4JT4A

Structure of clostridium thermocellum polynucleotide kinase bound to datp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt4A00
2OEPA 1R5BA 3A1TA 4D25A 3WRXC 3BE4A 4F7WA 1GRRA 2ZYTX 3ND9A 3DMDA 4K81B 4PFSA 4V0OA 2CLSA 3PUZA 4AK9A 2NO1A 5FBQB 1U9IC 1G8PA 2FZ4A 3ADBA 3T5DA 4PQRA 1DAMA 3ASYA 1Q21A 5A5GA 1UBGA 3GFOA 4DEXA 5FUWA 2J0UA 4BWYA 2IC5A 1M7HA 4DSNA 2JLVA 2ZUCA 3WBKA 4DKXA 1PLJA 3CPEA 1IXRC 1G8HA 2O8EB 3ZD7A 1F2UA 4JL8A 2O52A 1XB2A 1R5OA 2DWQA 1Q1QA 4FIDA 2O8EA 3MWJA 1KY2A 4G5QA 1N5IA 1RRPA 3LAWA 1E0SA 1LY1A 2VYFA 4MRNA 3T12A 2D3WA 3N2EA 4FMCB 3I61A 1U99A 4D4KA 5FUYA 1FP6A 1D2EA 4IW3B 1JPJA 2CDNA 2JLSA 1XD2B 4GBMA 4Q4LA 3WHLA 2W83A 1NBME 4JLNA 1MRNA 1FQKA 4NYJR 4UNPA 5DE3A 2ZE5A 4CYMA 3LY5A 2FDCA 3BBPA 2P3SA 3REGA 4HYYA 5TARA 5JWOA 4DSUA 4US2R 1IN5A 2ODWA 2VL7A 4EKDA 4GDFA 1Q44A 3RWMB 2GCOB 3TRFA 3PUVA 3AH8A 1PLKA 5FTMA 3DHWC 4II7A 2DHRA 1C4OA 4Q4JA 4Z8YA 5FUVA 1XRJA 2WWXA 2R6CA 4CIDA 1E2HA 2IYSA 4DWJA 4GL2A 2RAPA 1II8A 3AGPA 4TYYA 1BYUA 4L15A 1NBMA 2GEUA 4G1UC 5KSYA 1E9EA 2IYWA 1VCNA 3QPVA 1XCPA 1JQJC 2ZI3A 3B82A 2G77B 3RABA 1U98A 1ZC3A 4CEHB 4PX9A 1A4RA 4PAQA 1P62B 2ZYUX 2X1VA 5JHGB 3AB3A 2DFTA 1RFLA 3B1XA 3QKRB 4B44A 1SKYB 4JYBA 8OHMA 1FP7A 1XEWX 2GVZC 2RHMA 5J47A 4KU4A 2I3BA 4QFMA 2GK7A 2WWHA 3QXXA 2GETA 3KJHA 4URUR 2ZS8A 4C0SA 3VNUA 1WDTA 5GJVC 2HT6A 3ND8A 1G8FA 3QIAA 3A1WA 4W5HA 5FL7A 1ZRHA 4Q1DA 2QROA 1VHTA 4TL6A 3M6AA 1D2MA 1OJLA 3O8DA 2GCPA 4LYFA 2LCFA 2DFNA 2J87A 5AWFC 2QBYB 4IEIA 3TSWA 2HEIA 5AJVB 3VX3A 4KVGA 3ZYCA 3ZVNA 4YDSA 1T3LA 2ZETA 2QL6A 5LB4A 4GOXA 4M1YA 2QSYA 2LKDA 3R9WA 4RD1A 2IWRA 4QXAA 4D4MA 2YVUA 4HLDA 5CYOA 4WZBE 2QMEA 5KNCA 1UEJA 4QJ5A 5JEEA 3SYNA 1AKEA 1QG2A 1ZNXA 4I1SA 3IIMA 3CIOA 3IBYA 1US8A 3K9LA 1Z0DA 4AYXA 1VCIA 3MFYA 2GNOA 2EU8A 1II0A 1R7RA 4O0MA 3LBHA 4RVCA 4JBYA 3CR8A 2O8FB 4A0RA 2CJWA 1PUJA 1S1CA 4F4IA 4JLPA 1MO4A 1B23P 1QHXA 4IHQA 5A4JA 4D80A 2ZXUA 2E9SA 1FNMA 4QNRA 2PZEA 2IK8A 1CRPA 4HI0E 2JDIA 3RC3A 4RFSB 1H8EA 4Y0VA 4OI4A 2O5VA 3CRRA 4IDHA 1KKLA 3CX8A 4M0LA 3O8CA 2RB4A 1DS6A 3RRYA 3C7KA 3LWNA 1YR8A 4RZ2A 5EP3A 3X1ZA 3HU3A 1R6BX 2BMEA 3LBIA 4GOKA 4HSEA 1O87A 4U7DA 3LW8A 4DJTA 1XMVA 2FX3A 4NCJA 5LBIA 3JZAA 1KIMA 2OBMA 1FPMA 3MD0A 3GJXC 4JS0A 1AJEA 4TLDA 2W6JA 1KDTA 2PH1A 4M1TA 1IJEA 4Q47A 1G9XA 3HYTA 2GZHA 2X8AA 1W49A 3EA0A 4YMWA 2F6RA 2OHFA 3UG7A 2AD5A 4XH9B 1DAKA 2FPLA 3CRQA 3DEFA 2NO7A 2ZU6A 2FPKA 4RD3A 3U4QB 3J81k 4OHYA 2QE7A 3BS4A 2GA8A 1EFRA 1XDBA 4D26A 4PSKA 1G1MA 1GSIA 2J59A 1W44A 2RGXA 3U3OA 3RRMA 2CL7X 3A4NA 2V7QA 4OI1A 3DO6A 4X8HA 1RVDA 2YJTD 4TLAA 4R71A 4DXAA 2D7CA 1SXJE 2CCJA 4LHYA 2GF0A 2R62A 3KQHA 4URZR 2ZRPA 1X1RA 4DHEA 1W5SA 3KTAA 1UPTA 4JVMA 4Q7KA 2ZTSA 2IXEA 1G291 4Q21A 4PC3A 2Z4SA 4Q66C 2VH5R 5HKKA 2PMDA 3KJIA 1J7KA 4FN5A 3FKSD 1HE8B 1HH4A 3K70B 1XCGB 2IYLD 5H68A 4AKEA 1XEXB 5M04A 2EW1A 4JLAA 2QT1A 4KFRA 4LYAA 4Q7LA 5G3YA 3RNLA 3HR8A 3I73A 1G3QA 3GEEA 1W48A 2R6FA 3UKDA 4MRPA 1G5PA 2VF8A 3FYHA 4YDHB 5E7MA 5CLLA 3I8XA 4DIEA 2QPOA 5F9FA 2GCOA 1KK1A 3AVOA 1GDDA 3H0KA 3CRVA 2NO0A 4QHSA 3AP1A 4HB0A 3LX5A 5TVKA 1KNXA 3HR7A 3WNDA 2XX3A 3TJZA 2YOFA 1M6NA 3QF4B 3I5XA 1ZCBA 1Q1ZA 2KSQA 4GZMA 2P6NA 3IHWA 5KNBA 1M2OB 4ZDKA 4B3DA 4FMDF 2LWIA 4TTPA 4GSYA 5F98A 5KSPA 5CJPA 1IOZA 1GNQA 3SYLA 4UXIA 5HE9A 1DAEA 3GCGA 4K8OA 2XJ9A 2VIIA 1KI3A 1JBKA 1RYFA 1UM8A 4PZYA 1KI9A 3MRSA 3GLHB 2OV2A 3K8YA 1IHUA 1BO6A 1W2HA 3PCRB 2ZRLA 2NG1A 1UKEA 2AWNA 2ZSEA 3I62A 1OB5A 4OL0A 2P0EA 2VPPA 3EPJA 2W2TA 2VP2A 1Z22A 3ZVRA 1ZINA 3TUZC 4C0JA 2OAP1 2IS4A 4Z1MA 2Z43A 4I1VA 5JI3E 2SHKA 2BC9A 3CWZA 4A82A 2JLZA 1FUKA 3EIQA 4B73A 4NYIQ 1ZIOA 2ZUDA 2W0MA 1JR3D 3KFVA 1IQPA 2J0UB 2V1XA 4YC7A 3NDPA 3PG5A 2QGNA 2GAAA 4M8NE 4QJ4A 1YRBA 3I72A 2PX0A 3T15A 4YLGA 4FCWA 4KBFA 4JL5A 4LV5B 3TNFA 5LDDC 3VR6A 4KVAA 2OO7A 1ZM2A 2F55A 4QM6A 3QXCA 1SVWA 2QG6A 1NVVR 3UMSA 3AKCA 3WY9A 2PCJA 3VR5A 4TLCA 1FMLA 1NMXA 4A1FA 2CLDX 3RLFA 4BFYA 4TMTA 1IONA 2OLJA 5KSZA 3P4XA 4DLRA 2G1JA 1P61B 3G0HA 4JYCA 3AV0B 4RKEA 5EXXA 3U44A 2UKDA 1ZVQA 1FQJA 4XSHA 2ZI6A 1N5LA 3AF3A 3BD9A 5AK0A 3RAPR 3KDSE 3MSXA 1N6OA 5SZJA 1E2KA 1RPZA 1PV4A 2XB4A 4KCGA 1G7CA 3U3KA 5IF9A 1YZTA 3BIFA 5JJLA 4N0EA 1P73A 1JAHA 4NYIR 4P4UA 5FL7D 4X8OA 1I4DD 1FL9A 4ZO4A 1G7RA 1IY1A 3G82C 4KLZA 2ZE8A 4IDQA 1TEVA 2PEZA 4EPWA 4AY2A 3RRNA 2X77A 2OXCA 4C4PA 4BZXA 1HT1E 3C16C 2ZVPX 1R0XA 3RWOA 2FWRA 3UMRA 3I92A 2F1JA 1JXOA 2Q3HA 2G9NA 5HE8A 4LJ5A 1RC8A 3SN6A 4YMTA 1XP8A 1A1VA 3EIEA 4BLQA 1OV4A 1G7SA 3K0FA 3FFBA 4BLPA 3I4LA 2WOJA 3V4RA 1W2GA 1HUQA 2OG2A 3QXSA 1L8QA 1R0YA 1SQ5A 2ORIA 2XJ4A 3K1JA 2QSZA 3EW9A 5J4KA 1CF4A 1SXJB 6Q21A 1YJ5A 3OFND 3P4YA 2HXYA 2QE7D 1WB9A 3EC1A 1CS4C 1WF3A 2HYIC 3MWYW 3ICEA 1OYWA 2BBOA 3QXHA 2NPFA 3VR3A 1AS3A 1CR4A 1YHNA 4ERNA 2JLYA 1JEDA 1D9ZA 5HPYB 1E99A 2CK3D 1E79A 3SR0A 5GVSA 2R6GA 4QBGB 5H8WA 4UNQA 4A6PA 5K8UA 4DDWA 1UBEA 2A9KA 5H70A 2JLRA 2HF9A 2Z83A 4PR0A 1KJYA 4TMZA 4Q1EA 4BRUA 3GLGE 1Z0JA 3KQKA 2O8CB 2DCUA 2RGNA 3GFPA 2V4ZA 2J46A 3TQCA 4D82A 2KBEA 1CJKC 3CNOA 5KUTA 2W6JD 1VCOA 1N6LA 