4KFTA

Structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with atp-gammas
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
195
Chain Sequence
MNPDDIVVLVGRKKSGKSYLIKHYFIPVLKAHKISYIIDDHNSEYSKFGYNATSLSDIVSKQYVVVYDDFFEKLWQASKLHSKKYGTTVLIIDEAYYHFKYKQKVTPAIDEALHANRHAGLGLILSTQRVYDLMPIVYKQADLIIMFYTREPNELRWISKYISAEAAEKVKTLKQYHFLIYDVNSQTIKIHKPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome packaging NTPase B204
publication title The Structure of the NTPase That Powers DNA Packaging into Sulfolobus Turreted Icosahedral Virus 2.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus 2
molecule tags Hydrolase
total genus 63
structure length 195
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 3.-.-.-:
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kftA00
1G8HA 1A82A 1OKKD 2X77A 5BW8A 5IK2D 1UBFA 4CEHA 1UADA 2JIZD 1ZUNB 3B6EA 4G0NA 2AKYA 3PUXA 3ZVNA 5F2EA 3SS8A 1J8YF 5KUTA 4WXPA 2REXB 2J87A 1PVOA 2QTVB 1XTQA 2KBFA 4A9AA 3SE0A 4TYWA 4PX9A 4YC7A 4B2PA 5AJYA 2O8FA 3ZYCA 3AVUA 1MABB 1VYVA 2WWGA 3GCGA 4LC1A 4WXRA 2D74A 3VU9B 1FQJA 4L16A 1GRRA 2C98A 1XPRA 1G5TA 3RSLA 4GL2A 2IUUA 2DPXA 4Q7MB 1NBMD 4JYBA 4DSOA 3I32A 5KPDA 3C14C 1ONBA 2C77A 1Z6YA 2BC9A 4M8NE 4URVR 3AVVA 2YWFA 4V0ME 2IA5A 1GVNB 3FMOB 4DZZA 3LH5A 4CEJB 1P73A 4B3BA 1VMAA 1KGDA 5E95A 3T5DA 4D4JA 3A8TA 3FHTA 1WB9A 1H8ED 2Z0MA 1GL6A 1XD2B 1KK1A 4JLBA 3FWYA 4PSKA 3DVLA 4TN1A 3KJIA 4K8OA 1VKJA 3L2OB 4DCUA 5KTYA 2OLJA 4A0HA 1DE0A 4ITRC 1XEWY 2JIZA 1TF7A 221PA 4D0NA 5JJKA 3B1YA 4MGZR 4P32A 2QNRA 2YWGA 4ZI2A 2QT0A 1NVVR 3KFVA 1IN7A 1S2MA 4R98A 1TNDA 4G5OA 5EQTA 2VP2A 2FPKA 1NI3A 2JDIA 2O8CA 1K6MA 1Q57A 4ZCIA 1X3SA 2IS1A 2RB4A 3AVWA 1NSTA 2ZJYA 1UM8A 2ZREA 1Z0FA 1CJKC 1I4DD 2FJUA 3CH5A 4Y0VA 4YLGA 2RMKA 4NBSA 2GAOA 3L82B 1T3LA 5FBWB 3KQLA 3H1TA 1EX7A 3KKMA 2ZRLA 4W5WA 2RAPA 3C5CA 3TUZC 4X8LA 1CIPA 3LVQE 5FTKA 3U3RA 2ZSAA 3CM0A 4BEJA 4JYCA 2HYIC 1L7VC 4GZMA 4B2IA 3CR8A 3A6PC 4U5XA 5A0FA 4JLKA 1KKMA 3SJZA 4Z1MD 3SEAA 