1LRKA 2VT6A 4LMRA 5BUSA 1JJVA 4HPXB 1DS6A 4BMPB 1Y8QA 1ZKDA 2PX2A 2EHJA 2FGJA 3KF8B 1DINA 3CUKA 3QLUA 4OPMA 1ENOA 2AOVA 1N5JA 1RYNA 3DBHB 3KSRA 3RVRA 2XN9C 1SHUX 2XTZA 3KTAB 4YBZA 2A2ZA 5E4TA 3SXJA 1WLYA 1B76A 5JYCA 3FOAA 1K5DA 3K2EA 3NENA 3DM3A 2HLHA 5F12A 3S5JA 3IIIA 3PKJA 5ALRA 1I50H 1O97D 2YX1A 2Z4RA 2JBAA 2VP4A 3BSFA 4EUKA 1GN9A 4OBBA 4YIKA 5JJIA 2WT4A 2RSNA 3H6KA 1GGFA 2QUZA 3CJRA 4HH4A 3S2YA 1DUIA 1WKCA 2C29D 2CN1A 3DZFA 4WKGA 1LTTD 4LQLA 5EE9A 2Q6KA 4C0BA 3CVWA 4RVGA 3ANTA 3ELYA 4DADA 2NVYH 5HURA 2Q27A 3IUSA 2G9DA 1HYBA 3D2CA 3K9LA 4TS1A 4UEJA 3C3KA 4HLCA 2GEFA 2RGNA 1YNJD 1T6BY 4HMPA 3TDNA 4CM8A 4B3MQ 1IULA 1J99A 1A4XA 5FBRB 1RHQA 3ZIUA 3OO1A 4ZOAA 3VC7A 4Z9BA 2X7JA 2L55A 1HA5A 4KIUA 5C4JB 5DCYA 1SMYC 4JI7Q 1QP8A 3QI7A 1E2QA 3M3YH 1FZQA 2QWXA 1I4HA 4BGIA 2PZBA 4XFDA 1VIAA 4G5HA 4R6XA 3ZDQA 4PLVA 2I55A 4YY3L 2QYOA 5LQJA 5ECDA 2QLBA 2UXCQ 3UXMA 2KVMA 1VB3A 3FWZA 3W2DA 4OM8A 4AS2A 4CIYA 5TF0A 2EARA 1FRZA 4RABA 1CSPA 4B4UA 2WB1E 3B3GA 3ER8A 3TJMA 2GF2A 3GUCA 3IUNA 3U39A 3RHTA 3TW6A 4ZQIA 3DEIA 1IWPB 4ZI7F 4MVJP 3OMWA 4WGFA 1U63A 2ZT5A 3FNHA 3ROGA 1E3JA 1DJPA 1PFNA 2D8AA 2EY5A 4OHKA 1FCJA 2Z83A 3AKDA 3MINA 4P33A 4DRYA 4KFRA 3IMFA 2FFJA 4DLKA 4XIJA 2IS1A 5FOSA 3CLSC 3TBIB 2P3LA 1MPXA 4IO0A 4UUNA 1UAPA 5CP8A 2W2VA 3VO2A 5DLQE 4C2UA 1QWSA 4GQIA 5KQPA 4MV6A 4M1QA 3DLLA 3N0TA 4Y2QA 4TV9A 3ONEA 2PPBC 1HJPA 3RC1A 3ICWA 4J43A 2GBPA 1XAGA 2FV8A 2VNUD 1AS3A 1NXVA 3HQ4O 4L07A 4M89A 4O1HA 4R8LA 3ZZ1A 4EB6B 5J2UA 1L7NA 4O02B 1HLFA 4ZEXA 2A88A 3TQCA 3D6MA 4NWIA 5KTPA 4J0CA 4HJ7A 1HE5A 1L5SA 1RZVA 3BXXA 3H3JA 5G3LF 5C44G 1YKGA 3JZFA 4PZYA 4UDOA 4ZEWA 