2AN9A 4I81A 4A0GA 3U60B 2OE2A 2QQ0A 2PLFA 2IWHA 4GOJA 4BFXA 1KMHA 5EE5B 1COWD 1DE0A 3W5IA 3CZPA 4OI0A 2QAJA 2H18A 3SYKA 2IEZA 2W0SA 4OKSA 4TMXA 3T61A 2NO9A 1YE8A 4H9GA 2QMOA 4HZUA 3UMFA 2W2XA 5GJCA 3UATA 1P7CA 2WICA 1R5NA 5LB2A 3N70A 3EC2A 3B9PA 1Z07A 2YZ2A 2NZJA 4LV8B 2PZFA 3T1VA 1T0JB 4ABYA 3CLVA 3FTQA 3DL0A 2O8DA 4HUTA 2WWFA 3ZVMA 1AM4D 4A4DA 1C9KA 4NONA 2CBZA 3O47A 5JJKA 2FSHA 2ODBA 3AP2A 4KITB 2MMGA 2XOKD 1T5LA 2PCLA 4B32A 2ZE7A 1OIXA 5LPNA 4RFVA 4NCHA 4BEJA 3RS2A 3ZD6A 2OBNA 1TQ4A 1VPLA 1N6IA 1TMKA 2W00A 4C2UA 4HLCA 4EPYA 1W36D 1NG9A 4IDNA 2D62A 1PLLA 1JECA 3BRWD 4ZV4A 2VQSA 5E95A 3KKOA 3R7WB 5F9HA 3F0TA 4O3MA 3IBGA 2BOVA 2G88A 3B13B 4PHFA 5EXSA 4IKEA 1IN7A 4TMVA 1DG3A 1XZPA 2JJ2D 3MG9A 5FFMA 2JIZD 4G3XA 2YWEA 4LBWA 3GLHE 5D3QA 1RYHA 2V6IA 1SVLA 2ZRIA 3B78A 3CF6R 3OIUA 5HCNA 3BJIC 2ZQ5A 4Q5IA 4B75A 3THWA 1T3HA 4V02A 2OCYC 3VHXA 2JLWA 1KTVA 2GBLC 4Q9IA 5IT5A 4FD2A 3HPQA 1GZSA 1LFDB 2AKYA 5K8TA 3TW8B 3T1OA 1U8AA 2GJKA 1AQUA 2JJ8A 2RGDA 2V55B 2WJVA 1E79D 5CLQA 4CZ2A 4TWZA 1G5RA 3GD7A 5P21A 3T34A 3L0SA 4LBYA 1BYIA 3OZXA 1R2QA 1IY0A 1TX4B 1CXZA 3IGFA 3MJHA 2RGAA 3U7HB 3VKGA 3R8CA 3TVDA 4A2PA 3E2IA 1GL7A 4JSTA 2HXSA 2QAGC 1Z3IX 2AX4A 2JJ1D 3NBFA 4LGMA 3ZQJA 2DB3A 5TV2A 2WOOA 1HEIA 5FI1B 1E1RA 3S1AA 1UDWA 1A82A 1E3MA 3LQRA 2QM7A 3W6PA 4QJ3A 3U44B 5D3MB 3CX7A 1AS0A 4RD0A 1DG1G 1EFHA 1QZXA 2ZRBA 1DPFA 1X8LA 5JLJA 3A1VA 3PEWA 2ECKA 2ATVA 2CL0X 2OCBA 3WMGA 4EIWA 2IX3A 3QBTA 1IAQA 3C14C 2AXPA 3A58B 3QEOA 3W3AA 1GVNB 3NG1A 5FOXA 4BGDA 4A6XA 5FL3A 5EE9A 3EX7C 1Z6TA 1WCV1 4Q4JB 4Q4AA 3AM1A 2WAXA 1ZUNB 3MCAA 3FVQA 1S0UA 2J7PD 3BAFA 3ZJYA 4BFWA 1CTQA 2ZRNA 2BCJQ 1Z0KA 2FNAA 4MRSA 3W5JA 4POAA 3SQWA 1XZQA 5IK2A 2ZANA 3IEUA 3BERA 4JT4A 2D2EA 4X8LA 3OIYA 4DBLC 4PO8A 2J9RA 3LLMA 4HLQB 3VR2A 3ZS9A 2GF9A 2A5JA 2FFBA 4RY2A 4HAUA 4BZPA 2NQ2C 1YR9A 1NSFA 4MITA 2IHYA 1V5WA 3A37A 3FOZA 3NHAA 5JSZA 3EPKA 1DOAA 4GPTA 3U6KA 1E1QD 1I2DA 2MSEB 2JEOA 4YXWD 4IOLA 4L8GA 4V03A 3QQ5A 1NIJA 1P9NA 1XEFA 2JGNA 3K0CC 1TEXA 3LQQA 2GEVA 3PEUA 1OXUA 2GJ9A 2XXAA 2BMJA 3X1DA 4DCVA 2WMOB 4LOAA 3THOA 4CDGA 4PHTA 2EFHB 2C8VA 3NXSA 3Q3JB 5AJXA 2HT1A 1KI6B 1V43A 2OFXA 2ZJ8A 1KI1A 5CIQA 1I2MA 3GLFA 4H1UA 4URYR 1E0JA 1E94E 4TZ6A 2R8RA 3AKEA 4CEIA 1KNQA 1SKYE 5DSZA 1TPZA 3RSOA 2FMXA 4QGAA 3ZGXA 2YNMA 2WIAA 2ZE6A 4ZCIA 1N6KA 3D6TB 1AK2A 1M34E 3IO3A 2QP3A 3CPJB 2RH5A 1P72A 4L16A 1KI4A 2HCJB 1IY2A 4JLOA 2C77A 5H1YA 1AGPA 1CP2A 1TL7C 2L0XA 3RS4A 1Z5ZA 3U7GA 2IYYA 2IYRA 3KZ1E 1OFUX 4CEJB 1O3YA 3B85A 1JJ7A 1Z2AA 4LZZA 3VKWA 4B47A 5JBQA 1CRQA 1CJVC 1LNZA 1P2TA 4MH0R 3WYFA 2GXAA 4MKFA 1XJQA 3CNNA 2GVDC 2QBYA 2ZIAA 4V0MA 3P20A 1M8PA 2ZRKA 4QHYA 1Q12A 3LO5A 3W3ZB 1UAAA 1NMZA 3GLIE 4R9UC 1S4QA 2N46A 4YXWA 1L7VC 4PAMA 4EPVA 1XTIA 3QKTA 1KK0A 1W4BA 3GJ4A 5J4VA 3PUXA 3CF2A 2NZ8A 2AWOA 4LHZA 1DEKA 5J4YA 1T91A 4MYUA 4URVR 1MH1A 3QF7A 1ODFA 5CDFE 2UZ3A 1N0VC 4B43A 5L8VA 4MRVA 3KX2A 1F48A 4NMMA 1KK2A 4URWR 3M4YA 4FINA 2GESA 4FCTA 4RKFA 1R8QA 4FMBB 2E1RA 4MYTA 4GI7A 5E7JA 3L82B 2C96A 5EQTA 4CF7A 5J4HA 2QN6A 4PHHA 3B1VA 2J41A 4B74A 3UANA 4BLRA 4KFTA 4WA7A 5FOSA 2QI9C 1D9XA 1TADA 1YZGA 3W34A 1N25A 121PA 2B92A 3Q8XB 4LHVA 1GUAA 1K5DA 2QP4A 1CEEA 1J8YF 1SHZA 2WZQA 4XIGS 4D6PA 3SJZA 2JLUA 5HKKD 1GL6A 2IUTA 5TXGA 3ZZUA 3CBQA 2XGJA 3JVVA 1YRAA 1RW4A 3IILA 1FX0B 2VTKA 1XTKA 3RS0A 5CYPA 1AZSC 2YWHA 3TLXA 1Q3HA 2MSCB 4C0QC 4Q9LA 2KJQA 2A5FA 2GJAA 1KDOA 3B1WA 2R2AA 5BN3A 2OCPA 1QHGA 2IBMA 4V0NA 2FPMA 1L4YA 5FPTA 1QHNA 4TSFD 1YZLA 1BMFA 2B7BA 4NYMR 1NVWQ 1TU3A 2ZJAA 1VG8A 3CNLA 4TYQA 1WBDA 3CWQA 2H5EA 4PAOA 2W6IA 2ZPTX 1G17A 1S96A 3OESA 4A92A 3H86A 3PUWA 4NCIA 4TTRA 3OEEA 4P0TA 1OE0A 5HZKA 5C4MA 4RCYA 3OEHD 1JAIA 4NYJQ 4RJLA 5B64A 2WSSD 3W6OA 1GKIA 3QE0A 4OJQA 3N2IA 1XTSA 4BFUA 821PA 3QY0A 4UNRA 2B8WA 1OIVA 3F8TA 5HTKA 4ESVA 4MGYR 1XPRA 4IOMA 1UF9A 2CLCX 4Y0AA 5GJBA 5FOTA 3X1YA 3AUXA 4V0ME 4P4SB 2R6DA 4NU0A 2OSBA 3HU1A 4GMXA 4MKGA 5BN5A 1TUEA 5IRCD 1U9IA 1XTJA 5C2JB 1XTRA 2ATXA 4AG6A 4OK3A 2GJ8A 4JKYA 1KO5A 4XWAA 4IRUB 2ASEA 2FJUA 4IJMA 1ZM3A 4FXPA 2VP5A 3IIKA 4TLEA 4M21A 5FTJA 3Q72A 3AVTA 3R8FA 2FSFA 3NTUA 1KDRA 4PSAA 4XWOA 1XEXA 1XXHE 4TQAA 4DLSA 1UBFA 1P4SA 2QTHA 2J7KA 1WA5A 1HT2E 5CK5A 3UWKA 3PQCA 1X8JA 2REBA 2ZSFA 1AN0A 4JLDA 3EASA 3VKHA 2PLRA 1SHKA 2ANCA 2DY1A 3UG6A 1PZNA 2VP6A 4TTQA 4DIDA 3TBKA 4NYMQ 3TVTA 4FCVA 1ZU5A 1ZAKA 1JJVA 4AG5A 4TYNA 1N6HA 4LYHA 3RS7A 5AUNB 1RE0A 3U61B 4G5RA 2C9CA 4HDOB 1NNEA 2XZLA 4CEIB 2HV8A 3E1SA 4Q18A 1CULC 3I32A 3K0AB 4US1R 4ZIRB 3EZ9A 5EE3A 1YR7A 4A9AA 2WVJA 5JSZB 3Q7QA 4Z8XA 3AVPA 4HAZA 1N6RA 2V6JA 4HLUC 4AC9A 3HWSA 2YWGA 1XJ0A 3O8RA 4D0GA 4BASA 3NKVA 1SVMA 1JEEA 4LBVA 2O8DB 4Q7JB 3R9IA 2EVWX 4XSGA 2CNWD 3BK7A 2V1UA 5JS8A 4P31A 4YONB 4PC6A 2ANBA 4TLBA 1K5GA 5SZKB 1G21E 1NY5A 4UJ3A 2HYDA 3CKLA 4EFNA 2YKGA 1N6NA 3FE2A 3LXRA 4EAQA 1E2PA 2XTZA 2WKRA 1CJUC 5FUXA 2F7SA 2ZYVX 3AKYA 2ZRJA 4QBHA 3W90A 4DRZA 4B2IA 2XZOA 3AF0A 4BFTA 2BMFA 4N3NA 3WHKA 2B6HA 3CRMA 4OQNA 1KSGA 2HJGA 4ASUA 1NVXQ 1H65A 5JS7A 1NJFA 5JRZA 3FMIA 4OQXA 