4JNKA

Lactate dehydrogenase a in complex with inhibitor compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
326
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 326
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jnkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4jnkA02
1MC5A 3BHJA 3DC2A 4R3NA 3GZ4A 4YAGA 3AUAA 1DO8A 1RYEA 4H3VA 4RZIA 2OHXA 2X5OA 8LDHA 4EZBA 2QX7A 3CZRA 1O89A 1WDMA 1ZK0A 4FS3A 3ASVA 1HYEA 1UXIA 4HADA 2FN7A 4PZDA 3F4LA 4E4YA 1SEPA 4RJTA 4BNHA 1NQOA 3IKVA 3IUPA 4KUGA 4LCEA 1EE9A 4RPLA 2AE2A 4KUEA 5L4LA 1OAAA 5IZ4A 1E6UA 1M6WA 1I32A 1SO8A 3K73O 1MGOA 1ISIA 4QQRA 3TZKA 3V2GA 4IBOA 4MKRA 1Y81A 2R6JA 4HNGA 2BFMA 1EQUA 2GN6A 2JCYA 5GZ6A 3U49A 2VUSA 4TWRA 1TT7A 1O9BA 5TGDA 1CWUA 1HSOA 2IZ0A 4HKTA 3HNPA 1NM5A 2WD7A 5DT9A 2E82A 1NPYA 3IUSA 1JWAB 2ZB7A 4GAEA 2XF8A 4J7XA 5U4QA 4WLUA 2AA3A 3ZV3A 2I5PO 1OC2A 3WSWA 4AJ1A 3ONDA 4GH5A 4J91A 1E3WA 3TPCA 2JFGA 3DOJA 3JYLA 3Q0EA 1OFGA 3RUAA 3OA2A 1FDTA 2ZB8A 2JAHA 4H16A 3UXYA 1W6UA 2PZLA 4CQLB 4Y98A 1YVEI 4IQ8A 4FC6A 1KERA 2JD0A 1DLIA 2P4HX 3GPIA 4NPCA 1DEHA 3GZNB 3QLJA 3DBLB 3PJEA 3TZHA 4YBZA 4MKXA 1LC3A 3H8VA 3VDRA 4CM1A 4CUKA 2FRDA 1XYGA 1GCUA 1BW9B 1GUYA 4O6VA 4XD2A 1RYDA 1IPFA 1GTMA 5I9NA 3PP8A 1X7GA 5L4NA 1P1FA 1ZFNA 3RC2A 3MJCA 5COBA 4FCCA 4DRYA 3VH3A 3JQBA 3PHGA 1Z45A 2VHYA 3JQEA 3KYDA 4IZHA 3O38A 4K1LA 3VPHA 1JTVA 1TLTA 2CVOA 1BDMA 1NYTA 2NVUB 2Q1UA 3JQGA 1KVSA 2W2LA 3I4FA 5JCJD 4FJ0A 2FSVA 2EF1A 2H5LA 3HDQA 3LC2O 1K6JA 3DXFA 3PYLA 2PKQP 4TQGA 5I7EA 1LRJA 2G0TA 3W4KA 4XQCA 5KKCA 5K0ZA 3FI9A 5JAMA 4IDBA 5DBGA 1N5DA 2UUOA 3VTFA 4LISA 1YONA 4I9NA 4AL4A 3DONA 2Y0DA 2X5KO 4FW8A 4XKJA 4BGEA 3I52A 1T25A 1A72A 3VZPA 4D43A 3S55A 3PWKA 4JJIA 5LDHA 1B26A 3T4EA 4NBTA 1BWSA 1LDGA 4NG5A 4NFHA 2EERA 4XYMA 5FWNA 3BMCB 1Z7BA 4K9DA 3KBOA 2ZYAA 3OJOA 4CLRB 4IDCA 1NX6A 1KVRA 3QV1A 1C1XA 5JO9A 3VOSA 4BGIA 3D5TA 3NV9A 4YRAA 1LQTA 3LT2A 2CVZA 1VL6A 2HAEA 1GL3A 5COAA 3ZCXA 2DT5A 1X13A 1DBVO 1XU9A 1PZFA 5FYDA 4LK3A 2GCGA 3A28A 1TT5B 2X0JA 3GPDG 4GL4A 4HXYA 3WFIA 4FDAA 2NUAA 3GT0A 1SOWA 3LSYA 4JP2A 4ZD6A 3BHIA 3LYLA 5ILOA 1P1IA 5F1OA 1MV8A 2IE0A 2PZKA 2NM0A 4LCJA 1D4FA 4NU5A 4PLFA 4CM5A 2GLXA 4QXMA 3ZWAA 2O2YA 1R15A 4ILKA 4FFNA 4ND3A 5AXDA 4CLOA 2H63A 4KQXA 3DQPA 3QRWA 2DFVA 4GLOA 4I1IA 3ZU5A 3DFUA 4MDHA 1U3UA 2Y1FA 5A9SB 1LJ8A 1VSVA 2I3AA 3NX4A 1T4DA 2EJVA 4JBIA 3H9QA 2B35A 1PWZA 4D79A 2AQHA 4XDYA 4U6QA 3U0BA 1DHRA 2UAGA 4BO8A 4HWKA 1X0XA 4IDAA 4KDFA 2POQX 2B5VA 1WNTA 2C29D 2D3TA 3FCOA 3L6DA 2CNBA 1HE3A 4RCVA 3ASUA 4DQVA 5L45A 4HUJA 4BKOA 2J8ZA 4AFNA 1IUKA 4PZCA 3KXDA 4FN4A 5CEEA 1RKXA 1E7SA 2Q49A 2X7HA 4BNMA 1XDWA 3GK3A 4D3SA 5L7TA 2V7PA 2Q4EA 5EL0A 2UYYA 4M54A 3DWFA 1DC5A 2VN8A 4GKBA 2RH8A 4TZTA 1GDHA 1GYPA 1EK6A 1JVBA 4UVGA 3CPSA 3FNGA 3DB2A 4MJLA 5JW6A 1UR5A 3UUWA 1MC4A 5DCWA 3GNSA 4IJUA 1PGJA 3IKTA 1H93A 1UP4A 1PX0A 3KYDB 5A9TA 4ALMA 1XWFA 3QVOA 2UUPA 4GLLA 4Y6SA 3PZBA 4F46A 4Z6KA 2WEKA 1PJ4A 1Y8QB 4R1TA 4HFJA 4E31A 1HETA 4CUZA 1T1SA 1I24A 4EW6A 4YAIA 5CG1A 2AMFA 3HADA 3VZQA 2X4GA 4BNZA 1LLUA 2GGSA 3DHEA 4WPGA 3KV3O 4BB5A 1DJQA 1NR1A 1YXMA 3WYEA 4NI5A 1N9GB 5G0WA 4DPKA 3OQBA 3GN1A 3JQAA 1GQQA 2FSSA 3QIVA 2IZ1A 1RM0A 3OEYA 4CR6A 5B12A 2HK9A 1QV7A 3X2EA 3VPSA 4N5MA 3E82A 4G81A 3VHRA 2FPGA 5BSEA 1HDCA 1JKFA 1N9GA 3OF2A 4RQUA 4WLEA 4Z3KA 3U3XA 3GY0A 4PVCA 2Y66A 3ZNPA 5JMWA 2ZYDA 4XJSA 3NGLA 1WLYA 4FC7A 1GU7A 4ESOA 3BMQB 2DBQA 3QWFA 1NQTA 1ONNA 5GZ3A 2NU6A 3R1IA 3E9MA 2ZQZA 3ADPA 1H94A 3T7CA 1ZO8A 2DTEA 4J16A 3F3SA 3K9QO 3CIFA 3MJVA 4YXFA 4DBZA 2QIOA 2D5CA 2BLLA 1XELA 1DIHA 2HMSA 5KJEA 4RL6A 2YQ5A 1T4BA 1AN9A 1P0FA 4DIBA 1HLDA 1E3IA 3HB4X 3KYCB 1DC4A 4W9NC 1H9BA 2V6MA 4E33A 2G17A 3GMSA 1XKQA 3EC7A 4B7UA 1E7RA 3S2GA 3PEFA 3RBVA 3B20A 4XQGA 5I7FA 2O3RA 1UXGA 1H5QA 2HMWA 3L4BA 1XQ6A 3CH6A 3H5NA 1GADO 4CLOB 3KRTA 2J3JA 3CKYA 4EJ6A 1Y9EA 5EPOA 2H9IA 1MXHA 1ZH8A 2VNAA 1X7HA 2BFOA 2X86A 4KWHA 4L75A 4BO0A 5BSGA 5CDSA 1NP3A 3HFGA 2BGKA 2NADA 1TXGA 3C7CB 4BKRA 2F00A 2FY8A 2WWRA 4DWVA 1DIGA 2X9NA 3PQDA 3TF5A 3H9EO 1LNQA 4GPD1 2TMGA 1A9ZA 3EDMA 4Q3AA 1T26A 4ZJUA 2X23A 1WWKA 4A2CA 3KEOA 4LSWA 5KVQA 4YAJA 1ADGA 2QZZA 1U4OA 1BTOA 4A10A 4XZ3A 2B83A 3H3FA 3BTVA 3MJEA 3L4SO 2ZKLA 4ZHSA 4LW8A 1NVGA 1UUFA 3IAHA 3TL2A 5G2OA 2GDZA 1O94A 4J90A 4D7AA 2NQTA 3WYBA 4E2XA 5JDCC 1RJWA 4KWIA 5I7SA 3AY6A 3GVXA 3PZRA 4E5NA 1TB4A 1DSSG 1E6EA 3Q9NA 4IJVA 4J9UE 3WIDA 4D3DA 4BHTA 4E6PA 2ZIZA 2J5QA 5HS6A 4Q39A 2FOIA 4PN3A 1ZEMA 5EINA 1KVTA 4UVDA 4P38A 4MOWA 3ZHZA 1H6DA 3FTNA 1LLCA 3B1FA 3BTSA 1K6XA 4HNHA 4J4TA 1SEVA 5H83A 4RVHA 4AJIA 3OJLA 1SBYA 9LDBA 1K5HA 3E9QA 3ITKA 1ISGA 3JYPA 4YJDA 3RUFA 1ZZEA 2C54A 2GERA 3KSDO 2GSDA 1DFHA 5IJZA 4R16A 1PJLA 1G6KA 2DC1A 3VC7A 3B1KA 2PKRA 3OHSX 1RPNA 1E3WB 2CF5A 5JC1A 1F14A 4D41A 4K26A 1B2LA 4YACA 1YO6A 3OECA 4TKLA 4BS9A 3W8EA 4YT5A 4CM3A 1A9YA 1J0XO 4RDIA 1YB1A 3LLSA 5HA5A 3D1LA 5T64A 3JD1A 3AWDA 3QVSA 2B5WA 3JQFC 2A92A 4PLYA 3HUDA 5L7YA 3MTGA 4J2OA 3IL2A 3GGGA 3RUHA 2P4QA 3GEMA 4ONEA 4YJHA 3AK4A 4H7PA 1NWCA 2DVMA 1I2ZA 5CP8A 1ZW1A 4RPJA 