3TNDA 2XSCA 3PF8A 1D7OA 3DEPA 1S9HA 2JA9A 1KHTA 5FUXA 3E82A 4DCMA 2A0FA 4HLDA 4F6RB 1KRHA 1XTPA 2AF4C 2JFGA 4F3TA 1X0VA 1YZLA 4ZV7A 2WZDA 2OCKA 3VGPA 1Y1LA 3KALA 4XCXA 4NZNA 3UUGA 2C99A 4KO3S 4Q3BA 4A8JC 3O9VA 3U7EB 1E5QA 2V9CA 1CZHA 1JIVA 3JQ9A 4N5HX 4A3SA 3HKDB 1XZMA 3OLYA 4Y18A 4K9MA 5DGHA 2WT9A 3W1VA 1CSEE 4BKQA 3OPNA 2KA7A 2OBXA 1RZRD 2VDRB 5JEDA 4BP1A 1XXHA 2NACA 4RTOA 4IUVA 1RXSA 1Z4NA 3J80A 3EVBA 3CNHA 3MGGA 4LVUA 4Z9AA 1GKKA 3OJWA 3TOZA 2WWXA 1AK9A 1RU3A 3FMGA 4JT2A 2WWYA 1BG6A 3WISA 1WDMA 2XQIA 4XGNA 5E9WA 1QH8B 1L1OA 2GJSA 3IAM6 1KDYA 4JY7A 1O87A 5B55A 5G1NA 5JC1A 1VIMA 2X23A 1Z0IA 4KMUC 2K5HA 1ZL2A 2HRBA 2O6HA 4XT1B 1MIOA 3HR8A 3PDIB 2O0JA 4UTVA 4JI2Q 2ATEA 2BCJQ 1JQEA 3AFOA 4H4DA 5KCMA 4Q3LA 1ZHFA 3ZV7A 2KHSA 2JA5G 2G77B 3KHSA 1N32B 4R4CA 4I7ZC 2UUBL 4JD5A 4PZ0A 2Q5QA 4N8X1 1Q57A 3AIOA 1E4OA 2QPAA 1P7ZA 1PSDA 4MR9B 1LV7A 5EWJA 4AN4A 1D7QA 1AXGA 1W75A 1AMNA 2OOSA 4KRYA 5MN4A 4RMHA 1TVKA 1ETUA 3E84A 3IV9A 3WLJA 10MHA 3I9V1 3UYKA 1FJGL 4KBGA 4XRGA 5AVUA 2OWEA 2DZDA 3WRYC 2FN7A 3JD3A 4XQEA 5KOJB 1EY4A 5AMXA 1CQXA 3KT0A 1SVMA 5IYZA 1ORWA 1VLLA 3H1BA 3Q7QA 4YWKA 2QTBA 2R8YA 3FTDA 3IQDB 4NNPA 5JVH3 4J3JA 2XCLA 2Q5JA 2XAAA 2ZUUA 3RHZA 5AVZA 3I34X 5EMNA 2KW5A 5J4YA 1H2HA 3LC2O 3P71T 4K86A 2C5AA 3ZWOA 4RFSA 2RHQB 1HRKA 4INZA 2ZI9A 2WVHA 4KO1S 4RD0A 3TLAA 4DBLC 9MHTA 1BOSA 1UE6A 1BN6A 1DJOA 2PZKA 2SICE 3UDFA 2CV0A 5G53C 3CZPA 1VQAA 1L0WA 3FE2A 4PY2A 1CTMA 5KWSA 4RJLA 3TLGB 4L8GA 1U3DA 5TQ2B 4OSEA 5ARBA 4G86A 1CPYA 3IQEA 3P7JA 1Q0ZA 5ELCA 3CZ9A 4FQ8A 4GI5A 5KSPA 5FIUA 2VDJA 4Z4GA 2OAP1 2VP6A 4A5OA 3PIPA 2K7VA 1YOBA 4KNYA 3AB9A 1XL1A 1U2RA