1W0KD 3AVVA 5KDLA 1ESNA 2YINC 3FMOB 5JCZA 3LVQE 4RD6A 2QUZA 5B30A 4TYWA 1W47A 1P60A 2ZS9A 5SZIA 5AJWA 3MWLA 1SVKA 1TAGA 2ZU0C 1J90A 3B5JA 4B6EA 2P6RA 2AFIE 3B9QA 3L8ZA 4IEEA 3NEYA 4PQFA 4XD7D 521PA 3JVUA 2C03A 4QGHA 3FFAA 4JJZA 4QG7A 1H8HD 1TF7A 1MT0A 3NH6A 4YMVA 4EPTA 2IS6A 3F3YA 4IXNA 1N0UA 4CEJA 1TTTA 1JPNA 1WQ1R 1XNJA 2Z0MA 4DLYA 1OFTA 3B1YA 3QENA 4M1MA 2H16A 1ZMXA 3B6EA 4JBWA 4L5BA 2Q0HA 1SVOA 3SNHA 2ZITA 3CZQA 4DLVA 5FI0B 4K46A 3KQNA 2H57A 3JZMA 2VF7A 4OQFA 3DZDA 2XOKA 2F1IA 3CR7A 2QTVB 2KE5A 1XD2A 4Q01A 3REFA 4CRWB 5DI3B 2OAQ1 1FFHA 4B76A 1ZNWA 3CW2A 1KO8A 5EP1A 4B3BA 1ZC4A 3RSLA 3AVYA 5JJIA 2UVQA 4DT1B 2G1KA 3CUEF 3DKPA 3KJEA 1E0AA 2GZAA 3D8BA 2YC4C 3NBXX 2DBYA 2ZSBA 1M1YE 3TSZA 3NH9A 3LD9A 1F2UB 2GZDA 4E03A 1NG1A 1KK3A 2PZGA 4HATA 2CJWB 1U90A 3QOFA 2IYQA 4MGKR 4U02A 3X1WA 1COWA 2O0KA 3OAAA 3U3JA 5BYKA 5CB8A 4Z1MD 2OZEA 1AGRA 2XNDD 2ONJA 1OHHA 3CH5A 1GRQA 1I4LD 2DR3A 2WKQA 1DADA 4A8JB 2J0QA 5DHFA 1AS2A 1CJTC 1KSFX 3LV8A 3KTAB 4B48A 4DUGA 1T3SA 1TQDA 4XVRA 2J3EA 4BECA 5EJEA 3UPUA 5L3QB 1KMQA 3BWDD 2H1LA 4QBFA 4HUQB 3ZDQA 3IQWA 4MUAA 1QDEA 2IL1A 1NLFA 1SGWA 1KY3A 2YV5A 1KHTA 5JWRA 3AQ4A 2WWGA 1YU9A 1KAGA 5FH9A 3ICQB 1P3JA 1NL3A 1XFAA 1JI0A 3OFNA 4GMDA 4MGZR 3I8SA 4UNNA 2RGGA 1BS1A 2WHXA 3KXIA 2WWWA 2ZEJA 4EQ6A 3RS5A 3IHLA 3QEJA 5JWHA 2ZRAA 4JIMA 3SOPA 2O8CA 2C9YA 1KOFA 5JHHB 4ACAA 4NTZA 1GITA 3PVSA 1M74A 1D2NA 1TU4A 3GPLA 2PBRA 1DVRA 4DCNA 4AKHA 3K9HA 3C15C 4Q9HA 3F5FA 5ELXA 2G3YA 1G5TA 2VHQA 4PHGA 1Z63A 2CL6X 3DPUA 4Q4HB 2D74A 5DISB 4Q1FA 2XSZD 1MRSA 1MR3F 5F3WB 4NHOA 2GDJA 4PC1A 3L8YA 2FA9A 4OHWA 4UKDA 1RZ3A 1UBCA 3FMFA 3PUYA 4O2LA 2ZM5A 3QKSB 4BQSA 3EG5A 2H8KA 1LF0A 1NVUQ 3S1AB 1GIAA 2GCNA 4KO8A 4N0DA 1MABA 2KBFA 4MYCA 2A5YB 2OILA 1VYUA 2R65A 4XTRA 2WWYA 4QC2A 2YHSA 2OT3B 4ZCMA 3BXZA 3L2OB 4GFDA 3RDPA 1E2EA 1U8YA 4M9XA 2A5DA 1EFRD 1MABB 2P5SA 4ON9A 4P4TA 5FBWB 3PJRA 4DDTA 2O8BA 1MOZA 4LUCA 3QBVA 4WXRA 4OHVA 5B58C 2EFGA 4WXPA 3SZRA 2AK3A 4DVGA 5EE1A 1AQYA 2BJVA 2WAYA 4JBXA 5KHOC 1CKEA 4ZKDA 1G7TA 2WWIA 3EZ2A 3C8UA 4FW9A 4WAUA 2KWIA 2VHUA 1W4AA 2YWFA 5L3SA 2ZI9A 2QTFA 1PUIA 2Q21A 3K09C 2ZJOA 4TYPA 3D31A 1X1SA 1VIYA 1P5ZB 1SXJC 2QA5A 1I4TD 2JCSA 2IF2A 3D7MA 3OIVA 3EARA 4OYHA 1EWRA 2ODEA 3EA5A 2WJJA 2XAUA 4JVSB 4YMUA 2WPDD 3SFZA 3GJ0A 4RCZA 5HCIA 4U5XA 2BBTA 4QGFA 1AKYA 5AJZA 2I4IA 3BB1A 4V0KA 5DN6D 1F5NA 1TQ6A 3IUYA 4WBSA 3B1ZA 3QPUA 2ZRHA 4LX0A 5GVRA 1UKYA 1IN6A 4EFMA 3RYTC 4GZLA 4PPNA 5J5CA 4DLXA 3L0IB 3ZS8A 1AZTA 1IBRA 4B71A 4ESHA 3QG1A 1VG1A 4PZZA 4LJ8A 5JFGA 3R7WA 1XJCA 3AF4A 4PO1A 1W4RA 2WBLC 1G20E 4ARZA 1E1QA 4EFLA 2I1VB 3LH5A 3RHFA 3K0AA 3H2YA 4E07A 2KI5A 1S9DA 1R0ZA 4TMKA 1GNRA 1IJFA 1NN5A 2QRZA 4YMSA 2CXXA 3W6NA 5EXPA 4WZAE 1E9SA 1RRFA 3GP8A 4WZ6A 4E5UA 1HTWA 5IHPA 2BWJA 3DKVA 1G4AE 2GRJA 3RC8A 4I99A 5EP2A 5EUQB 2C2HA 2A78A 3QNUA 2ZJZA 1VMAA 1QHHB 1XXHB 2VHTA 4Q00A 5SZHB 3IO5A 1CJMA 3OIWA 3FKSA 2LKCA 2FFAA 3T1TA 1T0HB 2F43B 4JKIA 4PPGA 4C30A 1OH6A 1RRCA 2QENA 1TF2A 2O0JA 1GRNA 3W8RA 1AA9A 2CE2X 2ERXA 4ASUD 4JLJA 2WIBA 1WBBA 2GJSA 1P2SA 2OUKA 1HQYE 4B3FX 2IXFA 4PSVA 2HLDA 1CBUA 3LXXA 5FTNA 1NF3A 1R8SA 2P6UA 3CB4A 1GKYA 4JZKA 4D81A 2H7VA 1YZQA 3IIJA 1E9AA 4S2EA 2H17A 4NCKA 2ZSDA 4GP7A 4UNSA 1TNDA 4KXFB 2V7QD 4DLTA 4DC9A 2ZR7A 2JJ1A 3TR5A 1OFIA 1NKTA 1P75A 2JATA 5C18A 4M1SA 4EPRA 3KUDA 4OJKA 4D2IA 5DNYB 1MV5A 2Z5FA 2VO1A 1E9DA 1GM5A 3AVXA 1OXSC 3DOFA 4J0QA 1XD9A 2AHOA 1CU1A 1HQCA 1ETUA 2CNWA 3OF5A 1ZYUA 2ZYWX 2ORWA 3TGPA 1G8GA 2EWVA 3QVUA 4AKIA 2ZJ2A 4AURA 4LBZA 5CM8B 2J1LA 1YQTA 1VHLA 5K8IA 1ELOA 4ZIRA 4TQ9A 5DGXA 3AP3A 2FZLA 4KODA 1DAHA 1JR3E 4LRWA 2XNDA 4ZI2A 4TT3A 4IFBA 2WJIA 1SXJA 3WP1B 3BGWA 2JIZA 1KSHA 3NEJA 2JJ2A 2FF7A 3Q9LA 3EZFA 4W5WA 3ZVLA 3PXGA 1B0UA 2F1HA 4CT5A 1VIAA 1VG9B 4ZKEA 3CM0A 3PIRA 1R4AA 3IPYA 4Q03A 1VYVA 3R20A 2G0TA 5AUQA 1YZKA 2WKPA 4EPXA 4PC7A 2D06A 2JDID 3PFIA 1UDXA 2WMNB 4V0LA 1LW7A 5FR2A 1KYIA 3CONA 1OF1A 4O2RA 3X2SA 1E0KA 2XNSA 5IDVA 4MDFA 1RJ9A 4AI6A 1E6CA 3AUYA 5KNDA 1QVRA 4KAXA 1EXMA 1E2DA 4LY6A 5CK4A 2QZ4A 4ARZB 3Q5DA 4RFSA 2UZIR 1E9CA 1RKBA 1QHIA 4I1UA 4DCTA 4URXR 4DCUA 1GG2A 3KKNA 4HAWA 1S3SA 2RGNC 1C1YA 1N6PA 3R9XA 1NY6A 3LBNA 4O25A 3IDQA 4E22A 5BXQC 3WP0A 4TL7A 4TZ0A 3KXLA 1KO4A 1Z6YA 2NOAA 2YOHA 4LV6A 1H8HA 3QKSA 4F92B 1KI6A 2AFHE 1P9RA 4RZUA 1G41A 4XD7A 2HDNB 2QU8A 3FDIA 1G18A 4B35A 2H92A 3A4LA 5KU1A 2NTYC 1G3RA 2OM2A 2XTNA 3KL4A 3ONWA 4NE2A 1II8B 4PXAA 2ODNA 5GJWC 1CR2A 4JJKA 2V3CC 3LA6A 5EP4A 2IYZA 3X1XA 5KPJA 2BMDA 4M1KA 4TT3D 3K0CA 1U94A 3WBJA 3U7FB 5AR1A 2C95A 2IYVA 2Q9CA 1S8FA 1KJWA 3L43A 1M7BA 3KJGA 3M0EA 3EPHA 4OQLA 1GL9B 2R9VA 3WRYC 4BUJA 5BW8A 4CW7A 5J4LA 3A8TA 5C46F 3AF1A 1EWQA 1D8TA 2AK2A 2ZJBA 3BH7A 4HZUB 1FTSA 5L3RA 4P3YA 4QL3A 4MKHA 4DLUA 2D7DA 4F4CA 5KSOA 2PT7A 4H1VA 3U2QA 3GLFB 1XPOA 2QGZA 2QQEA 2YYZA 1CLUA 2IT1A 3EAQA 4KHZA 2F9LA 1BMFD 3TMKA 5CM9C 5FBRB 1OH7A 3BC1A 1Z83A 1Z8FA 1NBMD 2CVFA 1NP6A 4CT4B 4DT1A 3THXB 3SI7A 5L3QA 2GK6A 4CEHA 3ZZTA 5FR1A 3U3MA 1FUUA 2ERYA 3TIFA 3CH4B 4G5OA 2HCBA 3V4FA 3K0SA 3G5UA 4M53A 