3QA9A 1XGKA 2IYPA 3NDIA 1R6DA 4LRSB 4OKIA 2VHZA 3AFMA 5F1KA 2VUTA 2WE7A 4BKUA 1PJ3A 3QSGA 4EJMA 1NHWA 3H2SA 4FBGA 4IDFA 3RUCA 3HDHA 2HCTA 2IYOA 4P22A 1EBFA 1NASA 3LC7O 4DVJA 4J1TA 3IP1A 1B7GO 3MZ0A 2NU8A 4E5YA 4ND2A 4CMJA 4I5EA 4R54A 3BMNB 3QY9A 3AJRA 3JQ6A 4YWJA 2D8AA 4YJFA 2NVBA 1BVUA 3UN1A 4XDZA 1T2EA 4JK3A 2CF6A 3AUUA 7ADHA 2DM6A 1W4ZA 1HZJA 3EHEA 4L74A 4QO7A 5C7LO 1C1DA 4BQPA 4AJNA 2EG9A 3QE3A 4ZN6A 4I9UA 2CVQA 2OMEA 3IC5A 4DGSA 3M6IA 3HN2A 4OXKA 5JDCA 4A03A 3D4NA 3RBXA 3BMOB 3VAZA 1YJQA 2FR8A 5BSHA 4RQTA 1JKJA 1KETA 4CM6A 3P5SA 2HJRA 1NNUA 1G0OA 3ZWPA 2YDYA 2Y68A 3AUSA 1HRDA 2X0NA 1J6UA 5TQVA 3RFVA 3NKLA 1H9AA 1P1HA 3D5QA 3OSUA 3I4CA 4GGOA 4GBJA 5DN9A 4XGNA 1UDBA 1GPJA 4NHEA 2I99A 5JYDA 4X54A 1SAYA 2OUIA 4ROSA 2RHCA 4WK6A 5U1PA 2YUTA 3RWBA 4O1MA 3BTUA 5EERA 4ALLA 2HSDA 4DIFA 2DAPA 1R4NB 3DBLA 1U7HA 4JIGA 1BSVA 2O23A 3LT0A 3NDJA 5JAQA 4OOFA 3D3WB 5L40A 1WAMA 3ZWXA 1NPDA 1ONPA 2OBNA 2AG8A 5T67A 4NBVA 4WUVA 1J49A 2VZ8A 4TMFA 1CQIA 2J3KA 4R1NA 4BKPA 3KOUA 2V6FA 4N5LA 4OHUA 4EBFA 4J3FA 1C0PA 1WW8A 1QMGA 2I9PA 3LT4A 2D59A 2EKLA 2W2LD 1L1FA 3ZZNA 1E3JA 5IXYA 5EIOA 5J23A 2NTJA 3HSKA 4XQEA 4FIZA 2DLDA 4U0KA 2DTDA 1R12A 3RASA 4WGGA 4RGBA 4Q3NA 2EGHA 1R16A 4LMRA 5COQA 2Q50A 4NZ9A 3PXXA 4BMSA 4E3ZA 1LSOA 2BKAA 3DFZA 1PL8A 4K28A 4EITA 1PJQA 1HZZA 1PR9A 2ZATA 1T2DA 3D7LA 1EVYA 3WLEA 2J6IA 1U5CA 5THKA 1EFKA 2FWMX 3DZGA 3AOEC 2WYWA 3DBVO 1ENOA 1UDCA 5JBIA 1I3MA 1K2WA 2A9FA 3GH3A 2W4QA 1U8FO 5CPFA 1BMDA 4LMPA 3LU1A 3IIEA 4IZIA 4YJGB 4WCDA 1DXYA 2PD4A 4KTVE 2VT2A 4BNLA 4GX1A 4DMMA 3GVIA 2RIRA 4FQ8A 4EUEA 3PI7A 5A06A 3QHAA 3HE3A 1YB5A 3U5TA 5ADHA 1WMAA 1A71A 3CSDA 3QWIA 5C5IA 5A05A 1QXSA 1U28A 5TF4A 3H65A 3I6IA 4Q3CA 4NK5A 4F6LA 3DBRA 3INGA 1PS8A 4M87A 5HRUA 5IDQA 1HDXA 1CERA 2EV9A 2VWPA 5CEFA 2DBRA 4ZQFA 4URFA 1E3SA 3ON5A 2JD2A 4D44A 1YQDA 5MGBA 2WYVA 3OQ6A 3PJFA 1BGVA 3ETGA 4W7IA 1MP0A 3JQDA 4E2WA 1H0KA 1O5IA 3I9OA 3WDSA 4A7PA 4YT8A 5TT0A 1LRLA 5JO0A 2VT3A 2ZB4A 4RPHA 5F5NA 2G82A 1Z73A 4MO2A 3RKRA 3V8BA 3GVPA 3NT4A 4R5HA 5JY6A 4QUKA 4XQ9A 3ADOA 4UVHA 5CPBA 3SC6A 4BNFA 2FR1A 2FZWA 1I5RA 3AU9A 4XRRA 3RI3A 2VYNA 5B4UA 2FHSA 4ID9A 4YRDA 3KO8A 1W0CA 1G1AA 1ZSVA 2CSUA 2ET6A 1XA0A 1T24A 3VPGA 3DHNA 3MOIA 2UVDA 5I9MA 3DMTC 4ZGWA 2O4UX 1M66A 5LC1A 4BO2A 4OL9A 4BV8A 3JQCA 2Y1EA 3Q1LA 2W98A 1LX6A 1QRRA 1BDBA 2W8ZA 4L4SA 5BR7A 1UP7A 2PZJA 4E30A 3NGXA 1M2WA 1HSZA 3GA0A 1X0VA 3MWDB 1EQ2A 1PJTA 3OBBA 4JNKA 3F5QA 4ITUA 2AEMA 4J9VA 1GQYA 3DR3A 4KTTE 1LLQA 4JCOA 1YGYA 2C2XA 5JDIC 4NJOA 2PV7A 5IZCC 3GDGA 2GPTA 4CLEA 2HMUA 3C1AA 2GUGA 3LVFO 5TC4A 3WNQA 1GZ4A 4FOOA 2GRAA 4OKNA 4DA9A 4CMIB 5AXAA 2R00A 4GMFA 4J1QA 2EWMA 2YFQA 3H9GA 3KEQA 2Q1SA 3VH1A 3RFXA 1BHSA 4J7CA 4RO0A 3MJTA 2LDXA 4E5KA 4CM9D 3ZWYA 2X9GA 4D3FA 3AI3A 1YL7A 1FJHA 1FDUA 1U3WA 3JYOA 1Z82A 3N58A 2CDCA 1HDZA 3M1LA 1I33A 1QKIA 2WD8A 4MIOA 2AG5A 1JQBA 2HUNA 3BZUA 3DZKA 1R4NA 4MVJM 1GCOA 1VLLA 3S2FA 1CRWG 1RM3A 1Q7BA 2VHVA 3CXRA 3GHHA 2QYTA 4PLWA 4GVLA 4R9RA 3DZIA 2TMDA 5BQFA 1PZEA 3L6OO 2ZJ1A 1SB9A 2VZ9A 1IL0A 4MINA 5BSFA 1N92A 1HEUA 3FNFA 3PK0A 4ZQGA 3AM5A 2Y1CA 2OP1A 2OFPA 5JMPA 4EYEA 3W8FA 3PTZA 1ZBQA 3ZU3A 1DRWA 2F1KA 1HDGO 3A4VA 1K0UA 4E5MA 2CDBA 3RUEA 2E48A 3I9NA 3GUCA 4A26A 2ZTVA 3PWZA 1MB4A 4W9NA 5AXBA 3UKOA 4CM9A 3LLVA 3CINA 1AXGA 1ONOA 2W90A 3DZBA 4M55A 1YL6A 3U9LA 1ISJA 3IMFA 1I10A 3NJ8A 5T8KC 1ZCJA 1PJ2A 3OIFA 2HK8A 1XU7A 2RCYA 6ADHA 1KEUA 1GY8A 2HQ1A 4F3YA 3W6UA 1I3NA 2DTXA 2P9CA 4GWGA 4E12A 4R01A 2RBEA 1Z7EA 4YEDA 3ZDFA 4DTIA 2GYYA 4CLDA 3I9LA 1YQGA 4M89A 4OO3A 5A02A 5HS4A 3EAGA 3OJEA 3W4JA 4A27A 3PHLA 4FR5A 1NXQA 3BHMA 5A3JA 5T5QA 4UULA 3K6JA 3ICPA 2DKNA 1C0KA 4CM4A 3F1KA 1KS9A 1YB4A 2QRKA 5JCXA 2SCUA 3WX0A 5KJ1A 1U1IA 1X7DA 4UVEA 3KTDA 1B16A 3JD0A 1PEDA 3IP3A 3NAQA 3PFFA 4DREA 3WWZA 5KVVA 1U9JA 4IQ0A 1QYXA 4CR7A 1SCUA 3ROMA 1P45A 1D1SA 2EXXA 4PG6A 1IHYA 2PH5A 2LDBA 5IG2A 2H1SA 2P9EA 4AJKA 2PNFA 2I3GA 3GUYA 3V1UA 2B4QA 3I1JA 1JWBB 3EK2A 3RKUA 4F6CA 4II3A 4WE3A 1YJ8A 4HX5A 3VZSA 5TS3A 3TJRA 5HTOA 4EJ0A 4IUYA 1IOLA 2NVUA 1DDOA 3C7AA 2GR9A 4PFJA 5U9CA 3I3OA 3HFSA 3L0DA 5KJ6A 1MLDA 1Z75A 1FMCA 3FD8A 3JYNA 3WQQA 5A5EA 3NTQA 3QW2A 3KSZO 3JSAA 3L9XA 1YBMA 2OXIA 3W6ZA 1YH3A 4PZEA 1CJCA 4DQXA 4HBGA 4B3JA 1QYCA 1ENZA 3ZN2A 3JQ9A 4U7WA 4JP3A 2GZ1A 4WEOA 4YYZA 5THQA 5A1TA 4NQZA 4IXWA 3D4OA 3R0IA 3LK7A 4NR0A 4KOAA 4K6FA 3HZZA 1VC2A 2C2YA 4CMGA 1JAXA 2G76A 3AI1A 3UCXA 1VJ1A 4F45A 1ML3A 1YBAA 1TEHA 2Y93A 4N18A 4UEKA 4BNWA 4CQMB 3EZLA 2PK3A 1LQUA 2Z1NA 3RJ9A 3H5RA 4PLGA 1D3AA 5JNLA 2Y1OA 3I23A 1FXSA 3SBOA 4MVJA 3VKUA 2J5KA 1F0YA 1N1GA 1N7HA 3T4XA 1MX3A 4UREA 1GUZA 1M6HA 3G49A 5ER6A 3K92A 4P4NA 3WBFA 1NAHA 4MVJE 5G0VA 4XJTA 3RCBA 1EFLA 1PZGA 4TZKA 1SPXA 2V6BA 2VOJA 5HBRA 4UEJA 4XYLA 1P1JA 1U8XX 3O4RA 5TSDA 4QTZA 4Q3EA 1E1LA 1B3BA 4PG5A 3WMXA 3ENNA 3ZH2A 1C1DB 1Y1PA 3DOOA 2IXBA 1FF9A 4Q3BA 4RDHA 5IN4A 4YTEA 2Q1WA 5F5LA 1DFGA 2Q3EA 4R9SA 5DF1A 3ZNOA 2B4TO 3GGOA 3W8DA 3O8QB 3AY3A 3JQ7B 3OH8A 4DXHA 2GF2A 2Q2WA 2BD0A 2R00C 3K2BA 4WNCA 4Y67A 4DPLA 5L95A 3TFQA 5F3RA 