2IUTA 4BFSA 4KLNA 2V54A 2PMDA 5CDFA 3KTAA 2WJYA 5LD2C 8OHMA 2R2AA 3NBYC 3AB3A 2FGJA 3AV0B 1XJCA 4JLNA 4OYHA 4KFTA 4JBYA 4JLDA 4F4IA 1G8YA 3PFIA 2MMGA 1T0JB 4LX0A 2JAQA 4EFNA 2A3RA 2C04A 4PC3A 1G8GA 3C5HA 2BWJA 3QXCA 2IYLD 4IXNA 3KTAB 4M4SA 3LV8A 1G9XA 2OCPA 4U02A 2B6HA 2FN4A 2OCYC 4IEIA 5LBIA 2HJVA 4CT4B 2OFWA 5P21A 3FOZA 2VP5A 5H1YA 1ZP6A 4Q4HB 1XP8A 2BBOA 1QRAA 4M1KA 5LB4A 1UKEA 1I4LD 4W9MC 2BDTA 3K09A 3CRMA 1S0UA 4ZIRA 1NSFA 3BWDD 3GLHB 3I5XA 4RKFA 2J7PA 1XTSA 2J7KA 1A4RA 4IW3B 4AG6A 5KHOC 3PUVA 1ZVQA 3LWNA 1XDBA 2VYFA 3SBDA 3Q8XB 5F9HA 3IEVA 1KHTA 4HAXA 5IF9A 1NLFA 1BH2A 2HCJB 4TSFA 2FSGA 1FP6A 2J0UA 2F55A 3I62A 4V0OA 1CU1A 4WBSA 1FNNA 2W6IA 1YQTA 4A8JB 4PC7A 3D3QA 2O8BB 2QAJA 2D2EA 4RCZA 2DFLA 3RRNA 5JBQA 1Z0DA 4PC2A 1OPXA 2XGJA 1AGPA 2KE5A 2OXCA 4O2RA 1S3SA 2NO9A 2QM8A 2H8KA 1VIAA 2ZUBA 3EPLA 5TY0A 2BMDA 2JCSA 2ZTSA 3MWKA 3REFA 1QZXA 3LBNA 2GVDC 4TQ9A 2WIAA 2ZR9A 1MO6A 5HCNA 3P1JA 2FSFA 2O8CB 4C7OB 2RGGA 2ZIAA 2OILA 5DISB 3VAAA 4QBGB 3I73A 4XSGA 3OHMA 4BZXA 1PLLA 1HV8A 2H16A 5K8IA 2LCFA 4LJ8A 4N0EA 3QF4B 2O0HA 2CLCX 2XX3A 4B75A 1XZPA 2NOAA 3EWAA 5HCIA 5TV2A 1BS1A 4Q7JB 1OHHD 2Z4RA 3FFBA 1YRBA 1AN0A 4Q7LA 4NCJA 4UJ5A 5DLQC 4EQ6B 3K0SA 3ZQ6A 1HTWA 2G3YA 3KKNA 4TWZA 4YXWD 2OBNA 4Q5IA 3AGPA 3QOFA 2H57A 4DUGD 2IYTA 4GDFA 3PUWA 2IYZA 2WJJA 1S1MA 3X2SA 2GCPA 2FDCA 1DARA 1G7CA 1NY6A 4ASUA 4BFVA 4BZPA 4A2WA 3CPEA 1T6NA 4QBIA 3PEVA 4LHYA 2BJWA 4US2R 4JMPA 1ZIPA 4QGAA 1G21E 3Q85A 1N5LA 3CW2A 1IBRA 4Q66C 1COWD 3EPHA 1WQ1R 3RLFA 5C18A 4Z54A 1VHLA 1CR1A 5AJWA 1KYIA 3QBTA 1W7AA 1TX4B 2CLSA 4HAWA 3D8BA 3HWSA 3BIFA 3MG9A 3I8SA 1Z06A 2D7DA 3DM5A 2ZJAA 4RZ3A 4FMDF 3DKPA 2ZPTX 3TQCA 2R8RA 2CJWA 2EVWX 4WOPA 1G3RA 1XX6A 1MR3F 5IDVA 2CL0X 4EJSB 2O8EB 1KMQA 3WXMA 1LTQA 2YWHA 1KI1A 2F6RA 2ZI3A 1XCGB 4Q9HA 2X2FA 2PBRA 3TIFA 4KVAA 2PZEA 1NKSA 3ASYA 2BMEA 4LY6A 5EE5B 2ORIA 4EPVA 1YJ5A 2IYUA 1Z0IA 3PENA 3QI2A 5C1BA 2OFXA 3V9PA 4XWOA 4PC1A 2IX3A 1U0LA 2IF0A 1E2QA 1ZC3A 1XJ0A 1KKLA 3FHOA 4HZUA 4Z51A 