3GLHA 4A0FA 4C0AC 1EGAA 3AKDA 1LV7A 1SULA 5EE0A 3BH6A 2BJWA 4Z54A 1UFQA 2PMKA 2ZR0A 3PR1A 4G5SA 4XJXA 3IKJA 4A36A 3TH5A 1MO5A 2AR7A 1Z28A 1QRAA 1T4GA 3NVAA 3VU9B 5UKDA 1QF9A 1FMJA 4JVLA 5JRJA 4IVPA 1KO1A 3VX4A 4HUQA 3VAAA 1IXSB 1ZUIA 3C5CA 3NC1C 1P2VA 4HDQB 1GTVA 2C9OA 3W9YA 1Z2CA 1JALA 1NRJB 4OHXA 4F91B 3GLIA 4Q4AB 1QBKC 1Q0UA 1QG4A 4KLNA 3OHMA 3QUSA 2X2EA 3FGNA 3GJ6A 3Q5EA 1XMIA 4UQOA 2B7CA 1E9RA 3MWKA 1OH5A 2IYTA 2WJHA 2ZJYA 4M4SA 3NIBA 4S35A 1A2BA 2ZAOA 1GNPA 1OXXK 4QGGA 1JXMA 3VHLB 2RGEA 2BM1A 1E2LA 2C5LA 3VU9A 4BLSA 3K9NA 3QJYA 3K70D 5DN6A 4WVFA 1FZQA 1ZU4A 2A2ZA 2OXRA 1Z6GA 2A7QA 3E70C 4FWTA 2DYKA 2RHDA 4NDZA 1G4UR 4IDPA 1KSJA 1U2RA 3CRW1 4IDOA 4P33A 1ANKA 4R98A 3TE6A 2WPDA 2HJVA 3KUCA 4M2LA 4ZDIA 1FW6A 3PITA 3U4QA 2Q9AA 1OKKA 3SDZA 2ZI4A 5CB6A 1OXVA 3A4MA 1KJZA 1YKSA 3ZZ0A 2FFHA 3TUIC 3P26A 2BM0A 1FTNA 1LVGA 3KXKA 4UXJA 5E4FA 2C98A 1SXJD 1N0WA 4B3GA 1VDZA 3ASZA 3FHCB 2CVHA 2XXAB 3AF2A 1DO0A 2BIFA 2VLIA 1R0WA 1GAJA 1W1WA 2XEXA 2R44A 4HB4A 3THYB 1XMJA 3TW4A 1J70A 2C99A 1OT3A 3NBYC 4DDVA 5JEDA 4RD2A 1E4VA 1G3UA 3OEHA 1U81A 4MUBA 5EZ6B 2OFWA 4PANA 4WIAA 4ACBA 2YOGA 2FH5B 4L9SA 4TQUS 2Q6TA 5TY0A 1LB1B 5DLQC 1EFTA 1E9BA 5C1BA 5BN4A 3THWB 2QPAA 2G6BA 3SJAA 1F6BA 3WNBA 1VECA 2PL3A 5FBLB 1R10A 1TF5A 1KMHB 3A1SA 3VTKA 1ESMA 1U0HC 1W36B 2JLQA 2WJGA 3WMEA 3P27A 3HU2A 5J40A 1W7AA 4QRHA 1OW3B 4D0LB 721PA 5JI2E 1HYQA 2HLDD 5DYIA 4HLUA 3THYA 3V00A 2IHBA 4ILEA 4TMWA 4KFUA 1D6JA 5FTLA 4MGIR 5LD2B 5EZ5A 1BH2A 4GP6A 1F3OA 5EXTA 4OK6A 2ZROA 5GADl 2QP9X 2XSZA 4UJ5A 2XZPA 3QSYA 1RRGA 2QM8A 2WSMA 2ORVA 1GILA 5KOYA 1HV8A 1SZPA 3MGCA 1NJGA 4G0NA 4UXHA 4FI3C 2DFLA 4NZYA 2EWWA 3HYRA 4LJ9A 3RVBA 2A5GA 1XWIA 4Q19A 5KPDA 2P5TB 2ZRDA 3I1FA 3OE7A 5JECA 1G64A 4NCNA 2DPXA 2IUSA 1XTQA 4C9BA 3K0EA 1S9HA 1ZW6A 5L3SB 3VNVA 3SBDA 1HA3A 1S1MA 1NVVQ 4Q1BA 1F60A 4JLMA 4LPSA 3P32A 4TN1A 3VQTA 1UADA 4EJSA 3B2EA 1ONBA 3EPLA 1KAOA 1U0LA 1N5KA 4B6FA 4C0HA 2C04A 1W36C 2W58A 3GLIB 4PZLA 3LW7A 3THXA 1KZ7B 3U5ZB 3AEZA 4DUGD 2VSFA 1ZNZA 3NHBA 2QAGB 1QHHA 4KSBA 4DCSA 1E32A 3V9PA 4BRWA 1GKUB 3A36A 3ADDA 1P6XA 1ZCAA 3RRZA 4OBEA 4QM7A 2A30A 4B3XA 1L4UA 4EJSC 5BYJA 1G8YA 3OAAD 3NWJA 2EFEB 1T5IA 3A1UA 3VMFA 4NBSA 4NKRA 3LNCA 4AYWA 4IVRA 5HZHA 3QKUA 2AXNA 5B2ZA 5BQ5A 1Z06A 2VSXA 1OSNA 2NGRA 4DLWA 1YR6A 1A7JA 2YC2C 4DSOA 4XWKA 4KJZA 3T06B 3C41J 4IVQA 3BFXA 1NN3A 4WOPA 1AIPA 4PPQA 4Q4HA 3QPWA 5ANRB 4ZI3A 4AD8A 1Q3TA 5KDDA 3UWOA 2ZVQX 2FE4A 4BLOA 4D4JA 2VA8A 4JLVA 5G3ZA 2FEOA 2IS1A 4KSCA 4AKGA 4LJ7A 4C3ZA 3EWAA 2QPTA 4P4SA 3HJNA 1U8ZA 2G0NA 4DDUA 1N2CE 4M9ZA 4PTLA 1WRBA 1OB2A 2WV9A 3SU8A 1Z0AA 2WM9B 2BEKA 3SJCA 5K8LA 3FKQA 1EX7A 2OFOA 1T8TA 3HDTA 3L0PA 4W7SA 4C0KA 2QEQA 5JMTA 4HAVA 5D3MA 2QY9A 1EFCA 1T8UA 1FNNA 2EQBA 2REOA 2R6AA 2VP0A 4JMPA 2W2VA 1ZM9A 3FPAA 5A0FA 1OXTA 3HPRA 1HY3A 3KKMA 4Q02A 3MLEA 4GNKA 1WXQA 4LHWA 1T9HA 3AVQA 3GJ7A 4C2TA 5IK2D 2DFKB 2QRNA 1E2QA 3LFUA 2BKEA 1J99A 2JA1A 2D4HA 2CHVA 4OK5A 3VR1A 3EZ6A 2EFDB 4RD4A 4US0R 1KI2A 1NIPA 2GTPA 2NPIA 3UK6A 5KO2A 2P65A 1W0KA 4HDCA 4WW0A 3RS3A 4G01B 3CX6A 4R7ZA 2Y8EA 4HZIA 2WJYA 3FMPB 3Q7PA 2IW3A 2CCGA 3UXMA 1XEWY 2J5XA 4QNMA 2Q3FA 3U6BA 2ZUBA 1E98A 1E2MA 4XTCS 1HE1C 5DIFA 5CJ2A 2QT0A 3K9GA 3BORA 2FSGA 5G41A 4HB2A 2JAQA 1DO2A 3KKQA 4LJAA 3SE0A 4BE7B 3SS8A 3VFDA 4CGZA 3PENA 1JNYA 4DSTA 1A5TA 2X2FA 2CCKA 3EXAA 4E09A 2ZI7A 5TB5A 1E2FA 4Q9JA 4BPBA 2FG5A 2XITA 4HEJA 3DMNA 4HAYA 3GEHA 1PJRA 1QHYA 1D5CA 4B2LA 5AUPB 2VSOA 3L0OA 3EIHA 3H4MA 5FOUA 5BWMA 1OFHA 4FMCF 4M9QA 2E87A 2WTUA 1NI3A 1A2KC 3QF4A 3BOSA 5FPHA 3TQFA 1GOTA 2NMVA 3FB4A 1WE2A 2RCNA 1EX6A 4PQYA 1Q22A 3QG5A 2GXSA 4GT1A 1E9FA 1E2IA 5DYGA 1OHHD 4BFVA 1KZGB 4C0BA 3DOEA 4RZ3A 5KDOA 1UEIA 2VBCA 421PA 1K8RA 4DB2A 4B33A 1MO3A 1S3GA 1Z08A 2EFCB 1SKQA 4W5JA 4LWZA 4PO9A 4LHXA 3KQUA 4L9WA 1RIFA 2VP9A 3PV0A 4DEYA 4LK2A 4MA4A 4OQMA 2Z4RA 2C78A 2P2LA 2XB2A 2Q3MA 3ADCA 1M7GA 4ZCLA 3ZH9B 1OLOA 2ZS7A 1T6NA 4B2PA 4P32A 2NO6A 1OIWA 1JQLB 5TDHA 1G3MA 1CR0A 2ZAMA 4BEBA 1X3SA 5AUOB 3UIEA 1BKDR 4F38A 4XOIA 3EZ7A 4LI0A 1UJ2A 1EG7A 4DB4A 2BDTA 2IYXA 1E96A 1GFIA 2O0HA 4KYIB 4Q9KA 3TK1A 2BBSA 4EUNA 2GXQA 2IF0A 2GHIA 1IN8A 2F1RA 4A8JA 3TAUA 4C0LA 2BBWA 2IUUA 1YZUA 2IS2A 1XMSA 3BB3A 4ZDWA 3MMPA 2ZJ5A 1G16A 1Z0FA 3LLUA 4CVNA 2BV3A 3TAHA 1Z47A 2DWPA 3VR4A 1XCMA 1SVSA 4AIIA 4JSYA 4XVQA 1NLYA 2OCAA 1Y63A 3GLFE 3GQBA 2VRWA 1X8KA 2OLKA 5EUMA 1FOEB 1WP9A 1ZUHA 2FFQA 5CITA 3TUJC 4MQBA 4OI2A 1EFUA 4A0HA 3A6PC 4X8MA 1Q20A 2BCGY 4MKIA 4DZZA 3IPXA 4LC0A 1J8MF 4NPHA 2F9MA 4AYTA 3I5YA 4M9SA 2ZREA 2DWOA 3SHFA 4JLKA 4W9MC 3AGQA 1G6OA 3AVUA 3EWSA 3U7EB 3AVWA 2JLXA 2WSSA 3LVRE 4Z51A 2PT5A 3U3RA 4LDJA 4NP6A 3KB2A 3ZQ6A 1CR1A 1XBTA 2CK3A 1N3BA 2PX3A 2W6ID 1UKZA 2CEAA 1BOFA 4KFSA 2RGCA 1U0JA 2PEYA 2PJZA 3M1IA 3P1JA 1E69A 2VP4A 4L4UA 4ZDJA 1ZIPA 2OESA 2ZRCA 1X86B 2BEJA 2JASA 4TSFA 2GEDA 4I4LA 1E2NA 4IXMA 1MO6A 5CDFA 3OE7D 4BFSA 4D4LA 1VYTA 3ZIAD 3ADKA 2GKSA 2ZSAA 3RANA 2F43A 1ZD8A 3D3QA 2FEMA 3DZ8A 1DELA 4XVUA 2CMKA 2IYUA 1UKVY 2N1BA 1DARA 4NH0A 4M1WA 4LJ4A 1XD8A 1NKSA 