4CLHA 1DLJA 5TJ9A 1EDZA 4IJWA 1QV6A 2VYND 5C7IO 5FEUA 5AXCA 4NFSA 2E49A 2ZK7A 4NFYA 4KQWA 1BXZA 2XPCA 2WMDA 4JQCA 1DC3A 3JD4A 3HWRA 4BB6A 3NT5A 4AG3A 5G4KA 3TZ6A 4W82A 2Y05A 5JFOA 4Z0TA 3DMTA 2PFGA 4W7HA 3WYCA 1LBEA 1ZK4A 2VYVA 1QG6A 4ND4A 4NIMA 3MCVA 3VDQA 4QFDA 2GZ2A 1EEHA 1I3KA 3C1OA 3G17A 3H9JA 4RVGA 4B4WA 1H6AA 2IZZA 2OO5A 3HHPA 3DZHA 3GEGA 4DMLA 2C59A 4OMUA 3V1TC 2P68A 4N5NA 3U09A 2C0CA 4L0QA 3FNHA 4AJHA 1Q2XA 2EIHA 3IDSA 1HDOA 3JQAB 4HFNA 2AEFA 3N7UA 2AW5A 4IDGA 1W8DA 3PJGA 5EMHA 4BUCA 1C14A 3PPIA 4FJ1A 4IDEA 4J1NA 4LGVA 4PCVA 4TRJA 1YOVA 3WLFA 1LXCA 2A35A 5KJCA 4TRNA 4O0LA 3IOYA 4HFRA 3UF0A 2EKPA 4GI2A 5L9AA 1ZK3A 2YY7A 1Q7GA 1ADFA 1PGQA 2NACA 4UUOA 2P5UA 1JN0A 1OOEA 4OXYA 5ITWA 3WGYA 4J7UA 3ULKA 4B7CA 4LVUA 4WCFB 5CDUA 2VTDA 2I66A 4FFRA 3FWNA 1IY8A 3WGTA 4IM7A 5JDIA 4OOEA 1PWXA 1V3TA 1GUFA 1Q1NA 3KYCA 3EMKA 5K6AA 5CFZA 3LQFA 4U5QA 4QECA 1BG6A 4R68A 4CPDA 2DFDA 1JVSA 1QSGA 3ZWMA 3JQ7A 3FPLA 2X1HA 3KLPX 5JAZA 1OBFO 2CY0A 2P2SA 4CV0A 2NV6A 2QRLA 2ZTMA 5A4DA 1R4MB 3JTMA 4BO5A 1QLHA 1UZLA 4IS2A 3WR5A 1PQUA 1ID1A 2PWZA 1D7OA 2D0IA 3C85A 3WGIA 1E7YA 4E2ZA 4IIUA 1S6YA 3AY7A 4FD3A 4XGIA 4RVDA 1BRMA 2JCVA 3STHA 3KZVA 4YRBA 2E6UX 2GN4A 4QO8A 2OOSA 3U4CA 1EBUA 2ZCUA 3ROPA 2OORA 2YW9A 4XYBA 2P5YA 3W4IA 3BAZA 3KM0A 4GSKA 4EUFA 4DC0A 4J6FA 4IGFA 4ZQBA 4DL9A 4A73A 1NFQA 2Z5LA 1O8CA 1TVEA 4Y8VA 3WICA 4DIOA 1UXKA 3CE6A 5I8ZA 1XLTA 5AYVA 4DUPA 4BNNA 2JAPA 4Z0PA 4ALKA 5CG2A 1MFPA 4BMVA 3VH2A 1XCBA 3ENKA 3K5PA 5JAIA 3AW9A 2YV1A 1VE9A 3GG2A 2CZCA 2QG4A 4BL5A 3GF4A 4ZRNA 3RUIA 2XAAA 4CM8A 5EJ2A 3ZW9A 4CM7A 5KCZA 1T2FA 3H4VA 1VL0A 1IZ0A 1WDLA 1I30A 3EW7A 1Y8QA 3DEYX 4I5GA 4JJGA 4MIEA 5B1YA 1ZMTA 1V3UA 3UOGA 3TFOA 5FI5A 1DHTA 2Y0CA 4OYRA 4RLHA 4J49A 1Y5MA 5DZSA 3ZWBA 5L4SA 3WGHA 1V6AA 3H6KA 1E3EA 4PRKA 4O59O 2FMUA 1ULUA 3DTYA 1J5PA 1EMDA 2PGDA 3G0OA 1ZJZA 4CL3A 1ADBA 2Q2QA 1CDOA 3NYWA 1CETA 3BIOA 2B36A 3ANLA 2R2GA 4G5HA 3ANMA 1JAYA 4LSMA 4YPOA 2PGLA 1Y8RB 3PYXA 4WCFA 2DPGA 4CQMA 4NJMA 4BNXA 5T8KA 4ZQEA 5IDYA 1VSUA 4J0FA 4J0EA 3DTTA 3UH1A 3UW3A 2PTGA 3FN4A 4C7KA 2AXQA 1HDYA 3PFWO 1NHGA 1KY4A 4L9RA 1WPQA 3GFBA 3OIDA 4CM8B 2NU7A 1E7MA 1YQXA 4MPDA 3ZGYA 3ZW8A 5DP2A 5ENVA 3JQAD 4HV4A 4XB1A 5FF9A 5I8WA 1V0JA 2ZYGA 4ZA2A 1MA0A 1UZMA 2GD1O 5ER9A 3G79A 4MVJD 5C37A 3AFNA 2PA3A 3NT2A 2JFFA 1EVJA 1LRKA 3QWBA 1Y7TA 1R66A 2AE1A 4RVSA 3SC4A 5TX7A 4TVBA 4U8GA 3BMNA 3GVCA 4W6ZA 1LDMA 3DMYA 2AEJA 3VKVA 4YR9A 1K6IA 5KVSA 1CF2O 1Y5RA 1ZJYA 1QP8A 2X6TA 3E6AA 3CZMA 1NTOA 3FPCA 2YHIB 1HYHA 3QVTA 3RU9A 3BXXA 5C7OO 1ZSYA 3I6QA 1X15A 1GFSA 2QQ5A 1H6BA 2YFHA 1HL3A 1R4MA 4IGEA 3S8MA 4YQYA 3ZHBA 3ROQA 1JU9A 2X9VA 2ZTLA 2HK7A 1NQAO 5A3VA 1AHIA 5IFLA 3GRKA 4Q3DA 3PHIA 1O0SA 5ES3A 1EUCA 3TN7A 3F46A 2PH3A 3ABIA 3KYBA 3TNLA 1ZVMA 4GVXA 5TRTA 3ZHYA 3OQ1A 2B0JA 1BVRA 3VPFA 1G0NA 3FWZA 5IDXA 1F8FA 3CMCO 3HQ4O 4NDNE 7MDHA 1B15A 4XR9A 3QVWA 4HFMA 3ANNA 1N8KA 5CDTA 4WEQA 3DDNA 3SLKA 1DB3A 1CQJA 2CDAA 1VPDA 2XXJA 2VNSA 2W2KB 3WQRA 4MVJG 4IJKA 4E13A 4Z9YA 4NMHA 3GEDA 2C7VA 1WVGA 1XR3A 4G65A 2O2SA 3O26A 3JQ8B 3V2UA 4ALIA 3GDOA 4JXKA 1O6ZA 1NFRA 3U4HA 3WGGA 2D2IA 3QWAA 3GAFA 4G2NA 3T7EA 1NQ5A 3LF1A 4OM8A 1JDJA 1W73A 3GFGA 4B8WA 4MIYA 4PLTA 5DCUA 3L4BC 4M86A 3V1YA 3WS7A 4BOYA 2YYYA 5ICMA 2IODA 1E5LA 3M2TA 4CQMD 4KZPA 1HF3A 3HDJA 2GNAA 1T2AA 3INRA 4DYVA 3FBTA 4E2YA 4QT0A 3SLGA 2WD7B 3E18A 4DLBA 3C3XA 1UP6A 5TJHA 4FFPA 1R0LA 2VYVD 1KYQA 3UICA 5G0UA 5JLAA 3WGQA 2Y1GA 5ILGA 4PIVA 4PLZA 1E7QA 3AUTA 1B14A 2ZB3A 3Q2IA 1PL7A 3U4DA 1P77A 2YQ4A 4W99A 4D0SA 4J43A 2J5RA 3UFXA 4OSPA 4NJMB 4CQLA 4CMAA 3JD3A 2CD9A 3P7MA 1ZUD1 3UCEA 1P31A 1LDYA 9LDTA 3JV7A 2BH9A 3PDJA 3H9UA 4JLWA 3TZCA 3ZU2A 3DHYA 5AQ1A 4H15A 3WTBA 3R3JA 3FBGA 4HP8A 1Q0QA 3G3EA 3RFTA 3A9WA 4M1QA 2AQKA 4RF3A 5EQDA 3FR7A 1Y6JA 4O5OA 3SJUA 1LI4A 5AVOA 4XIJA 1Z74A 4R5MA 2QHXA 4BO1A 4AJOA 4XIYA 3RD5A 3RAJA 4MVJH 3NRCA 4CUJA 3Q6IA 1LDEA 4XGKA 1J4AA 3VVCA 3BMQA 1TT5A 3PLNA 3RUDA 2VRBA 2BF7A 1E6WA 2EKQA 3RROA 2EW2A 3DBHA 2E37A 3B6ZA 1PZHA 5EESA 3DBRB 1I3LA 5CDYA 3DAPA 2CMDA 4Z9XA 3EY4A 2A4KA 4YA6A 3WGZA 3JQBC 3RC7A 4BV9A 1GAEO 3SEFA 4FGWA 2EGGA 3CEAA 3ZI0A 2C5AA 2JKVA 1PQPA 1PTJA 1VRWA 4IPTA 3DAFA 3RU7A 4MP3A 1QYDA 5DOVA 3H2ZA 3JQFA 2I67A 3KLMX 2EW8A 3HG7A 1R37A 1DFIA 2C82A 5IAAA 5A5FA 2HO5A 4MVJP 4R1SA 3RC1A 1PJSA 3TSCA 5EN4A 4I9HA 4Z9FA 4OAQA 2P91A 3L6EA 5JCJA 2BELA 1BW9A 1U7TA 1P74A 4CR8A 1YL5A 4DLLA 4EI2A 5K9ZA 3WJ7A 2G5CA 4DC1A 1BXKA 3EUWA 1T1RA 4XCVA 2BMAA 1JKIA 5TLSA 3PQEA 4OGWA 2YV3A 2BRUA 4PG7A 1EE2A 4BNIA 1DIAA 1HE2A 1ZEJA 1NBOA 3Q11A 4OJNA 5IF3A 1E77A 5G0TA 3RQSA 2YZ7A 1N7GA 1PGPA 2PZMA 3ZWWA 4RVFA 5DOZA 2UV8A 4D0RA 1IPEA 2O4CA 1ZK1A 4P4LA 4IQGA 5H81A 1PR3A 4B4UA 4KDEA 2BI7A 4WCFC 4ZQHA 2HDHA 1E3LA 4R41A 4NH4A 1SMKA 4AVYA 4LVCA 1GPDG 1KOLA 3IJPA 3BYZA 1E1NA 1PIWA 3KETA 1P1RA 5ENDA 2JJYA 1YBVA 3VZRA 3PWSA 3COSA 3I83A 3SJ7A 3PQFA 3SXPA 1ADCA 1EVZA 3CUKA 1I2BA 1QYWA 2Q4BA 1HKUA 1GEGA 1ZSNA 4TSKA 5DULA 4PLVA 3ICCA 4FSHA 5JPIA 1KC3A 3WG9A 1HLPA 2J3HA 5F1PA 5CDGA 4QFCA 2O7QA 3WBBA 2QYSA 1MG5A 4C4OA 3KB6A 