1DAGA 1W0JA 3GMTA 4D0NA 2V54A 2GWHA 2ZRFA 1KGDA 2FV8A 2X19A 1KI7A 3QXJA 3B60A 3BH0A 3MJRA 2P67A 3TKLA 2QORA 3WYGA 4YQFA 2AKAB 3CF0A 4BZQA 2A3RA 2EYUA 4HB3A 3T1QA 1Z6XA 4B34A 3WXMA 3HP1A 4A2QA 2REXB 4LSGA 2ZR9A 3SQXA 4LYJA 3W8NA 2FU5C 3KFXA 4N1AA 3B7GA 2HF8A 2BVNA 4Q48A 1XU4A 2BKUA 2VHCA 4C7OB 4Q1AA 1MKYA 4LJYA 3SEAA 3QI2A 4GRAA 4ZPXA 1F2TA 4A2WA 2N42A 3CO5A 3FWYA 2QNRA 1Y3AA 3DM5A 2J0SA 1CIPA 2J45A 1KDPA 1KKMA 3QKRA 1GP2A 3C4JA 5LD2C 4M1OA 1Z29A 2ZI5A 2RKOA 3C5HA 4LPKA 2BHRA 1XF9A 1VKJA 2QMUA 5FOVA 4EQ6B 3DDCA 5E3HA 5DI9A 1VG0B 3O8BA 4BLTA 2O8FA 2GBLA 1OH8A 3BFKA 4HAXA 4BFZA 2GAOA 4QOSA 2CHGA 2K5UA 1JR3A 3WNCA 1DAFA 2O8BB 5DHAA 1SVIA 2MSDB 4KBGA 1G6HA 2NIPA 4QBIA 1KI8A 4NL4H 2CHQA 3LX8A 1F2TB 4QKQA 1YVDA 4PC2A 1OKKD 2AL7A 3SFVA 621PA 3B8HA 2HUPA 3KKPA 2CE7A 2ONKA 5F2EA 4LCBA 4EDHA 2XTMA 1QVAA 2TMKA 3BFVA 4Q7MB 4A15A 1H8ED 1HURA 1IN4A 1NSTA 3GEIA 2Q9BA 5JCPA 2GXUA 3BB4A 1OYYA 2F3RA 3K70C 2MMCA 1OPXA 4I1OA 5FPSA 1ZNYA 1ZM7A 3MUFA 4B3CA 2IEYA 3H1TA 3OEED 1ZM4A 4FWIB 2I1QA 2F3TA 5DH9A 3WMFA 3TSOA 3GLGB 3LRPA 1P9WA 1EESA 1W46A 4R2HA 1VTKA 1Q57A 1XX6A 2B8TA 3SBEA 4JVNA 5KTYA 1LF5A 4DLZA 1FX0A 1NLZA 2RMKA 2IA5A 3GLGA 4RSGA 1ZJ6A 3SC3A 2AD1A 4KI0A 4F4JA 3K53A 4MDEA 3KQLA 1JB1A 2VHJA 1LS1A 3K09A 3FHTA 5CIWA 3QVVA 2PJRA 3NDBB 3T35A 2ZRMA 3GJ8A 3N5CA 5FTKA 5TMPA 3E5HA 2D2FA 3DVLA 4A8JC 1K6MA 2FGKA 1LTQA 3SHWA 2ZRGA 5B57C 2G83A 1JR6A 4AWXA 2J7PA 4U00A 1GWNA 2FGJA 2OBLA 4M22A 1LS6A 1TUIA 3KB1A 1NN1A 5AJYA 1W0JD 2RGBA 3I3SR 3NC0C 4IOKA 2VEDA 3GJ3A 1L2TA 2EYQA 1G3IA 3PEVA 3K0FB 3ECCA 4R2IA 5L3VA 3ETLA 1YZNA 4RZXA 1Q1EA 1IM2A 1S2MA 4C7OA 5KYKA 1NMYA 5DI3A 3ZIAA 4ITRC 1Z6AA 2B21A 2FN4A 1G19A 1KO7A 2Z6VA 4LJ6A 1E1RD 1W4CA 4JT2A 3FHOA 3ZLJA 3NBZC 2FSIA 5HR5A 1ZP6A 4IOJA 1ZD1A 5G53C 4Q1CA 3CPHA 4JLBA 1P2UA 5FBVB 1VCMA 4KV9A 1XXHA 3H84A 3PEYA 4FMDB 1PVOA 2J0VA 4G5GA 1XPUA 1QHSA 3IEVA 1E2JA 5E7IA 4TL8A 2KB0A 5FOWA 5JZVA 4LC1A 1II9A 2GILA 2FOLA 4JL6A 4MYHA 4PPFA 4F93B 1N5JA 4IFEA 1Z0IA 3DM9B 5FPYA 3GFTA 1WMSA 1E2GA 1DAIA 2V9PA 3MAAC 1DTSA 3T5GA 4EJSB 1DBSA 1RJ9B 4QHTA 1IXZA 4MRRA 3LDAA 221PA 4TL9A 5DO9A 4OHZA 1Q1BA 2IXGA 1W5TA 2QMHA 1NN0A 2V8OA 5C4GB 5G40A 2QAGA 1ZD9A 4KYUA 3WYAA 3SJBA 1J2JA 1X6VA 1US8B 3TR0A 1TQ2A 1BIFA 3IQXA 1EK0A 3GJ5A 1E4YA 1ZBDA 5FPKA 3Q85A
chains in the Genus database with same CATH superfamily
2OEPA 1RQ2A 3A1TA 4EHFA 2R7KA 3WRXC 3LMKA 1UQTA 4R2LA 4MZDA 4GM0A 2C5SA 2GZ1A 2ZYTX 3BUSA 3VYWA 4E2ZA 4F7WA 4ZYTA 2PL9A 3NTRA 4V0OA 1S3FA 1E20A 3DBRB 2ZPAA 3TIGA 1N8SA 1JV2B 2FZ4A 3SEFA 3ADBA 4UTRA 4DGQA 4DTCA 2O2EA 3RSGA 4WOKA 4AJ2A 1JRLA 3NTXA 4Y3UA 3GFOA 4QO7A 4FFSA 4GLJA 2GPWA 5FUWA 2J0UA 3RSCA 4LFBB 2IC5A 2O54A 1RRKA 3HEMA 2ZUCA 1EUDA 1BGVA 3N7AA 3AYZB 1EXDA 4KN8A 5HUHA 2XBUA 4FTWA 3INYA 2O8EB 5BSUA 1CY1A 1KIFA 4GMFA 1ZITA 2PGOA 1YMVA 1U5BB 1XB2A 3PU6A 2POQX 1Y5MA 3OE4A 4MIYA 5JE8A 4EYQA 5EJ4A 1OX4A 2XCIA 1EDDA 3NV9A 1QH8B 4Q82A 3LAWA 1A8SA 3BFPA 1LY1A 5BQPA 5HZGA 3AY0A 1KRHA 2D3WA 2GPAA 3P9SA 1E5LA 4FMCB 3FTNA 3WYDA 3I61A 2RG7A 1U99A 3DTVB 3PZBA 2WE7A 4D4KA 4EHLA 4REQB 1FVFA 5LDHA 5LQAA 3Q8WA 1FP6A 3GG2A 2AEMA 3PK0A 3A6HA 4A6DA 1PEAA 2AZ4A 1NBAA 4GBMA 4LN1A 4BAZA 4YNBA 5L7TA 4Z7OB 2EBHX 1NOIA 3BJMA 1TK9A 3MTJA 4L5CA 3UFXB 1MBZA 1RPZA 2B3TA 2P3SA 3CC8A 3ICPA 5A02A 3ZPXA 1V3QE 3FYUB 1PJAA 2JFPA 3ZHOA 1MU0A 3FMVA 2CV1A 1YQGA 4US2R 4EKDA 2BEUB 4GDFA 3REOA 1WKBA 2BFDB 3UPDA 3I01A 2R6R1 3SX0A 1NMQA 2GCOB 4FGSA 3EF1A 3TRFA 2JFXA 2P9HA 5FTMA 1C4OA 3BMOB 5JDCC 4Q4JA 3G8DA 5FUVA 4I1RA 2WWXA 3IP9A 4X1KB 2IYSA 2OPHA 4DWJA 4GL2A 1D2CA 2ZJ7A 4C89A 1WCYA 3GLKA 1KS9A 4D99A 3P0HA 1NBMA 4G1UC 3Q0TA 3RJ9A 3OD5A 1O08A 1QFZA 4TTIA 3SYTA 4M89A 4J0DA 4CMEC 5AKYA 3RABA 4TRRA 3ZHXA 3MOSA 1FRQA 1ZC3A 3MOIA 4CEHB 3RTBA 1XLTA 3BIJA 3IXQA 1UZMA 5C5EA 1KPHA 1O4VA 3FPEA 3W2IA 1JT9A 1R8YA 4HH4A 3AB3A 5BSRA 1NXQA 1A9PA 3B1XA 2C9MA 1GNVA 4JYBA 5AHXA 1FP7A 3BHNA 3DTYA 4KU4A 3TIVA 4EG6A 2VCEA 4IDCA 4OBBA 3O4HA 3NWPA 1VHJA 1ZONA 3QXXA 1UJNA 4Q3LA 4WACA 4YRFA 4LTDA 1SOAA 4UZSA 2ZS8A 2AMLA 3IUSA 3SF8A 1M3SA 3BHMA 5JAQA 2WD9A 1G8FA 3QIAA 3U31A 3I58A 4L7QA 2QROA 5H59A 5AVZA 1V6AA 1VFPA 1DC4A 1GZHB 1SD1A 4ZOCA 2CYBA 1LI7A 3CG0A 3PC2A 3ULKA 5AWFC 2J87A 4YMHA 3V4ZA 1Z6QA 1HDOA 1YBMA 1FX1A 3CUUA 3VH4A 4YEDA 3ZYCA 2BDUA 4ILKA 1LDGA 2GBCA 4KVGA 4YDSA 1T3LA 3KTFA 1Z37A 2OV8A 3B6JA 4M1YA 2QSYA 4ZOEA 1KMCA 5AKJA 3R9WA 4HGNA 1TRHA 1ABFA 3OCXA 2VDOB 3BRWA 3HXLA 5CYOA 1VSQA 4WZBE 2PZBA 1KTIA 1A50B 1RWPA 2R87A 1ZNXA 4I1SA 2M1ZA 2OKGA 4MWBA 1HT0A 1SJ9A 3K9LA 4WRRA 1B8VA 4V24A 4EFDA 1T9CA 1REQA 4G5YA 2P8JA 1EUQA 3HEAA 3GN1A 3T0IA 1NJ1A 4RVCA 3TZQA 1Z34A 3WWYA 1OROA 1FUEA 4HGZA 3WGLA 3AEKB 3V1MA 3PFHA 4ZZ2A 1PUJA 2C3MA 3EK2A 2PNFA 1RLUA 3TSYA 2H2GA 1Z7WA 1GZ3A 3M8KA 1PR5A 1X0XA 3SHQA 3D4PA 4IHQA 1OV6A 4ZYYA 5A62A 3FPLA 4IQ4A 4D80A 1PU2A 2E9SA 1EP2B 1Y4UA 3C3PA 2PZEA 3GNSA 4HVCA 2GZRA 4YRAA 3SSNA 2GN6A 4NOKA 2QJOA 3G9TA 4I5DA 4KACA 4INJA 4X84A 1WZNA 3WGYA 2C7BA 2R48A 3CRRA 1HBJA 1KKLA 3B3AA 4B8ZA 5DYYA 1YQ9A 1O9BA 2B83A 3WYCA 2WWVD 3J81A 1K5PA 1A8PA 1NNLA 4EAAA 2L19A 4IL5A 4GOKA 3UB4A 3GIWA 4PG6A 5AOAA 4OREX 4U7DA 3SEQA 2IH5A 1XMVA 4DILA 2EATA 2GRAA 4O4JF 2OYSA 4DQXA 2OBMA 1FPMA 1HE4A 2EDAA 1YQWA 3AJRA 3C97A 4X97A 4LDAA 3SDSA 1PVVA 2VZLA 1GU7A 2QUBA 3R44A 4DJAA 5L4NA 3VPAA 4TLDA 1LPPA 2HWKA 1KDTA 3UA4A 1X1DA 1TYDE 4LF6B 1E1DA 4MIKA 1IJEA 3RT9A 4ESOA 1GG5A 4FX2A 1OVGA 2PKEA 5LYJA 3OHPA 2XIJA 3TLAA 1G9XA 5DJ5A 4H3KB 4P36A 1XRPA 1W49A 2BZSA 3EA0A 3LDHA 2V58A 2QZJA 5A0VA 3PSHA 1OGIA 4KDRA 2NO7A 1K7XB 3UJHA 5TQ0B 4JYAB 2CFSA 2IXDA 4JYMA 2RGRA 4Y2JA 4OHYA 1NU6A 3IE2A 2Q5IA 1A69A 2X3FA 3BS4A 3CGWA 3JWJA 3BMQA 4D26A 1HDEA 1LSJA 4F1JA 2HMUA 4GKJB 3BE8A 5KVQA 2Z5LA 2GTHA 4P08A 4DXAA 1ZD2P 4LHYA 3HVUA 3VDQA 1JMYA 1I7QB 4AZSA 3ZKAA 4ZHQB 4ZQEA 4YV7A 4NS4A 1BROA 4A26A 4IZIA 2XGGA 5D7NA 1YA6A 1UPTA 1G2IA 2ZTSA 4FW8A 3RVNA 1G291 1UBOS 1GG8A 3AUKA 3NQ41 4UBIA 2V6FA 5AOVA 2FDCA 3RD5A 2Z4SA 1IZYA 3ZDFA 1C7ZA 2NU7A 2Z2JA 3A70A 3K6KA 4RXTA 1G38A 2VXBA 2PMDA 3LWDA 3IQIX 4GYWA 4R1SA 5DM1A 1N4AA 3FKSD 1EXNA 3HB1A 1NQWA 4OGLA 4YN3A 3K70B 4YAJA 3Q8LA 1XCGB 4FKMA 5H68A 2EW1A 1BDMA 1PG2A 1W6UA 2QT1A 4KFRA 4LYAA 2ZSHA 4Q7LA 5G3YA 3VU8A 5KJCA 4RADA 1I0IA 3DD1A 1V8DA 2J5BA 4MR8B 2X0FA 4B79A 5JSHA 4PWZA 2BFEB 2O20A 2QLLA 3ITKA 1VL1A 3UKDA 3KXDA 4MRPA 2W6PA 3D4IA 3FYHA 4YV0A 4P3XA 5LMNB 4EITA 2QPOA 5KKNB 5F9FA 1KK1A 1NVMB 1RRMA 3OO0A 3QNWA 4QHSA 1JGTA 1U8TA 3CXUA 3T9CA 1DNPA 1QF6A 4MVCA 5TVKA 5K0FA 2DJIA 1K27A 1MX9A 4G9GA 1PJQA 2ENUA 2A9JA 2GGSA 4XGRA 3PP8A 1V3VA 5HUQA 1M6NA 3QF4B 4MS3B 3KYCB 4TSRA 4PHCA 1VPTA 3I5XA 3WLJA 3JSAA 4GZMA 4J3FA 4LX8A 1G8SA 3GRYA 3VZQA 3O2SB 3CLTD 4FMDF 4TTPA 3ZI7A 4OHKA 4B3DA 5BSVA 1FJXA 5KSPA 1RWBA 2CHFA 2QVCA 3GZNB 3RC9A 1IOZA 3UC9A 2FG6C 4UXIA 4KRFA 3GCGA 1D1PA 1KI3A 2VIIA 1JBKA 2YY7A 2VXCA 2ZYAA 4E5DA 2BR4A 3CKMA 3HSYA 2Y1EA 4IIHA 3R75A 4BVGA 1DFHA 1FBNA 3GLHB 3HCPA 4RVDA 1CZLA 3NOVA 5EQFA 5KTSA 3O38A 3A4VA 1C2TA 4UAVA 2WQZA 1V1RA 1UKEA 4GHWA 5FPQA 1OWOA 2AMVA 2KLBA 4CMIA 2ICAA 2BONA 4XCVA 4NFHA 1F7UA 3R6DA 2ETXA 4KN5A 2HIGA 3IOYA 4C0JA 4LRTB 4ALJA 1IPFA 2JC3A 3MQ2A 3CHYA 4A82A 2N47A 1V5IA 4JC5A 4ROSA 5L6MB 1Y4SA 4GWKA 4LZWA 4UM9D 2M6KA 1WCIA 1ZGZA 2OFPA 2ZUDA 3A6KA 4YC7A 1H2YA 1GSHA 2V1XA 4OHBA 3GDOA 3VJMA 1ZRMA 5IAJA 3LZ6A 4QJ4A 4M8NE 5CB0A 2FSPA 3N3BC 3O8OA 3B7PA 4YLGA 3BWCA 4KBFA 4JL5A 1P0IA 3CLSD 4ZAYA 4OAQA 1PGPA 2IEBA 3KL2A 4AXBA 3JWPA 1R0LA 1ZM2A 3PE6A 1TYEB 2XGMA 3IE1A 4M0CA 4KQGA 4QUHA 4EMTA 3DBIA 3I4CA 5GGYA 1NVTA 4BLVA 3QXCA 4KB5A 5JALA 5F33A 2P6OA 3H13A 2CDAA 3VSDA 1VOTA 3OX1A 2X6RA 2FE1A 2H1RA 4RA6A 1RQXA 4O4IB 3VR5A 1KOJA 3JQ8A 4OGWA 1AUXA 2GN8A 4TLCA 1FMLA 1NMXA 4PG4A 5TSDA 4A1FA 2X5JO 3IDZA 3HY4A 3PIDA 4TMTA 5B6IA 1L9XA 3QWFA 1HK7A 1QQTA 3KVVA 2BEVB 3UJAA 4W4TA 3E9ZA 5EXXA 2HR1A 3PPYA 5ENVA 3BXXA 5B1HA 2A35A 2CUTA 2ZI6A 4RDHA 4UFOA 1N5LA 2CXUA 5C8YA 1WSDA 3GBVA 3AX6A 3FLEA 3GPCA 3RAPR 5FV4A 3KDSE 1COZA 2ZXFA 3CSSA 4LTNA 1I1HA 2C82A 1XWFA 4L3OA 4MMZB 3O6VA 4GD3Q 4H2DA 4N0EA 2P2NA 4B7CA 2ADMA 1P73A 3ZLBA 2OZVA 2Q6VA 1IHOA 1Z0ZA 2P0YA 3EGDA 5GWXA 2HSEA 1T2UA 1I4DD 1DFIA 4EA8A 2UZ1B 2XVYA 4YCDA 3SM3A 3VDXA 3D43A 3EMBA 1YR2A 4KLZA 3SC2B 4K9OA 1EDBA 4IDQA 4E2YA 3WLRA 1XVLA 2OXCA 2Q27A 4OIFA 3FVVA 4FYWA 1THGA 2FWRA 1MDBA 3GCZA 2HRQA 3N2KB 4AX8A 2OZLA 5G0SA 3T5PA 4CF6A 1Z6ZA 3CBGA 3FFBA 1SIUA 3KD3A 1RWNA 1Z2NX 3C5VA 3M34A 3SIXA 1NZFA 1J25A 2P1ZA 2QSZA 3RLIA 4BVJA 5J4KA 3OFND 2UZAA 2NVUB 1EA7A 4MOWA 1WB9A 4G1EB 3MWYW 1OYWA 4GW3A 3QXHA 3VR3A 1AS3A 1PUXA 3DP7A 5HPYB 1DTWA 2CK3D 1E79A 5GVSA 3EVAA 4YFYA 3RW9A 4UNQA 1ZA1A 2UV8A 4A6PA 3HRKA 4YRIA 5K8UA 3RH0A 1DX9A 4RK7A 2Z83A 5H70A 3THSA 2PXCA 3D4OA 3VZCA 4BRUA 4NCAA 3RGWS 1DEHA 1H3NA 2RGNA 3KVYA 3DBOB 1VLMA 1XZLA 2JHCA 1O9GA 4BVHA 1Y6QA 4CCYB 4O8CA 3W6ZA 1JF8A 5JSQA 2WHEA 2R5NA 1HLPA 1X39A 4KQ9A 3RUCA 1USGA 4MA5A 3EE6A 3JQQA 1JHVA 1COWD 5CHEA 1QTNA 3MMXA 1O95C 4EKYA 1VJDA 1L5MA 1U3DA 2RSLA 3AM5A 4BBJA 3IB3A 3IODA 3VOBA 2EJBA 1P5RA 4ZZ0A 1MTZA 3HHEA 1FPQA 5DNAA 4IDAA 3AONB 5KTTA 1GUBA 1PE0A 2ZTVA 2FP4A 3OUTA 4L08A 2W2XA 4ZTUB 3DAFA 2XUOA 4OLHA 4BNXA 4J03A 5K0ZA 5LB2A 4II3A 1WXEA 3HBLA 5DDIP 1GQOA 2CD9A 4FONA 4FFOA 3M49A 1T0JB 4S1OA 3UFBA 3ZHZA 4EEXA 3W5CA 3CLVA 3FTQA 4ZI5A 3UWDA 1W4LA 4RZHA 3FBGA 4ZCPA 2IPMA 5JO9A 2O8DA 3TD9A 4JA2A 4NS1A 4NONA 2CBZA 2J5QA 3SHVA 2H1WA 4E1VA 3NHJA 2MMGA 4TLMB 2V6MA 5I7EA 1Q7BA 1S5PA 3VI4B 2VJOA 4FZJA 4YK7A 3WK7A 4B32A 3QA9A 4HWRA 1OIXA 3Q0EA 1WZIA 2JIMA 4RFVA 4NCHA 3AR2A 3VJLA 3PT9A 4KR0A 2W43A 4BNDA 4HLCA 1W36D 5K3AA 2WTXA 2XNHA 3H2SA 3HBNA 3JYLA 3Q2OA 4FWBA 1CT9A 4UE2A 5CURA 3OJFA 3B9BA 2C88A 4EEZA 1G9TA 3ET5A 3VZRA 4MUGA 1E6KA 2VQSA 1D2GA 1J0CA 2X0EA 5KOHB 1EWVA 2BGGA 3TNLA 3ADPA 3HN2A 4TXNA 4UUOA 5DZSA 1RQPA 5F9HA 2BHNA 3P0RA 3IBGA 4IH1A 4FDMA 1PR0A 4EVSA 1FMFA 1TAHA 4ZC1A 4IKEA 3ENNA 3QPBA 3ZK8A 4EF6A 2IXBA 2XUPA 3K9CA 3CNHA 2YYSA 1XKQA 3SXJA 4U2BA 2E4VA 3JALB 4LBWA 3ZNOA 5D3QA 8AT1A 2V6IA 5CG1A 2EIHA 2C1ZA 3B78A 3CF6R 3LCUA 3OEWA 1C1DA 1SCDA 5E3IA 3S44A 4Q5IA 1ZESA 1EGVB 2GS9A 2I6GA 3FMGA 4BO4A 4V02A 1O94C 4YGXB 1KTVA 