1BXGA 3C7DB 3M1AA 2PD6A 1YOVB 1GD1O 2Q1TA 4N7RA 1ZK2A 3Q9UA 3CMMA 1XG5A 3OETA 5IDWA 1ZXLA 3H5AA 3JQ9C 3UHAA 2IEBA 3PJDA 4RPKA 1E1MA 1ENYA 4PG4A 5DBIA 1HT0A 4ND1A 3ZWNA 1A7AA 2YV2A 4AJ4A 3VTZA 1E7WA 2FPPA 5BNIA 4BKQA 1MFZA 1IHXA 4RORA 1M67A 5A04A 5EQFA 1IE3A 2Y67A 1LTHR 3QWHA 3OM9A 2I6TA 5KTKA 3S1LA 4FOSA 1C0IA 2HRBA 1GV1A 5KVCA 1SC6A 1LC0A 3O9ZA 3OIGA 4O63O 4GX5A 3GZNA 5CAEA 2NVWA 1D1TA 2GN9A 1QR6A 4WLNA 3E5RA 3EYWA 1P3DA 4B3IA 1LLDA 4GX0A 2PY6A 2NU9A 2HU2A 1AE1A 3GQVA 4PLCA 4J4HA 3MJ4A 2RH4A 4UVIA 5FI3A 1AXEA 4FPXA 2JL1A 3KVOA 2Y0EA 3WXBA 3WIEA 4CV2A 1GR0A 4B4OA 2J3IA 2C20A 1KEPA 3MOGA 4D45A 1Y9AA 2YDXA 5IN5A 3WOHA 3HB5X 2O50A 3JQ8A 4BNVA 1ZIDA 3GMDA 3P2OA 4NBWA 2WTBA 4WLOA 4L4XA 3OJFA 3ZV5A 2D1YA 2HKIA 1KVUA 1EZ4A 3FSRA 4DYDA 4M8SA 4NNJA 3LF2A 1MUUA 3GRPA 4AICA 1R0SA 5DBFA 3GDFA 5DDIP 4PVDA 3KSUA 3Q2KA 1CIVA 1O95A 1OMOA 3WGOA 2VWHA 1ISFA 3MJSA 1F12A 1ZNQO 1L7DA 2PR2A 1HTBA 3FNEA 4OH1A 4AJEA 4CM4B 1VL8A 1Z6ZA 4PG8A 4I8XA 4JBHA 2DUUA 3ITDA 5CEJA 4S1VA 4EEXA 5LCXA 3WSVA 1GZ6A 1HE5A 3DZFA 4B8ZA 1P44A 1UDAA 4RPGA 5B37A 5JYEA 4GX2A 1P33A 4IIVA 3ZV6A 3TOZA 5ICSA 2G1UA 1QLJA 1TI7A 3GHYA 2X0RA 3L9WA 3LC1O 5BT9A 1XQ1A 1LEHA 1ZXBA 2IEDA 3ROKA 3K2EA 3ZV4A 3IJRA 5TNXA 4IMRA 1SOVA 3GNQA 1DAOA 1QYVA 1RM4A 3D3EA 3QQPA 2IRWA 4CMCA 1WDKA 3INTA 2NTNA 1WP4A 2OL4A 4FB5A 4I5DA 1B8PA 3DL2A 3F1LA 4IINA 1A5ZA 3PGXA 3EGOA 4UEOA 4GSLA 4ZRMA 1DOHA 4XEHA 1IYZA 2HMVA 3NEPX 2WM3A 3G1UA 4LRTB 3IS3A 2GZ3A 2C07A 2QRJA 2ZCVA 3AM4A 3HN7A 3PHJA 1PJBA 1ENPA 1UZNA 5K6AC 3RIHA 2Q2VA 3A1NA 4CMKA 4WLFA 2FP4A 3AU8A 4UUPA 4Z3DA 2Q46A 5L51A 1EK5A 1LDBA 3D3WA 3SX2A 1I01A 1LSJA 1OC4A 4YQZA 2ZJ0A 1I2CA 4BMNA 3JYQA 3KHUA 3RC9A 4CL8A 5JY1A 3WMWA 4E32A 2ZQYA 1UH5A 3OJ0A 5G4LA 1QORA 3MWEB 4BNGA 4XYEA 1PSDA 1S7CA 2IXAA 3AI2A 4QEDA 2NNLD 2X0IA 2ZTUA 2OP0A 1DIRA 3RBZA 2BFAA 3UGKA 1NVMB 2EP7A 1N1EA 2HMTA 2EHDA 4BO4A 4MVJF 3RVDA 1IZ9A 3WJAA 1R0KA 1AUPA 3ONFA 1KVQA 4INAA 3JD2A 1JW9B 4AJPA 5A9SA 3DO5A 1NWHA 1HWYA 2PKQO 4J4BA 2VWQA 4Y9DA 2NTVA 1XSEA 2B4RO 1PS9A 8ADHA 4BNYA 1V3VA 2VZ0A 3ZHXA 1Q7CA 4UUNA 1PGOA 1ISMA 2Y1DA 3OMLA 2HLPA 3LT1A 4EGFA 1RWBA 3S2EA 3TL3A 1ORRA 2PGJA 1DJNA 2Q99A 3S2IA 2JD1A 4M49A 1V8BA 2YHIA 1ULSA 3ZU4A 5C3MA 4WECA 1L7EA 2FPIA 5JS6A 4BO9A 3ZWCA 1A4IA 1GQ2A 1EVIA 1EUDA 1GEEA 3K31A 4YCAA 3B70A 4R69A 3PYMA 3FHLA 4OQYA 2XOXA 1M75A 4BO7A 1X1EA 3WFJA 1LUAA 1UAGA 1N2SA 3CTMA 3DOCA 3F47A 4BNTA 1I0ZA 4IS3A 2WJPA 4FFLA 2GASA 3JQGB 3PRJA 3WQSB 3QP9A 2O3JA 1V35A 3P2YA 3I9JA 1F06A 2JHFA 1E5QA 1VJTA 4S3MA 1PJCA 3GNTA 5DCYA 4YDRA 4Y6PA 1HE4A 3PIIA 4N54A 2A94A 1F8GA 4NU6A 1E92A 2YJZA 4EEZA 3FR8A 4WLVA 2RHRA 2BGLA 1AHHA 4ND5A 5TT1A 2XXBA 1NVTA 4CV1A 2FZEA 5TIIA 1CEQA 5ITVA 2WYUA 4WASA 1U3TA 1A4UA 1P0CA 3D64A 2NLOA 4D46A 3H7AA 1VKOA 4XX0A 3OP4A 1B8UA 1SNYA 1K3TA 1KIFA 4Y6RA 4FFOA 4RVUA 2QZ9A 3VH4A 4NBUA 2NWQA 1PQWA 1YE3A 4IMPA 3EVTA 4D42A 3FF4A 2DQ4A 3BMOA 3ZWOA 2DUWA 2VOEA 3F4BA 1TA4A 4TROA 3FRJA 4L73A 4YAEA 4MKZA 1FK8A 4BVAA 1B8VA 5I9LA 3ZNNA 1U2DA 3TOXA 5A03A 3UCFA 2UDPA 1C0LA 2EP5A 1SZJG 4I5FA 4JGBA 4CMBA 3ST7A 1LA2A 2EEZA 2D4AA 3GC6A 3TZQA 1GZ3A 3A06A 4LN1A 4JX8A 3PHHA 4R1UA 4IY1A 3N74A 3F6YA 5HWSA 1SB8A 4U0JA 4EDFA 4FJ2A 4CLRA 5IZCA 1NFFA 2E4AA 2VCYA 1H2HA 1WZEA 2DBZA 5GMOA 4YJGA 1T2CA 5T6BA 3I9MA 1FDVA 5GY7A 4PLHA 3PIDA 1LSUA 3WNVA 3PVZA 3ONEA 4JN6B 2GO1A 4B4VA 4B3HA 3K8ZA 4TRRA 3EZYA 2QW8A 2O3SA 2H6EA 1V9LA 3NTOA 2RAFA 2Y99A 1JLLA 4QSMA 4NBRA 4TKMA 1P1KA 3TRIA 3R6DA 5KOIA 3TWOA 1KEVA 1EUZA 1GV0A 2VTEA 3OICA 2V65A 5H82A 4GKVA 2VRCA 4WOJA 4DQUA 4BO6A 1YKFA 4A0SA 4BNJA 4BNUA 4GWKA 4E21A 3ORFA 3GGPA 4J1SA 4AJJA 5JC8A 2NSDA 1YWGO 2X58A 3E5MA 1UXJA 4YJFB 3MTJA 4CMEA 4AJLA 1DAPA 3C24A 1X14A 3EVNA 4E0BA 4BGUA 5KIAA 1X1TA 1GYRA 4L76A 4OQZA 3AOEA 1Q0HA 4L8VA 3P19A 1WMBA 3Q3CA 1IULA 1VKNA 2B37A 2BHLA 4NK4A 4QX6A 3TQHA 4C7JA 5MDHA 1MG0A 3W1VA 5GZ1A 2FR0A 3E03A 3GN2A 3SVTA 3DBHB 1MXFA 2EJWA 1U2GA 4HY3A 4ALJA 4YAKA 1M76A 3FTPA 4WJZA 1ARZA 4YT2A 2BI8A 2VRCD 2AHRA 3RJ5A 4CMHA 5AOVA 1KC1A 4RV9A 4Z0HO 3E9NA 1NAIA 1HDRA 4MP6A 4AJ2A 2VHWA 3M2PA 3DZJA 4ALNA 4BO3A 4MP8A 4BQRA 5F21A 1YRLA 1ZKMA 1HXHA 2HRZA 2JFHA 4XWYA 1F17A 3ETDA 3GAZA 2JCXA 3X2FA 3ZWVA 4XYGA 4L4RA 3NDRA 3ZNQA 1OZAA 2C5EA 2GN8A 5CHEA 1PS0A 3K96A 4P8RA 4RF2A 4EUHA 2I65A 3H3JA 4WNIA 3O8QA 4OXNA 3WTCA 5KKAA 4XRGA 5DNAA 3AOGA 4W4TA 4ZVVA 2X5JO 1LU9A 1XHLA 4DBVO 1VJ0A 3BTOA 2DBVO 4BNKA 2WSBA 5B4VA 3K30A 3GR6A 3MEQA 2I76A 1UAYA 2WE8A 3NUGA 5G0SA 5KNLA 4KP7A 5BNTA 3NJ4A 4IXTA 2VQ3A 5FFFA 1DRVA 1VI2A 1B0AA 1HYGA 1NPTO 1PU2A 2NQ8A 3VPXA 4JROA 2O3TA 5L7WA 3A14A 3DAGA 5KWEA 5BNFA 4CJXA 4J2HA 4GGPA 4XR4A 3WB9A 2DPHA 4RZHA 2X8LA 3E1KA 4YB8A 1ISHA 2ILTA 4XB2A 4JJFA 1NR7A 2HJSA 2AQIA 3D0OA 3BA1A 3PLRA 2CFCA 4Q9NA 3B1JA 1A7KA 3NTRA 4P4GA 3D4PA 4DPMA 4PRLA 1I36A 4RF5A 3WWYA 1DRUA 5JE8A 2YHUA 4YVFA 4R51A 1Q0LA 1XEAA 2IDZA 3VVBA 4FGSA 2O3QA 3F9IA 3QVXA 1GYQA 1PGNA 2C7GA 3KUXA 4BGVA 1E1KA 1D8AA 1WXDA 5JXWA 4RLSA 5G4KB 4GMGA 5HM8A 1Y8RA 3OEWA 2VUUA 3AM3A 3V5NA 2JHGA 3GG9A 1DPGA 1FDSA 1ZMOA 5B4TA 2Z95A 1EDOA 2X22A 4B79A 1KY5A 3GOHA 2O7SA 3HJAA 5IXSA 4RF4A 4DLAA 4WKGA 3PGJA 4KMSA 2AQ8A 1DIBA 1YDWA 1JA9A 1OI7A 1A27A 2D5AA 4CMIA 4I08A 1BXGB 5KJFA 4KUHA 4CV3A 4BIIA 2PD3A 2VWGA 1P9LA 1YS4A 1H2BA 1KBZA 1U4SA 1K89A 2WDZA 3E48A 4II2A 5LDGA 5T57A 3PDUA 3RSHA 5L53A 1H6CA 1WZIA 2PLAA 1U5AA 2W2KA 3O03A 1B3RA 1CYDA 2P9GA 3ETEA 3U4IA 3UAGA 5A9RA 4U6SA 1UJMA 1KEWA 1RM5A 2CUKA 4XA8A 4OSOA 3U62A 3C8MA 4K6CA 5JSFA 1LSSA 3JCZA 4E5PA 4A5OA 3HDYA 4PLPA 1E0DA 3BMCA 3IQDB 3LDHA 3I5MA 3L07A 3R3SA 3F5SA 4UUMA 2O3UA 1PL6A 1U3VA 2O48X 4MVJI 3C1TA 1LDNA 2V6GA 1AGNA 3QJ5A 4FFMA 2DU8A 4OIMA 3G1TA 1IB6A 2OBYA 4IDDA 2VHXA 3GVHA 4CODB 4JBGA 2BGMA 4TRMA 4CLXA 3OFSA 4CMEC 1C3VA 2Z1MA 2B69A 2OGUA 4YT4A 1I8TA 3TDKA 1YDEA 4R3WA 4B7XA 1FDWA 1DC6A 4YJHB 6LDHA 3LZ6A 4TVOA 5I7VA 3E8XA 3OA0A 3V2HA 3GLQA 5DP1A 3I9KA 1VM6A 4WOKA 4ZU3A 1XIVA 4GQAA 4PGFA 4UAGA 1UXHA 4R4JA 3L77A 5L3ZA 1C1XB 2OZPA 2BFPA 2Q45A 3UVEA 4ZICA
chains in the Genus database with same CATH superfamily
1MC5A 2OFFA 4R3NA 3TCKA 2R1ZA 3EXG1 3MG9A 3SZUA 3VTAA 3NOVA 1NI4B 3PNSA 3Q10A 3DS8A 4JJ6A 3O7WA 1D6NA 1N6NA 1LPPA 1PNOA 1OX4B 2OHXA 2ON6A 3CLUC 1JPNA 8LDHA 4MWBA 5EIXA 3P52A 2OCIA 1IM5A 4G1BA 1RRMA 2ZAOA 3FNBA 4ZVLA 3UWPA 4KACA 3UJBA 3I1FA 5E6RA 3OTWA 3NKVA 3AWIA 2ZBVA 2LR0A 1OLXB 3Q7IA 2VS1A 3H84A 3FPEA 3CRNA 4KO1S 1JLSA 4IDQA 2AZDA 4PXYA 4Z8YA 1MH1A 3CCFA 3WV5A 3IUPA 2C42A 4IOJA 4YMSA 1LTKA 3EB9A 3MGBA 2Q4RA 5L4LA 2YWCA 2G6BA 4K9NA 1SO8A 1XQVA 2FU5C 4RD4A 3NHYA 4QQRA 3TZKA 3GJ5A 4MKRA 2EDCA 5MN4A 3LKBA 2YZKA 5I3ZA 2R6JA 2BFMA 3GRZA 1KI6A 4TWRA 5TGDA 1O9BA 2WQZA 5FX2A 2Z6AA 2JLQA 2VVTA 5CFRA 1YVPA 1PL0A 3D4LA 3BZBA 4QTUB 4F8JA 2PRYA 3FPAA 4B0OA 3H4IA 5KAPA 1NNEA 4ND7A 3UJDA 3EXIB 5TDHA 2XF8A 1VG0B 2ZS9A 4WLUA 3C15C 2I5PO 3P26A 1OC2A 4PRZA 4Y0VA 3ER9A 3OTIA 3ONDA 4GH5A 4AJ1A 1LPBB 3TPCA 4M1SA 3QV2A 1CR1A 1MJNA 4HB2A 4ETWA 1XZLA 3EIUA 3NXSA 4OQNA 5B57C 3LFHA 3EZGA 1J99A 4JEHA 5JZBA 2W8BA 2ZB8A 4IHKA 3K9FC 3BDAA 1DAKA 5FPPA 1OH5A 1A1VA 2FG5A 3T6KA 1U2QA 4F8EA 4C0HA 1H42A 3C16C 3AUXA 4TYQA 4M9RA 2XOKA 4OI2A 1DEHA 3Q7EA 3KT8A 3GZNB 4UNSA 4ZOLB 2XGJA 3WHKA 1JIXA 5JVDA 3TB4A 3TZHA 1RNLA 1LC3A 3PRHA 5TGTA 1XYGA 3CUWA 1GCUA 1BW9B 1ZUHA 3CGWA 4MRMB 4JYMA 2HQSA 3B7PA 3Q87B 4O6VA 5EMMA 2PIDA 4YMLA 1SZCA 1GTMA 2ODQA 2FH5B 5I9NA 4JVMA 2AW3A 3PP8A 3R7NA 1X7GA 1F2TA 4LYJA 2DFPA 1P1FA 4KFUA 5L4NA 5T4EA 4QQNA 4IIYA 3UB4A 1ZG3A 1CDZA 5COBA 4I8DA 1U1FA 2CKMA 3DYBA 4R7GA 3VPHA 5KKNB 2JKYA 2V7QD 1UAAA 1CU1A 1JE1A 3HO6A 3EWNA 3WK7A 1J1ZA 1NYTA 2CJYA 5DXFA 2AN9A 1KVSA 1XXHA 2QTAA 3CT6A 2W2LA 3S2ZA 2C61A 4CDMA 4OYLA 2H5LA 3Q98A 2PMWB 1BEEA 2EJTA 5AWFC 1N5KA 4DA6A 2BM1A 2C9MA 3DXFA 3LVRE 3R6WA 3U81A 3U61B 2PKQP 3BFKA 3K9WA 2B1QA 4YCMA 4F04A 3QVGA 4HNTA 1PR4A 1SD2A 4AO7A 4IDBA 2HQBA 2NO0A 2A5YB 4UASA 4YCDA 5DBGA 2YY5A 4YI5A 3ZEIA 4CKZA 3U19A 1K63A 3QOWA 3LNTA 1IFXA 4I9NA 3P9KA 4WJKB 2AZMA 3DONA 1JDNA 2X5KO 1AZSC 1SBHA 4RHTA 1QFJA 2BR4A 5AW4A 3CEMA 3HLYA 2V7GA 4KE6A 3S55A 3VZPA 3WLNA 5AM3A 5DGHA 1B26A 5T3UA 4NBTA 1UJ4A 3K6SB 1EZZA 2NP7A 1DKUA 1EVEA 3GXOA 4C43A 3CLTD 4J1TC 1YTLA 4HAVA 2EERA 5AK0A 4E1AA 5EJEA 2O8FA 3BMCB 4HEA6 2A14A 5DLDA 1Z7BA 4K9DA 4J6EA 3DPSA 2AFRA 3NHPA 4CLRB 4FOTA 4IDCA 1K3FA 1VB5A 4Y9SA 5F23A 1VDZA 3QBJA 2BZ1A 3E3AA 4FZRA 4LHZA 3PLAE 3CFYA 1C1XA 4HGYA 5JO9A 5K3CA 2Z2YA 1P4RA 3PVSA 3LT2A 2MYNA 4PQRA 1ODFA 5GP1A 4FNAA 1SQSA 721PA 2BMJA 1DBVO 4H6XA 1A8QA 3RO7A 3VOTA 3G2IA 3V97A 3H2HA 2CEKA 3CC8A 3EIFA 4LK3A 4UTVA 2IY8A 2WYHA 3BGSA 1XRRA 2J0UA 5E9QA 4YQEA 3UAOA 2F1HA 2DPYA 1XC7A 3GT0A 1SOWA 2Z09A 2XYRA 1KI4A 4ZJZA 5JZOA 1P1IA 4GO1A 5C8YF 4RSRA 2NM0A 4NU5A 1IBKB 3AJEA 2GLXA 4QXMA 3S68A 4PAWA 2QTVB 4PFKA 4ND3A 4N01A 3A4NA 3ZG6A 2HCRA 1Q50A 1CEYA 3DXXA 2GN2A 3HVJA 1CXZA 1L8QA 2YWJA 4GLOA 5ES4B 3OKCA 3QEMB 4K6GA 3IXLA 2WWFA 2IKSA 1TVMA 2V1UA 4IXDA 5IAJA 1LJ8A 4QL3A 4FGUA 4JDPA 2ZU0C 2OT3B 4JBIA 4OQDA 4PZPA 4KJXA 3K0EA 3NETA 4HZUB 1Q83A 1PWZA 4JKOA 4X7RA 4D79A 2AFHA 1YUNA 4BJ1A 1DHRA 1T35A 2UAGA 3NC4A 4BEJA 3KK0A 1DI0A 1KDRA 1E5TA 4OCZA 2B5VA 1WNTA 2C29D 2D3TA 2G71A 3L6DA 4RZ2A 4HDNB 5CAEB 4MAMA 5EVJA 3LT5A 1SOAA 4L8YA 3B1YA 4HUJA 4IIDA 4AFNA 3NPMA 2E87A 3KXDA 3UZUA 5CEEA 4KHPB 2X7HA 1ZCAA 3GK3A 2CLLB 4RQBA 4X1OA 4WXPA 3V8NA 3UPTA 1OB5A 3R0ZA 2VZEA 1T5BA 3RTAA 3TZBA 2P77A 2UYYA 3A6KA 3G1WA 3GPCA 5DI9A 3DWFA 4REQA 1JI0A 3LAWA 4FEYA 2RH8A 4FYYA 3R76A 3U7QA 1KZ1A 4QBKA 2YY6A 1TA0A 1L5WA 1I9GA 2UZ3A 2UYCA 3RHFA 1EK6A 4MMYB 1D2HA 1MX9A 3CPSA 3FWKA 1N7JA 3OPVA 2R9VA 3B89A 1JB1A 4GOND 2IU4A 4BLQA 4KO8A 5DCWA 1N2CE 4UMEA 3IGFA 4IJUA 3ND8A 3IKTA 4LRYA 4WVFA 1H93A 1BQ3A 1GHTA 1EQAA 2UZ4A 1XWFA 3QVOA 4ZCIA 2UUPA 4GLLA 4Y6SA 1SBQA 2OXFA 1AKUA 1H5NA 3H9CA 2QLFA 2WU3A 1M2JA 2VHCA 5D2CA 3MS2A 3SFVA 3OQJA 4Y2JA 1EWTA 1HETA 2OILA 2O2CA 1T1SA 2R62A 3NVDA 4JOQA 1I24A 1JV2B 4KV7A 4CUZA 5LYJF 2OYCA 4AI6A 2P9HA 1TOAA 4R1LA 2YZGA 1RYBA 3M1YA 3X43A 5CG1A 3UYLA 5E9JA 2JFPA 1ZICA 2X4GA 3PL5A 5E4YA 4BMYA 4RK6A 4WZBE 3ZVMA 2QNRA 2C3MA 4EUKA 1G3UA 1R7RA 2GGSA 3K1YA 2XA9A 4YBRA 4LXIA 1AO3A 3LUDA 5CT6A 4YHBA 1WTCA 4K40A 