3G1WA 2ZWMA 4HY3A 4ZJZA 5A4AA 2CC2A 2NXJA 3E22B 5CVCA 5JS6A 1LFDB 1T5SA 2OOKA 3NS7A 4Q7QA 1SMKA 4KRGA 1U4SA 3T1OA 5AVYA 1PTKA 4FN4A 4IKPA 1LTHR 1M2WA 2RGDA 3AO0B 4QOGA 3ZNPA 4CZ2A 4YECA 2XCRB 3HXOA 3V9AA 4LBYA 4HDSB 1X9HA 4HDMB 4ZXFA 1CUSA 3BFJA 2RGAA 4OUDB 3T99A 4HDNB 3R8CA 1S3IA 2RH4A 2WTBA 4JSTA 1XJ5A 1K9SA 2I7CA 3DWIA 4P3NA 4B9EA 1Z3IX 3NBFA 1RYYA 3UAWA 3IJPA 2PXXA 3WLEA 2EKPA 1HEIA 4PXSA 4DJDC 5BY2A 2NM0A 4Y1RB 4Y1GA 4Z2AA 1A82A 2W2KA 3LQRA 2QM7A 5DTMA 4QJ3A 4ZZ1A 3EF0A 4E2FA 1ZOSA 2ZRBA 4Y6PA 2YIVX 3X0DA 2IYAA 1BE0A 4LVNA 3U17A 2ECKA 1T2AA 2OCBA 2UVPA 1IAQA 3C14C 3W3AA 3LUJA 2A57A 3NG1A 5FOXA 1PX2A 4A6XA 2XUIA 3SK0A 2J08A 4H7IA 1QE0A 1L1QA 2WTMA 2K2WA 4NFSA 4Q4AA 3ORQA 5A4MS 5HJ5A 3AM1A 1EVYA 4MGHA 3EEBA 1HE3A 2X14A 3NHPA 1S0UA 5JVDB 9GPBA 1V4BA 1XL1A 3U49A 1C0LA 1CTQA 2BCJQ 1Z0KA 2JGJA 1PD1A 4FFPA 4MRSA 4MI9A 5C0OE 4BX9A 4POAA 1Y1RA 5IK2A 1KDZA 4BNTA 3IEUA 5ESWA 5LA6F 3T9FA 4PXYA 3RUDA 2R6JA 1XTVA 1TM5E 4Z7JA 5BUSA 3LT5A 4X8LA 4PO8A 2IIBA 4HLQB 3AY6A 3G0BA 5F4ZA 5IXYA 1GUZA 4HAUA 1CUIA 4B85A 2IJGX 2NQ2C 3T5BA 1DIOB 1NSFA 2FPSA 4WZBB 3NIGB 3A37A 1ISIA 3LBYA 3NHAA 3U6KA 2OP0A 1E1QD 1W87A 1P18A 4R7GA 4AJLA 5LL6P 4FYKA 4Z0PA 2QJWA 4R31A 1T5BA 5BSWA 1N3YA 4JD5A 1E1CA 1H4VB 1QZUA 1XCJA 4IGFA 4IOLA 3EIWA 4L8GA 3WE7A 3THYB 1MG0A 2OD2A 3QQ5A 4CKEB 1XEFA 5KX5B 3ZUGA 3AHCA 3MLBA 1J97A 1V1RB 2GEVA 3PEUA 3S68A 1HXHA 2XXAA 2QAIA 2FW9A 3H5AA 1FS5A 3Q3IA 2EFHB 2NYAA 3C74A 4JJFA 3NTOA 4WESA 3NXSA 4WADA 5AJXA 1LJUA 4XM1A 1KI6B 1CDEA 1V43A 1Z3CA 1C8KA 1TK3A 2OFXA 1QU3A 5CIQA 1T2CA 3A3YA 4R5HA 4E4YA 1T8YA 2BTEA 2Z6QA 1A4UA 2R8RA 3AKEA 3PDJA 5F3DA 5J1SB 2UZ0A 5DSZA 2F3QA 2ZB4A 1P4RA 3RSOA 3B38A 4QGAA 2ES4A 2JVIA 1YS6A 5LP1A 2WIAA 5AICA 4FILA 3ZGYA 2C4VA 5JU6A 1MC4A 2QRJA 5C1OA 4ANFA 1BSVA 3GUHA 3HO6A 1DBWA 4KQWA 2RH5A 5JPIA 2JI9A 1E5TA 1IY2A 1AGPA 4HQOA 3PS9A 4MVJE 1TL7C 2L0XA 5CDFE 5LIPA 1GV1A 2H7XA 3O5AA 4IR7A 3A0UA 3JD4A 4D3DA 3SQXA 1KMMA 4I50B 3O2QB 3MVEA 1JJ7A 1Z2AA 5I47A 3KAQA 3VKWA 1BXZA 3R5SA 1QONA 3GROA 3ZK9A 2YBEA 5DHUA 3VR5H 2C00A 2BI4A 1PJ2A 4J7AA 2QYSA 1M54A 2DF8A 1X7HA 3TAXA 3CNNA 3ZWNA 1MQAA 4UEJA 1IG0A 2ZIAA 3OZRA 5LNK1 1M8PA 2EF1A 2C0PA 2YQ4A 3IHKA 3M1LA 1J24A 1ZH0A 4KWCA 2C5HA 4RQBA 1LI4A 1O1YA 4C4OA 1H6DA 4RE5A 1KP3A 4I4TB 5DNCA 1CQJB 2N46A 4X94A 4IIJB 3VC7A 3E9NA 3K9QO 3M2TA 4YPVA 1W4BA 3GJ4A 4X3OA 5FDFA 3CF2A 2AWOA 5D01A 4CLEA 1T91A 3L02A 4MYUA 2WUWE 1TXGA 1ODFA 3LC0A 3M9XA 3MS4A 2C92A 3FJ1A 2GD6A 3NNNA 4LXHA 2V74B 5B7PA 3KX2A 6REQB 3TKAA 1JFVA 3P9IA 1RYMA 2J5KA 4DCMA 3TKYA 3GRAA 2QZZA 3AWDA 3L7NA 2GFQA 2OB2A 4QD3A 2CHUA 3B1VA 2ZT6A 3HABA 3NHYA 4ZAWA 1UODA 4WA7A 3WNVA 3O94A 4JXKA 1D3AA 2YFHA 1GUAA 4BGEA 4DYVA 1LZKA 3WL3A 3PNSA 3T3HA 2PUEA 5ENZA 3SC4A 3Q88A 5EG5A 4XIGS 4YCSA 5HKKD 1X92A 3SICE 2IUTA 5TXGA 3ZZUA 1XPJA 3KLNA 3CBQA 3EEIA 1YRAA 1RW4A 1YDGA 2CB9A 2JHGA 3IILA 3JVVA 2BH2A 3UUFA 1A4XA 5CYPA 4DKJA 4LGYA 5DCUA 5D85A 1EK5A 1Q3HA 3LQKA 2GJAA 2XRYA 1T5TA 3MW8A 5B1IA 4BVEA 3PQ5A 2IBMA 4P0PB 4FEEA 5EYPB 2JANA 1BAPA 5C1PA 5FPTA 1QHNA 2OBFA 2QUIA 1J5EB 3DBLA 4MP6A 2ZCJA 5H83A 3DONA 5EN4A 1MW8X 1TU3A 2ZUEA 1YXMA 5M29A 1AV6A 4BQFA 1U9YA 2O2SA 4ZARA 1A8HA 3CWQA 1WBDA 3OM8A 5LOVF 3QEBZ 4E1BA 1Q0HA 1UMBA 2IE8A 1G17A 1S96A 3RYFA 3OESA 3H86A 3FRIA 1K06A 2QI9F 1K7CA 3K30A 5EMMA 4IUBS 3ER8A 2IOFK 4F9GA 3W4KA 1JAIA 4NYJQ 4RJLA 4F4FA 5FHQA 2ATCA 3ABOB 3F98A 3KWLA 4OJQA 4CF5A 1TZKA 4U9IS 1QE3A 4LXUA 4QRDA 2VP3A 5DLYA 5HTKA 1NJ5A 1UBUS 4RC9A 1K7SN 4IOMA 5HNKA 2CLCX 3ZTYA 1LZLA 4TS1A 3LS2A 1EUDB 3X1YA 4V0ME 4ZZ3A 4PF1A 4ZMSA 1E89A 1KRWA 2OSBA 2CJXA 3HU1A 4PGAA 4FEAA 1RM4A 1DTWB 1U9IA 2QMZA 3AFNA 3TQFA 5C2JB 3N5KA 3TR6A 4PBTA 4AG6A 4OK3A 2GJ8A 3L7CA 4XWAA 5F5LA 2GQ0A 4F6RB 4PNZA 1X3LA 4DV3B 3JQCA 3F7TA 2H5LA 3I6QA 4INZA 3WO1A 5IBRA 4YQEA 3VVLA 4TLEA 2QT9A 3NEAA 2FOXA 3Q72A 2WUDA 1IH8A 2AUTA 2FFRA 4RGYA 4YCAA 5CIYA 1KDRA 4PSAA 1AF7A 4R1TA 3ZHQA 1PX0A 3UK7A 2O59A 1CRLA 4OAPA 3EUEA 1X80B 3LI2A 3MJDA 3ORRA 3VNRA 3VO2A 3FAKA 1UBFA 2H51A 1E3EA 4I6JA 2VG8A 5C8VA 4F5YA 3EUAA 3I9FA 3I9V1 5CK5A 1PKEA 1S8AA 4XB2A 4ZREA 4CIXA 1X8JA 4LIPD 2REBA 2ZSFA 4XWGA 1LCIA 1R8XA 2FQQA 3EASA 4IS3A 1X70A 4AZ3B 1T9AA 3FTEA 3VKHA 1E58A 2WNIA 2YWCA 3N28A 1AD2A 4IUYA 2WJ6A 4GX2A 1T1IA 1WZUA 4P7JA 4TTQA 4IQ8A 1UBJS 3TBKA 5JO0A 2YW9A 4HNRA 1BWQA 2ZAGA 4LYHA 2E89A 2ORYA 2V4MA 3GN2A 4M37A 4IIJA 4RVHA 1L5RA 3RS7A 4CNQA 2AFHB 5AUNB 2WTUA 1VE7A 4NABA 4B4KA 4DDKA 1WMAA 3WYBA 4ETMA 2C9CA 3GRUA 5KYWB 1NNEA 5HXAA 1Y9EA 4CEIB 1CULC 3JATA 4C4XA 3IAUA 1TC2A 1DKLA 4ND8B 5CXSA 1DHTA 2PKRA 4M6WA 1IATA 2WVJA 3DZJA 1V3UA 2NTEA 1JHZA 2DQKA 2XUAA 3D0KA 4QDUA 1K63A 2V6JA 4DADA 5F76A 3EMDA 3OZTA 1L5QA 4O33A 4BVLA 4DNQA 2QYTA 5IKPA 1XE3A 5ECWA 3PKIA 4Y6RA 4D0GA 3VSEA 1F17A 2NSHA 4CLOB 4X62B 3ZCVA 1EEHA 2O14A 1XHFA 1S7GA 2A92A 4G84A 3R9IA 4UPEA 3PYMA 4OHCA 3IR5A 4XSGA 4QTYA 4R81A 4HN9A 2P4EA 3TL6A 1ZIXA 4LZJA 3TFWA 5JS8A 2WA2A 4OQDA 1IWOA 3F1LA 1L7DA 2ANBA 1K5GA 1UZAA 1G21E 2DZDA 1CE8A 1NY5A 2IKSA 3C6XA 5HF6A 4BMDA 4QDOA 3LX4A 2P68A 4K0KB 2GFIA 