1GZ5A 4EQ6A 2D1QA 2GJ4A 3JQAA 2JKZA 1GQQA 5EJ6A 2O6LA 4S0XA 2EU8A 3LW8A 1NMYA 4CR6A 1ZNYA 3X2EA 1OGJA 1M2OB 3OFKA 2DHEA 4GYWA 4N5MA 1Y7HA 2FPGA 5EWLB 2EGUA 5BSEA 4CEJA 1L7MA 1JDTA 1SU4A 2UZ1A 1JKFA 3LHIA 1I6LA 2B9VA 4TGLA 4WLEA 2YV4A 3GWZA 2GVDC 3U3XA 4PVCA 4EFKA 3KQKA 1I4OA 3RK1A 5DNUA 1KO4A 2KQUA 3WL6A 1PEKE 3RWMB 3BA6A 3HV2A 2VDWB 1WLYA 4Q21A 4ESOA 3BMQB 1NQTA 2X8BA 4K7JA 4I4IA 4B3JA 4X92A 2NU6A 3H7IA 2GM4A 3N7TA 3E9MA 3B3FA 4RH0A 2A5FA 1N78A 5H3LA 4B0PA 5KX5B 3MWLA 3ZDXB 2DTEA 2POCA 4Y2RA 3K9QO 2EBFX 4Q1VA 1N2BA 1CUWA 3QFCA 3G5AA 4YXFA 1WDWB 2D8MA 1EM8B 1XELA 3ITEA 2HMSA 4RL6A 5JU6A 4OMFG 5LYJA 4KRGA 3DKIA 1T4BA 4FD2A 4DC9A 1M0EA 4JR2A 4N6OA 2RE8A 1BKSB 5IEBA 5KO2A 3AUFA 3BWBA 3HB4X 3LCVB 5K0TA 3KYCB 1ZAYA 2OBLA 2O7RA 1BC5A 1DC4A 1JQJC 2J7PD 3BRWA 4U2BA 1BMFA 1W85B 2N47A 3SDSA 4UBLA 3UJAA 1GDTA 1JSLA 3J7TA 4C6TB 4ZREA 3KEGA 3HP4A 4B7UA 3P0JA 1JFLA 4HK4A 1E7RA 4MI9A 5EEGA 3NWBA 5JD3A 4TVKA 1RRPA 1CJMA 2HPVA 3PEFA 2WVHA 4OQMA 2F3PA 2ZJ7A 1WQ1R 5SY9A 3RBVA 4D96A 1XQ6A 4N8EA 2DOKA 5FHQA 3CKYA 3OURA 3WLSA 5LZ8A 1C50A 2IY9A 5EPOA 2H9IA 5ERGB 1YC2A 5BSGA 5E6UB 4Q4LA 1BMQA 5EIWA 3ZXYA 1NP3A 2ATVA 2BGKA 2NADA 2YINC 1YCFA 3LNCA 6GPBA 3EQ7A 4BKRA 5JLJA 3TMAA 3TF5A 3ROGA 1DIGA 1GLVA 2BFNA 2XNDA 3LHSA 3GRUA 1JTFA 1C4WA 4PBRA 3UJCA 1A9XA 5DHAA 1PBNA 5BSWA 3EDMA 5I4KA 2H06A 2JC3A 3LQ1A 2HLDA 3MHPA 4H2DA 1B43A 1QHXA 1WKVA 2GZAA 2Q1YA 3ENWA 2P35A 4A2CA 1SD1A 4G01B 3LZDA 4YAJA 2P2YA 2V4MA 4E2FA 4C7OB 2C9ZA 2ZI3A 4A10A 4JT8A 2COEA 2B83A 3C5EA 2G88A 4B35A 4NL4H 3IDFA 4PYIA 3EGXB 2IXTA 4Z4QA 1N5MA 2W2VA 5EUCA 1Q3KA 3GA7A 2HWUA 2PXXA 1UUFA 3OT1B 1PFQA 1NURA 2PUWA 4HAXA 3RU3A 1GAJA 4D7AA 3U7QB 4ETMA 4LF4B 2NQTA 5CLGA 5JDCC 1RJWA 3DTNA 9GPBA 4COOA 5I7SA 1W49A 4FE3A 4KNYA 2VXCA 3GVXA 4P3KA 4L5CA 3QKWA 4IJVA 3VNBA 3FUTA 1GG9A 3B6EA 1RMQA 4W6QA 4MGHA 2NU9B 4QT4A 3I76A 1HRKA 4Q7JB 2J5QA 2Q4TA 4QUEA 4YP0A 2FOIA 2IVZA 1FP1D 4PN3A 1EUDB 1N5IA 4RBNA 4HAYA 1AU9A 1IN8A 4TX1A 3BWDD 3UK7A 4N48A 1CIJA 2JJQA 1LLCA 2W6PA 1Y48E 1HFJA 2JZNA 3B1FA 3PXUA 4KXFB 2X19A 3UGTA 2QBYB 1CVRA 1DBQA 3OJLA 3N1UA 4W7SA 2XB9A 5DBHX 4QUBA 3W6PA 4BTLA 4LX8A 3VR1A 2JJMA 2JGAA 3ITKA 4GYJA 4U02A 1N2GA 2GSDA 2CBZA 1EIWA 3A31A 2IGBA 1ZRMA 4LX0A 2NXNA 3B1KA 4QYIB 2WWYA 4XEUA 4J75A 1E3WB 3DMNA 2X8JA 3RIYA 4YO8A 5G40A 4D80A 4D41A 1DKMA 1C9DB 4ZVKA 1B2LA 4FLMA 4YACA 2QM8A 1E9SA 1YO6A 3OECA 5TS2A 1EFDN 4YT5A 5EUQB 1V3QE 4BC1A 4DWWA 2Q9BA 4KNWA 4LEIA 5FOUA 5HG0A 3JD1A 2B5WA 2A92A 4PLYA 4CKBA 3HUDA 4R7TA 3MTGA 4J2OA 4F2GA 2XCRB 1GL6A 2PO7A 5CA0F 1HQCA 1SG6A 3IP8A 1D1QA 1QIEA 4D8VA 4B47A 2P4QA 3MA0A 5CH3A 4P0QB 5E3HA 3AK4A 3PC7A 2DVMA 1FJXA 3FSEA 1ZW1A 121PA 2R6FA 3H11A 3H97A 3QA9A 1XGKA 2IYPA 5F1KA 5BMOA 3M9LA 1DPFA 3CH5A 3O3NB 4EG8A 3VYTB 1QGZA 5C32A 4YCLA 5IVPA 3VU3A 3FVVA 3RUCA 4IDFA 1B6GA 2HCTA 2IYOA 3AF2A 3VC1A 4IKOA 1QIJA 4P22A 1ZC4A 3MWYW 5KNBA 1P7ZA 4DVJA 1PEYA 1B7GO 3MZ0A 4ND2A 1EH5A 1ONSA 4I5EA 1PZMA 3OPYI 4R54A 2C04A 3QY9A 3A6LA 3TB6A 4ZVPA 1Y6FA 4ZYYA 3JQ6A 4R9NA 2WYOA 4F4CA 4YJFA 2ZJOA 3ME5A 3GJ3A 3BEOA 3W2GA 1M34B 2WU4A 4LYGA 1W30A 3FTDA 4OFZA 3CF4A 1F51E 5JTUA 4JK3A 2CF6A 1YTUA 1W4ZA 1LWOA 5J4LA 1XALA 4UU0A 4GYKA 4L74A 1P29A 4ER3A 3HYLA 1C7EA 2EG9A 5BVGA 3QE3A 3PT5A 4GEGA 1JDSA 4L0CA 5NULA 3UT5B 4EECA 5K0GA 3FPBA 3EXHA 1USUA 3UOWA 2C4VA 1G60A 1Z8DA 3FRHA 4FYMA 4K3VA 3WRXA 2BMEA 1GGJA 1L7VC 3BERA 2IPLA 5HX7A 4PO9A 3V3KA 4H7DA 1L8OA 2IV7A 3D4NA 3FDJA 3LLCA 3RBXA 7REQB 3DV0B 2JBAA 2GRJA 3P9CA 1YJQA 2R5WA 2FR8A 1KU6A 5DHPA 4RQTA 1JKJA 4C1NA 2O2IA 3GRYA 3WIOA 1KETA 2GJ9A 3UB3A 4CM6A 3U44B 2M6LA 2LZ0A 3EVCA 5IXJA 1VSBA 3TTYA 5TQVA 2ZWAA 5CU7A 3F6SA 3NKLA 1H9AA 3U1VA 4UAJA 4BFSA 4LXHA 1CUBA 4E94A 1P1HA 1NGSA 1W8IA 2V03A 2V45A 2FLWA 3OSUA 4W9RA 3I4CA 5JCOA 1ZVVA 2GEKA 3RSQA 4KQ6A 1U90A 3G5LA 5BV0A 3PNQA 4UQPA 3TQCA 2O14A 5EMJA 1SAYA 4IH9A 5FA8A 2DH5A 3GLFA 1JHPA 3AUKA 2YUTA 4JC8A 3RWBA 3G85A 3BTUA 3O4JA 5SZIA 4QVKA 2RGCA 2BGNA 2GEDA 4TS9A 1AZLA 1E3DA 1P0QA 3DBLA 3O1JC 1DJOA 1UBTS 3B8EA 4JIGA 4L4UA 1T2UA 3LT0A 1AQYA 4HWOA 4LOLA 3NVKI 4NDAA 2VTKA 2YXBA 1FMTA 4CEIB 1K9SA 1NPDA 5BOSB 4WTOA 2YX1A 2HT6A 4Y2XA 1DOZA 3OY7A 2JFYA 4XOUA 2PS1A 5EIHA 3PD7A 4C4ZA 4F5ZA 4CEJB 3GEHA 1SUIA 1M72A 1N0HA 4I1UA 4BKPA 3KOUA 2DZDA 2V6FA 2QM7A 2RGDA 5JH7F 4CQNA 2GAJA 3QFFA 1TIBA 2KI5A 3ELBA 1QMGA 3SS9X 3FZQA 3I0NA 4HNSA 3TQQA 1I2DA 4DCTA 1Z4MA 3AHHA 2DP4E 2PVSA 4G9EA 2BGJA 3A6EA 2R8XA 1RKQA 1E3JA 3BB3A 1FQOA 5IXYA 1WCYA 4U5XA 1VLJA 2LE0A 4HRXA 1KK0A 1ESCA 3OZVA 4RGBA 3A9TA 4Q3NA 1WNFA 5FOWA 1YASA 4CCWA 2Q50A 1M9NA 2PTHA 4AKTA 4R2WA 5LYJB 4MS3A 1V25A 2QG6A 3ZI4A 3DFZA 1OYOA 1YD7A 4RVOA 4C7MA 5AI9A 1PR9A 3E9CA 2H1HA 4JT9A 4EHNA 4RD1A 2QD5A 3FAZA 4I4CA 3WB2A 1EVYA 3AO0B 5TB5A 1Q1AA 3QELB 3WLEA 3FOFC 5KAMA 5THKA 1EFKA 1F1BA 2FWMX 5C4GB 3DZGA 3MHTA 5BUZA 4B6OA 1TYEB 1G291 2A9FA 4EHAA 3QVUA 3PCRB 3T3GA 2O5CA 2ZIFA 5CPFA 3VVLA 5JAUA 4JXXA 1KMHB 1OSNA 3RF6A 4AN4A 4YRAA 3KAKA 3TXYA 3H1GA 4KIGA 2F62A 4O1IA 4YJGB 3RSLA 4EA8A 1U0TA 4X45A 1IATA 3O9MA 4NU0A 1V8DA 3FG9A 3KDAA 5E38A 3BFVA 2IU0A 2WFZA 1GKIA 1EJ6A 4RD0A 4BVLA 4EQZA 4B3MB 1E9CA 2BE9A 4RKQA 3HE3A 2G9RA 3U5TA 3I01A 2HL6A 2LVBA 5BN1A 3CSDA 3QWIA 5A05A 5FADA 4YLYA 4ZXPA 3VDMA 4NK5A 3HKBB 3CRMA 3PPVA 4RDXA 1HDXA 2WHPB 1CERA 3N2KA 4KL8S 4TN1A 4AF7A 5AVYA 1OVGA 4BY9E 3QH4A 1L2TA 1E3SA 2ZUDA 1M1ZA 3MELA 1MPXA 3OWXA 1POWA 3TE6A 2CXPA 3ON5A 3QPUA 3OE7D 4OM7A 4Y1FA 4F3KA 1YQDA 3SHFA 1PKXA 5MGBA 3EG9A 2WYVA 3OQ6A 3PJFA 3KOMA 4MITA 1Q1GA 1RI5A 1TVKA 4OFBA 4E2WA 4KQ2A 1KQNA 2X0FA 3HU3A 3TXAA 4A7PA 2QL6A 4YT8A 3SR0A 5IS2A 3MF4A 2VT3A 4YGXB 1EVQA 1B1CA 3O0TA 5F5NA 2W4MA 1RZUA 3D4IA 2BP7B 3OP1A 2G82A 1Z73A 2ZS8A 1U65A 3GVPA 3NT4A 2G83A 3I39X 2QN8A 1EGHA 1OPRA 2O5VA 4GR5A 4JL6A 4PZAA 3R4VA 4RZQA 5I45A 3KAPA 3HCBA 1U5BA 4V0OA 1IN4A 4MRRA 3BSSA 4FN5A 1WBJB 2QAGC 1ZIOA 3AU9A 1FYXA 4K9OA 2PNJA 4OX9Y 3GYGA 4GLJA 1LY1A 4UHKA 4DCPA 1N8TA 1W0CA 4O02B 4EWLA 1O9HA 2JBAB 3FKSD 3MFQA 4DM7A 1GG2A 4BMDA 3MOIA 2ZBPA 5I9MA 3HKEB 4Q48A 3JAKA 4ZGWA 3NIFB 4L6IA 5KTKA 2Z5FA 1STOA 5JSKA 4LMAA 2BCEA 4XD7A 1Z07A 2W98A 4L4SA 1QRRA 4ZCSA 1ACJA 2DE0X 2V1XA 1ZH4A 2UVQA 5TPWB 5TMBA 4BPRA 4DB2A 4KSYA 2A5LA 1W59A 2ONKA 1RQNA 3EQ9A 3LTEA 3EODA 4BZXA 1EQ2A 3UMMA 3OBBA 1KDZA 4JNKA 4ITUA 2XKKA 1L5SA 4J9VA 3EHDA 4KTTE 2XCIA 1LLQA 1HFWA 3I8XA 4JCOA 2BJVA 3JARA 5ALRA 5IWAB 4EY6A 1FP6A 2GPTA 2XDWA 4CLEA 3LVFO 1VLVA 1FYFA 4F97A 1COWA 4FOOA 4OKNA 4URZR 3TLZA 4IH4A 2NAFA 3FHCB 5CR9A 3WK9A 1FSZA 2EWMA 2PZEA 3H9GA 3ZUPA 4Q1FA 4ZMSA 4M1OA 1IC6A 4LNUA 5LXTB 3I72A 1SOMA 1D0VA 1BHSA 3L1HA 4J7CA 3RFXA 4DYHA 4EF4A 1SUAA 1Q1QA 4MYRA 5J47A 1DT3A 2H9YA 4LXXA 3ESZA 3QYPA 4YN3A 4IHJA 1EBBA 2VAVA 1J21A 1T1EA 5ULLA 3RRXA 1J7JA 4AC9A 4B31A 3N58A 1HDZA 1R9GA 1NNSA 2CVPA 2JIMA 4F1KA 5A4MS 3LRTA 1UMDB 1I33A 1QKIA 2WD8A 4FP9A 4BBPA 3V48A 4EDHA 5M7EA 4M53A 4PYRA 5DN6A 4EVIA 1JQBA 1ITZA 2QUAA 1SVLA 2L69A 3BZUA 3ZCTA 3FA2A 4NATA 2ZSKA 5IPFA 1F2UB 2YJGA 4DV5B 3RK0A 3S2FA 1P6QA 2H8KA 1CRWG 1RM3A 2RK6A 2ZRBA 3TLEA 2ASEA 4YP7A 3GHHA 4CHTA 4PLWA 3JW8A 1HM5A 3UAZA 3DLCA 3DZIA 3H8JA 4BN5A 5DX8A 3QMMA 2QAGB 1PZEA 1L7PA 2AJDA 2J6HA 2WLSA 4X8OA 2O20A 2VZ9A 1IL0A 1G2OA 4GLFA 4MINA 4EARA 4CZ2A 1RRVA 1U0RA 2H29A 2JHAA 5CW2A 621PA 3FNFA 3R77A 5KNDA 3R6GA 2C7OA 2R1VB 4MZDA 1P2FA 2Y1CA 2OP1A 3AM5A 5CX1A 4ZQGA 6PFKA 4LJKA 3WLQA 1W9HA 1BH2A 3NTUA 2AYXA 1SIUA 3KWJA 1VXOA 1WL8A 2XDQA 2BISA 3KAQA 5IAOA 1QE0A 5GWXA 1Z4KA 1IN1A 3PTZA 4HQ0A 5CVVA 5JCOC 5J2UF 1DRWA 1T2VA 2F1KA 1SZPA 3A4VA 3LQYA 3GBPA 4GM4A 5FKJA 4E5MA 2VG8A 1S02A 2E48A 3V4OA 3ETNA 5JJIA 3PWZA 2IXFA 1MB4A 4NV1A 4XDHA 2P2NA 3CINA 3OHPA 3Q5DA 4PANA 1CPYA 4KKXB 4LBZA 4PFSA 1AXGA 2CNDA 2NO9A 1ONOA 3DE1X 1KKLA 4M55A 4E51A 1ISJA 3IMFA 4BQFA 1I10A 3NJ8A 4MQFA 1ZCJA 5I4IA 1QP0A 1UBGA 3OCCA 4B76A 5HGXA 3VMMA 3V32A 1FTNA 3MJRA 3R8CA 4TZ6A 3HI6A 1XMOB 1GY8A 5IT4A 2C2HA 2F8TA 2AEEA 4M0FA 3C6YA 2B2XA 2MYPA 3K0CA 3T3NA 4TV8B 4QU5A 5J5VA 3R7AA 1FRZA 1KR5A 2RBEA 4QLAA 4C0SA 4E12A 2NX2A 4CLDA 3BILA 3HGQA 3AEKB 5CXSA 4MAFA 3DL7A 3HO8A 4RTSA 1R6UA 3I9LA 3IUNA 2QRVA 2X15A 2YWRA 4M89A 3W4JA 5A02A 4TMXA 1W1IA 4N6NA 2VF8A 1N34B 1HQDA 1V2GA 4O1HA 4V03A 3EDQA 1SBIA 1ONBA 1PT8A 2X1VA 3MWJA 1TL7C 2DKNA 2IHYA 1C0KA 3EXIA 1KBOA 2F9FA 1P81A 1K8XB 3I4LA 3O94A 4LRUA 1TIKA 3AQIA 3WX0A 4BEBA 3B12A 1X7DA 1F3LA 3JD0A 1GILA 3A9RA 1RFGE 2NNWB 8AT1A 3NAQA 1P1BA 3PFFA 4U3JA 1PAUA 5F2OA 4IQ0A 2FLVA 2X5XA 1N75A 3IT3A 5FIUA 3V7NA 4KGVA 4CR7A 5E2IA 5KX5A 3ROMA 1NZFA 3WA7A 4W5TA 2HD4A 3P8ZA 2EXXA 2PH5A 1OXUA 4RCZA 3F49S 2Z30A 3FXAA 4A0RA 1D2NA 1W52X 2P9EA 4HJRA 3VGJA 4GE3A 2I3GA 1MX1A 1L7XA 2QX8A 3ILXA 5G1OA 4YDQA 1BJTA 4RA9B 5KSOA 4QC2A 3NUZA 2B4QA 1JAIA 2ZI9A 2JG3A 1F9AA 4MVYA 4WA8A 6REQB 1TK2A 1ZRNA 2MIIA 4JQYA 4IFTA 1Q44A 2YYZA 2ECKA 2PMCA 1B1AA 1S4QA 1UFVA 2IF0A 2XYQA 4OI0A 3CVUA 1QFXA 4M6WB 3ZOZA 4DEVA 1R2QA 2JFOA 5HTOA 2J45A 1EFUA 2GRUA 4TYWA 3QYJA 2DLNA 2OQ2A 3T3MB 4AXBA 1QHSA 1ECJA 3Q8LA 2WHRA 5KJ6A 1JHZA 2FE1A 1WCIA 2IOHA 3MD0A 3ZBQA 1Z75A 1C1YA 1RZ3A 2XUGA 3FD8A 4J0JA 5T41A 4DBLC 1BO6A 4S0ZA 2XA1A 1RXIA 2UXCB 1GU0A 4Z4HA 1WY5A 4BFZA 4KMOA 4X1KB 2WMOB 3B5EA 3VU9A 3LUKA 7YASA 4GOMD 1DT5A 3CRVA 5DPMA 3HZRA 3T06B 5JZ9A 5AJZA 3JQ9A 3VPCA 5A1TA 4NQZA 3TLJA 1X38A 3IVXA 3A6FA 4JMPA 1J0CA 5CA1A 3D4OA 3R0IA 3LK7A 4NR0A 2R0QC 2A3NA 3CX4A 4KOAA 4K6FA 1V8ZA 2C2YA 4D25A 1WCXA 2Q3HA 1J7KA 1T6XA 1D2RA 1A4XA 3BN3A 1VJ1A 4CQMB 1TQ2A 4FYJA 1UADA 3GEEA 4KR2A 2PK3A 3VISA 3NBAA 5JRDS 3ADCA 4NBLA 2LGJA 2VIIA 3GARA 4WOPA 2Y1OA 1FXSA 1SXJA 2C3YA 3WYFA 5KMGA 1DXQA 2HSGA 3DL4A 4L3OA 1GP2A 3DE5X 2J5KA 3NTXA 3U7EB 3OFND 3VKUA 1N1GA 4B2IA 1N7HA 2G9QA 2G09A 3EVBA 4X5OA 4E4RA 3T4XA 4FIDA 3AR9A 3BRQA 1W94A 1M2HA 4DILA 3G49A 4EJSA 4P4NA 1CB0A 3WBFA 1SQ5A 3S27A 5G0VA 3ZYCA 3R7FA 3AM1A 4G0ZA 1EFLA 1OAKA 4JLOA 1SPXA 2V6BA 2VHEA 2VOJA 2Z43A 4TZKA 3U13A 4G9BA 4H4DA 4B32A 1D5WA 1DAMA 4KHZA 3DFKA 4GL2A 5TSDA 2ZDQA 1E1LA 4OHPA 3ENNA 3L4EA 1RYZA 3NM4A 2JVKA 2Y3IA 4KAFA 4YTEA 4JC5A 4R9SA 4FXOA 2Q28A 3MYRA 1S8OA 5TY0A 3O8QB 5B2FA 3KP1A 5LP1A 1HTWA 1S2LA 2BD0A 2YVUA 4OUDB 4Y67A 4DPLA 2Q8PA 5JNUA 3EY9A 3K09A 3AV0B 4F92B 3E0QA 