2AOUA 3B7WA 1V47A 4RVUA 4LRUA 1G42A 1CQIA 3DHVA 1UANA 3MINA 1QFXA 1Y34E 3IELA 4EAQA 1T13A 1CJUC 2WG2A 1CEQA 5F51A 3ROEA 4JJ7A 4HEQA 4DRZA 3OD1A 4GQAA 4XR9A 1TJYA 4ZOLF 4B2IA 2PZMA 1HDCA 2NTVA 1YOBA 3KHSA 4QX6A 4BFTA 4CLDA 4EJ0A 4N49A 3MWGA 4OYLA 4EL5A 2B6HA 2RDMA 3CRMA 4OQNA 1KSGA 3EQ9A 2Q6IA 3Q6MA 3CZCA 4MQFB 2DEUA 4GBGA 2AOVA 2UUAB 2V4UA 3UT5B 1KJ9A 3EOBI 3LZDA 4MQ5A 4OQXA 1W0KD 1NNUA 4HXEB 4NECA 2ZYHA 2YINC 4NPCA 3CURA 4RD6A 1XKXA 3OZSA 4MJLA 3E3OA 3LPCA 3RVKA 2VJMB 2JIOA 3MGKA 2AJBA 3L4JA 4EKIA 4F11A 4ZYLA 1Q83A 3QX3A 4FDAA 3RG8A 4CV3A 5K5EA 3E9DA 1HRDA 1RKXA 3MT0A 5AKLA 3NEYA 3SIWA 4Z4QA 1NPTO 4QGHA 3AZOA 3NH6A 1PFWA 1YT5A 3KDAA 4PYIA 4Q24A 4RKQA 3S99A 4EPTA 1M1ZA 4CEJA 5CLHA 4G81A 1E1CB 4A1OA 1HKUA 4DLYA 5YASA 2Z0MA 5A4KA 2Q5OA 1X77A 2HLHA 1GQRA 2ZYDA 3LJKA 3PJEA 4PQEA 1XRNA 2PIDA 4M1MA 3G6KA 1WXHA 4DIFA 3SNHA 2ZITA 1JYSA 4LRXA 1YACA 2C4WA 2K4MA 3CZQA 5JS2A 2H57A 4DLVA 4CQMA 1BX0A 3MK31 4Y2SA 4KR6A 3EVTA 3KYIB 4J1TC 1QAQA 3HI4A 3P71T 3PQ4A 2QTVB 2LIVA 1PR2A 3REFA 1P39A 2EAUA 4Q01A 5CPFA 3DCJA 3SEZA 1JBQA 5HHTA 4RTKA 3DZHA 4CMKA 3KSBC 1L1RA 1MLDA 4TUYA 2AJTA 5D86A 2O07A 1ZNWA 3CW2A 3UVEA 1Z0UA 3EGEA 1H2BA 3K8QA 4ZRMA 3VJKA 2VAPA 1IUOA 5B5SA 5LP6B 5DV9A 1UKAA 1FFWA 4MV1A 2YJZA 3ER9A 5HTOA 2GZAA 2YC4C 3LDUA 3O75A 1P91A 3QM1A 4HRAA 1L0BA 1KPIA 2DBYA 1JR2A 5E8JA 1M1YE 1PFKA 2DRIA 2IVZA 3P9KA 3QYJA 3G8CA 3E05A 5BUCA 1F2VA 2YXBA 3BCSA 1YJAA 4H17A 2XVMA 4CKEA 3NT5A 4RH0A 2CEKA 4U02A 3X1WA 2VRBA 2R47A 1MN6A 3D4LA 1COWA 3L06A 4MGKR 5GIOE 2AZDA 4Z1MD 4BVBA 4JX9A 1XFDA 4RS4A 4XA8A 1AGRA 1SC1A 1UMDB 2V5VA 2ZW9A 2O7VA 3D8UA 2ONJA 1OHHA 3Q7IA 3CH5A 1GRQA 3C5EA 4GM4A 5ALZA 5DHFA 1AS2A 1V16B 5IKXA 4PYMA 1H6CA 1T3SA 1XQYA 2EBFX 2NSJA 4XVRA 4IIBA 5E1BA 5JZSA 3E3AA 3UPUA 1WPRA 1GA6A 1QV9A 2H1LA 3BREA 3TLGA 5BVGA 1KYXA 4MUAA 4OF4A 1NZDA 4RXMA 2IL1A 2Q2NA 1SGWA 2Y1FA 1KHTA 2WWRA 2XRMA 2WQ7A 1KU6A 3N2GB 4BP1A 1YU9A 3FSGD 1XL0A 5TS3A 1NC1A 2X0DA 1GLNA 4MLDA 4GMDA 4WFJA 2VZ0A 3FDXA 4YCJA 3F78A 2WHXA 3KXIA 1GPJA 1V2HE 3VYRB 5BNTA 1B73A 1KXJA 3ENWA 3L6DA 3RS5A 4IGKA 2ZRAA 2R5FA 2HA7A 5FKJA 3U19A 4U2KA 2O8CA 3E9CA 1LTKA 4DV6B 3L0CA 1BW9A 1INLA 2IPLA 3HJBA 2FWIA 3KZXA 3R3SA 1P33A 4TROA 4WV3A 5HFAA 1NT4A 4ACAA 1AHNA 1WSBA 4MLCA 2B3DA 1M74A 1YBFA 1ZK1A 3G89A 2BFBB 5DXJA 3WLKX 1DVRA 1XQ1A 1U9ZA 1HE2A 1ZH6A 4DCNA 4AKHA 2HK7A 1EI9A 1Z88A 4FNOA 5EMLA 3D3WB 1JWBB 3ZDAA 5HRAA 1GUDA 5I7SA 4GYKA 3A3NA 1W1IA 1MA0A 4FHCA 1ISFA 4QYMA 4GWGA 4G41A 4QYXA 2J09A 2JFBA 4N5NA 5F3WB 4EO9A 4GQBA 4NHOA 2CDCA 1NOKA 4OHWA 4PLWA 1O96B 1Z25A 1RZ3A 3EWIA 4UKDA 4BDTA 3TB6A 2XKAA 2CXTA 4QXMA 4BQSA 2P3OA 2BPOA 2GPYA 3ITDA 2W11A 5CH3A 3LIIA 5I7FA 4C4YA 1QRTA 4I55A 4JAVC 2NP6A 2FRXA 2I9PA 3BXFA 1N1DA 2IY7A 4ECAA 4N0DA 3JQEA 2CDBA 5BSFA 4QA9A 4F96A 4IWYA 5CT5A 4I3HA 2PMEA 3L8HA 3FSRA 1E7MA 4UULA 1ZBQA 4GFDA 3RDPA 4AG3A 4ZCMA 1E2EA 2E4YA 2J07A 4P4TA 4M9XA 2A5DA 1MABB 3CQ9A 3EVEA 4QXOA 5JMWA 1FJGB 4KX5A 3D6JA 3HCFA 3R5TA 3NETA 2HW8A 1LLUA 2EX1A 5B58C 1C0KA 2AI2A 3H1PA 4QASA 4D02A 4WXPA 4E30A 3QYAA 2AK3A 4M3NA 5BOVA 4DVGA 4WKPA 1L5OA 2MT9A 4EATA 1UPBA 5KOJB 1QYRA 4LYGA 4RTJA 4MRAA 1N7JA 4G67A 4KE8A 1U9JA 4AULA 3N75A 4OKIA 1CKEA 4HCJA 5CNJA 2YXLA 3WV4A 4LSMA 4DCPA 1KJJA 3KIPA 1OZAA 4MKZA 1ESZA 1DIGA 1SCKA 4UPVA 4WAUA 1XZHA 2KWIA 3ENKA 5DB4A 4B82A 3IQEA 3C3CA 3DFIA 2Q21A 1S2IA 1L5HB 4XCXA 5AQEA 1YB4A 1G5QA 1WW3A 1E2UA 3JQBC 3EFHA 5EC8A 1DCTA 1ULUA 1JS1X 3E82A 2R8OA 3HL0A 5DNDA 2DXIA 3OIVA 3DDZX 3EARA 4IFTA 4QDZA 4UOEA 1SN7A 4LE2A 1J21A 5HIMA 1QH1B 3V4PB 3F7NA 1P5JA 2HD4A 4RCZA 3TDNA 1RE1A 1AKYA 2A9PA 3E7DA 3EH2A 2V8BA 2BMWA 3BYZA 1NHWA 1CZRA 2EP8A 1SOWA 1SQSA 2XH8A 3B1ZA 3QPUA 5TQJA 3MC1A 2ZB7A 1RHMA 2YW2A 2A58A 3BGIA 3DUFA 4GZLA 4JVOA 3RYTC 2AMFA 1X7WA 4DLXA 3L0IB 1M6HA 3A25A 3OCUA 3ZS8A 1AMNA 3DFFA 4QUBA 4HNVA 3R7WA 3R0JA 3AF4A 4PO1A 4R2KA 8MHTA 4UDOA 2WBLC 1G20E 2XXBA 5A1TA 4LJLA 4C6TB 4MI3A 3FZQA 3K2IA 4EFLA 5K3EA 3KUXA 1NJSA 3CZ9A 1ILEA 1RPJA 4XLZA 3PA6A 2CGEA 1W0CA 1MJGA 4UHKA 1OR8A 4RE6A 3VR2D 3YASA 4HUJA 1IJFA 5EJ8A 2QRZA 1SC9A 2I3AA 2YHUA 4KPUB 1IZZA 1E9SA 1UZLA 1XIVA 3ADOA 1TJ3A 3I76A 3NJ4A 4E5UA 1HTWA 5FWXA 1IMJA 1X80A 1ZO8A 2HN9A 4AY4A 2XB8A 5EINA 4I99A 4AMZA 2OO5C 4RCVA 3ST7A 2H9YA 3I2HA 2HF7A 1QHHB 1ULBA 4J29A 1AQIA 3AV3A 4J6EA 4LQDA 3IO5A 4Q00A 1DWQA 4A8HA 1QQ5A 4H0FA 4NMHA 4D8XA 2C4TA 4GPZA 1PT8A 2FFAA 2BF7A 1JZSA 2F43B 2ZQYA 3T1TA 4MP3A 1UPAA 5BRNA 4C30A 2X15A 1RRCA 1OH6A 2QENA 4AP5A 3EGCA 4GGOA 3W8RA 3KPVA 5ESXA 3AUFA 3OJOA 3HV0A 4IV0A 1WCXA 3A11A 4WBXC 4B3FX 5AQ1A 1BA3A 1HQYE 2BRUA 3GFGA 4PSVA 5CVVA 1CBUA 5FTNA 1OOEA 1NF3A 2ID9A 1RSZA 3OTHA 2P6UA 5EIWA 3SCZA 4WKBA 2H7VA 3A28A 1MD9A 1VL5A 2VWHA 5C34B 3S5JA 3T5CA 3M4ZA 4UNSA 3ZE9A 5B55A 2V7QD 4Y2YA 2BUBA 4AS2A 3UV7A 4B5KA 1P75A 3ZEAA 2OCLA 4M1SA 2FPOA 3FDJA 3C1OA 4EPRA 4QULA 4PG7A 4D2IA 3I52A 1MV5A 5DNYB 4AJIA 3PSAA 1DUSA 3DUFB 1XD9A 5CCDA 1IOVA 1VXRA 1EWTA 4MMYB 4ND6A 4Y2PA 3QPDA 4PX3A 2QN2A 4C01A 1CNMA 4MICA 2QPLA 2ORWA 2ACEA 5C9ZA 1G8GA 1IHXA 2DFPA 1T8SA 1R0BA 3QVUA