1ZQ1A 5EXSA 5KC8A 1E8NA 4CLHA 2NUPB 1DLJA 4LYDA 1CD5A 2VYND 5C7IO 4MLZA 3BH7A 3NASA 4NXMB 2WABA 3SC6A 2G1AA 1BKYA 1NXTA 4MW4A 3TMYA 1QIKA 1UMCB 2WMDA 3WGNA 1UMBA 4P80A 4JI4B 1DC3A 1P7WA 2M2IA 4S1NA 2BM8A 2PU5A 3M3PA 3E27A 5ELMA 3VSAA 4FMDB 2VFAA 4IIFA 5F9HA 4ZDJA 2ZRNA 3OPNA 1Q14A 3TZ6A 2XODA 4OV6B 5JFOA 4IKEA 1QZXA 1RI1A 1JJBA 3HCDA 1LBEA 5SZKB 4Z4EA 5JEEA 2CXRA 3L0PA 5FV7A 1UODA 1ZW6A 4E03A 4QFDA 4R2KA 4UEKA 3GCWA 4MV7A 3KELA 4WQMA 1SN7A 2W83A 4X6UA 2O8CA 3EZXA 3IXMA 4PR3A 3AEQA 5FQOA 1O03A 1MO5A 5G1PA 2X2FA 4TM8A 5EQJB 2YXNA 5SV2A 1GPKA 1L4KA 4LYFA 5IHXA 1BDIA 4H18A 3V1TC 3QPCA 4N7MA 4BVBA 1FNMA 4LC9A 1Z6GA 1AKNA 3M4JA 1Q2XA 1A4RA 3QOXA 4X1YB 3IDSA 4HQ6A 1KYXA 1HDOA 1ZM4A 5A3QA 4B6SA 2FJUA 3EEOA 1T0JB 1UWCA 4HFNA 1FY2A 4JZKA 1ADJA 4KH1A 2HM7A 4WBXC 1EFHA 3K0FB 4IDGA 2AW5A 3T61A 2NO6A 4PNEA 3OZ7A 3NU1A 1G8SA 1C14A 2O2ZA 5EMHA 4AUMA 4IO1A 3A04A 4IDEA 1RU3A 4PU0A 2NU7B 3FUCA 4O2AB 4V0MA 1CFJA 2J3MA 4JJAA 2CLKB 4O0LA 2D6FA 3MW8A 2EKPA 1FCJA 2YY7A 1Q7GA 3OAAA 2G06A 2IEZA 2NACA 3NEAA 1KP9A 1JN0A 3WJ2A 3ZHCA 2XQGA 3WIVA 1F7UA 4DNOA 3RVKA 2DULA 3QMVA 2JGRA 5ITWA 3EOBI 3VU9B 1RD4A 4LVUA 5K8IA 5H59A 4IIJA 1OIXA 1AA6A 2YL2A 1IY8A 4PAGA 3CZPA 2F4VB 4WACA 4IM7A 1JIJA 3TQTA 3CQ9A 1JMYA 1YR8A 4MW6A 1AGYA 3OKPA 2QPAA 4RMNA 1OYWA 3PA6A 1ZPDA 1CR6A 3EMKA 4HDQB 5GJCA 5CFZA 2ZWMA 4FHZA 4EHBA 2VKQA 1BG6A 4R68A 1QQ5A 1XZFA 3EGCA 3ZWMA 1AHNA 5EWMA 5CHYA 1G8HA 3HCNA 1QLWA 1VL2A 5JAZA 1E20A 1UT8A 2NV6A 1SCDA 5DTIA 4DBLE 1R0WA 1QIMA 1R4MB 3G2OA 2GXSA 1NX9A 1OIWA 3OZFA 4MKHA 1HEYA 4I3HA 2D0IA 2V8OA 2D4HA 2WG2A 1IOVA 3N87A 1TGYA 4XPIB 3SQXA 1CW2B 2VJPA 1S6YA 2P7IA 4X3PA 4FD3A 3STHA 2Q3FA 3KZVA 2YVAA 3RVJA 3EPHA 1S8FA 2ZSBA 4QO8A 1U3DA 3FUXA 2WIGA 3Q5GA 4JB8A 5LIPA 5K2OA 2H5JA 2XUIA 2IYAA 2Z2JA 3HYSA 4GNRA 1P9WA 1WW2A 3KFLA 3L8YA 3U7RA 4L9WA 3WLTA 1EGVB 1TO2E 2PMDA 3NOXA 4EUFA 2B8TA 4U3JB 4J6FA 1U94A 4FVTA 3A0UA 4TUYB 4ZQBA 1L6IA 2NV2B 2ETVA 2OO3A 1A76A 1TVEA 4Y8VA 5KU7A 2I80A 1NV8A 2Y8EA 3SS8A 1N2OA 3CE6A 3I6MA 3IE0A 4E5UA 1KI7A 4ENPA 5DW0A 1GZDA 4BLTA 1TLFA 5DGIA 5KTOA 2XXAA 1Z12A 2JI9A 4IIJF 4ALKA 5JTTA 4LRWA 1WBDA 1SQGA 4KXLA 3VH2A 1UK9A 3WIBA 4M1EA 2G70A 3ENKA 4F12A 2ODPA 4TXLA 3RM3A 3K5PA 5SYNA 5JAIA 2JA2A 1COWD 1VE9A 2YV1A 3GF4A 4ZRNA 3PGA1 3A1CA 3RUIA 2QZJA 4G41A 5HDQA 5EJ2A 4GVPA 5HIKA 4P81A 1T2FA 4R8VA 1QAOA 1ZCFA 4ZOLA 5FLEX 1WDLA 5AI8A 4G09A 1JU3A 1DG9A 1Y8QA 3C5VA 2RFLA 3HBMA 3RIEA 3IDOA 2QPOA 3TLXA 4TYMA 5EP3A 4XUCA 5UKDA 1Q0ZA 3CW8X 1V3UA 2XE6A 1M2EA 4MMXB 3B48A 3A05A 3JRNA 5FI5A 4IKPA 3H99A 4V3BA 3ZWBA 3CEPB 3PT9A 4DLYA 1IEQA 1V6AA 4G0MA 3EIQA 2J46A 1WZ2A 5AJYA 1ULUA 2DPXA 1AKYA 2QJTA 3B9BA 1CQWA 1LKZA 1CQZA 1T6YA 3H1PA 3NBUA 3KTOA 4LV6A 3TVTA 2X42A 1A88A 1NVUQ 1T36A 1ADBA 2Q2QA 4M88A 4RHUA 1CETA 2RHHA 5HK8A 4PC3A 5HQ3A 1XWIA 4COKA 2CXHA 4CTMA 2XTNA 3KSRA 1BNCA 1SR8A 1JAYA 1Z25A 1NI3A 3AY0A 3E70C 4LSMA 4Z7OB 2DPGA 1X1AA 1JYSA 4PRYA 4UFOA 5JJCA 1U2GC 2G7MC 4QKQA 1VRVA 1LJLA 2ZAIA 1CKEA 2EKZA 2PWYA 3AMVA 3MGKA 2J6CA 3R5XA 4J0FA 4MQEA 3UW3A 2PTGA 2C8KA 1UFQA 3E9RA 1TCBA 3ZVNA 2ZITA 3V33A 3LP8A 4CEHA 1IY2A 1KY4A 1WPQA 3NHFA 4DHEA 2NU7A 2G80A 1RXUA 4HDSB 3ANYB 4KVGA 2QQ0A 4EKDA 1SQ0A 2ZJAA 1ZUWA 2JVJA 4MDFA 2WFLB 3R5JA 4HV4A 4O08A 4CU5A 4P33A 1XRMA 1U0NA 4KYUA 3W3ZB 1SG0A 3R5TA 2H2IA 4CKEB 4ZCPA 5ER9A 3C8DA 1YI8A 3U37A 4DSNA 4BZWA 4QSHA 5LU9A 1MHTA 3V4PB 3QWBA 1Y7TA 4TQUS 2NU8B 1U8AA 3MBKA 1O87A 4JKYA 2AE1A 1URPA 2VATA 5TX7A 1L5LA 4KI0A 5AHRA 4KWEA 2IU6A 1P7YA 2OAQ1 4NY1A 3SE7A 4R6XA 4BJ6A 2O54A 2H7YA 3JATA 3VKVA 1K6IA 5EMKA 4DGQA 1WXHA 4C1BA 5LN1A 2IIPA 1ZJYA 2C4HA 3PTLA 3A6GA 1H2AS 1NTOA 3FAKA 1QRAA 2XCQA 5ERYA 4EATA 5BPHA 2W6JA 2Q6OA 3RU9A 3EFOB 4J3NA 1TAQA 1M0SA 3JRWA 3ORRA 3RIGA 5FOQA 2XEDA 4UOEA 1H6BA 3RTGA 3WGLA 1HL3A 2ISCA 4IGEA 1KQOA 4YQYA 2L19A 3PICA 2WINI 2ZTLA 4C4XA 4NTZA 5LKRA 3G2KA 4BASA 1XLWA 5J3JA 1AHIA 4E6EA 4CT4B 2B7LA 1FBNA 3LY7A 1UOQA 3IO5A 4UHHA 4QXPA 1O0SA 1A9SA 3C5CA 3A3YA 2E5FA 3BREA 3F46A 3LIIA 2XUAA 3NWPA 4D9EA 3ABIA 4NYJR 5I01A 4FM9A 2H2WA 1CZHA 3MINB 1QQBA 1EB8A 3OQ1A 4DADA 4HJXA 2PKWA 1I51A 3HP7A 4BMPB 2PUTA 1O58A 1J0AA 1ECBA 1F8FA 3QUBA 3ELUA 4QDUA 1ZP6A 4H1VA 1FLVA 1Z6YA 4XVRA 3C6KA 4RSGA 4MA0A 1AUQA 4I14A 4OHZA 3U3JA 5E7MA 1U0GA 1RYFA 2O8CB 5HIMA 4BAZA 5C8XA 5K3FB 2CDAA 4RY8A 3HTXA 2XXJA 5FYQA 3G2PA 2NTEA 1O7JA 4MVJG 1UEXC 4CTOA 2W2NA 4MUEA 1VL1A 1XKLA 2ZZKA 5HMMA 4NMHA 1T9DA 2BEUA 4OQEA 5KBYA 5EXEA 1M2VB 2R60A 2LPMA 4HRYA 2NPIA 3FIJA 3HABA 2AI3A 4HNQA 1JLLB 1O6ZA 1XEFA 3ESCA 4V1CA 1N2IA 3QWAA 4G2NA 3ZZ1A 4Q5IA 4KXWA 2W6IA 5EGSA 4JH0A 1BWQA 1FLNA 3HP1A 4RY2A 1E9BA 2ONZA 1J25A 3QKRA 1ZY2A 4PINA 3L4BC 4M86A 1BGWA 1P4GA 1UKVY 1VA5A 4PHGA 4BOYA 2I91A 2YYYA 3LBNA 2QQGA 3ZCVA 3M2TA 2XE4A 1RHQA 4FUQA 2H85A 4CF6A 1JPUA 3INRA 1NXVA 4AK9A 5E0OA 4M6WA 3FBTA 3P9RA 4AMBA 1L4HA 2W2OA 1I1HA 2WD7B 3AETB 3E18A 5DBOA 5FP0A 2ZUVA 2PGXA 3AHFA 3B2NA 4TN5A 3MMSA 2IUYA 4DLBA 1TYDE 3DVRX 4DLVA 3THXB 4I50A 1APBA 5ALXA 1MVOA 4GMKA 4O4IB 4P7KA 1R0LA 5TJHA 1JDPA 4EELA 1RKBA 1NJGA 3HCRA 1D2MA 2DWUA 4QOHA