2IXGA 3RDPA 2ZM5A 1G4UR 1FNMA 4IVRA 4H1VA 4OK5A 3ZGXA 3BFXA 2GZAA 3J81k 1A2KC 1TU4A 5C4GB 2Q3MA 4FN5A 4WZ6A 3GLHA 2OV2A 4X8MA 1P72A 1DAKA 2JDID 1D2MA 1E99A 1ZBDA 2CHGA 2VF8A 1E4VA 4BASA 2G88A 3ZIAD 4MRPA 2AWNA 1E0JA 1HT2E 3K0CA 2ZITA 3HJNA 1AQUA 2W2VA 3RYTC 5B58C 1H65A 3CR7A 5CYOA 3AP1A 1OB2A 4A36A 4LI0A 2ORVA 1TF2A 1E0AA 5BN4A 5L3QB 4XVUA 2REOA 2ZUCA 3QG5A 4C2TA 2NO7A 2VP0A 2DWPA 4PAMA 4RY2A 3ZJYA 4ERNA 4PTLA 4C0AC 1IXSB 2DCUA 3D6TB 3HU2A 3EZ9A 4I1OA 4JVNA 2PL3A 2QP3A 3RWOA 5EE9A 3IIKA 4OHXA 4IDPA 1DTSA 2VSFA 4II7A 4JBXA 4L5BA 2WOJA 3SJAA 2IS6A 1E2DA 1E2NA 1JJVA 2WKPA 3GP8A 5B64A 2OCAA 4HAVA 3ICEA 2P5TB 2VLIA 4TMWA 2AN9A 3AVXA 3E1SA 4A0GA 3ETLA 3VX3A 2PT5A 1W47A 1DAHA 4P4SB 3T35A 3QKRB 1Y3AA 1DAMA 1C1YA 3BH7A 5HR5A 1N2CE 4B3GA 2NPIA 1YR6A 4KJZA 2A5YB 3OFND 3QY0A 2G77B 2G9NA 3EC2A 2YKGA 3AF4A 1D9XA 4F93B 1W4RA 4LPSA 2V6JA 3N2EA 3TSOA 4LV6A 1GITA 3TAUA 3OIYA 3ZIAA 1JPJA 3PEWA 1QHHB 3EIQA 4LJ7A 4CEJA 3OESA 4Q1BA 1F60A 3EARA 1XD8A 1ODFA 3G0HA 4LJAA 5EXTA 4DDTA 1OYWA 3AKEA 4PSAA 5FL7D 3Q5DA 4M21A 1EFRD 3A1TA 2ZANA 3IQXA 3EPKA 2DY1A 2FMXA 4JSYA 3T1QA 4L4UA 2ZI6A 1EX6A 2EFHB 2FF7A 1DVRA 3E70C 3VR1A 3TK1A 2XNDA 4RD3A 2BKUA 2PJZA 1ETUA 4AURA 4PQFA 4CEHB 4BECA 1F2TB 4PZYA 3NBZC 3MLEA 4HLDA 4P31A 1N6OA 2PCJA 1E2IA 1R8QA 1XNJA 3KJGA 2I1VB 2IWRA 1HT1E 4TL6A 4NYIQ 1BOFA 4PAOA 2ZEJA 4HI0E 1N6IA 3VR5A 3MGCA 1A1VA 1E9BA 4CEIB 2AD1A 2Q9BA 2QI9C 3U3KA 4UXJA 5JJIA 1FX0B 2Z43A 4IOKA 4MUAA 2EFEB 5JFGA 1F48A 5J4LA 2QBYA 1DAFA 1FL9A 1KDTA 2CE2X 4OHZA 2QTHA 3UMFA 2VO1A 1AS3A 3FB4A 5J5CA 3ZVLA 4CIDA 3Q72A 5CLLA 4LRWA 2ZS7A 4OQNA 4M2LA 2GF9A 3T61A 4O25A 1KI7A 4Q03A 4A2QA 1KJZA 3L0SA 3T5GA 3CWQA 5FPTA 1E4YA 2H92A 4GT1A 3DDCA 5DE3A 2F9MA 2IBMA 3I72A 4WW0A 3RS3A 4IOLA 4OK3A 2GCOB 3B5JA 2D62A 1E79A 3QBVA 4PZZA 2CNWD 2RGBA 4HLUA 2WAXA 3MUFA 4RVCA 3R8FA 3GJ6A 5LPNA 2HJGA 2NQ2C 4QJ3A 1OHHA 2EFDB 4M1OA 1QDEA 1SXJB 2A5JA 2OAP1 2R44A 4MA4A 4QBHA 4XOIA 4QKQA 2FGKA 3H2YA 1W36C 1UKZA 3S1AA 2VQSA 3K70C 2QSYA 2JLQA 4DSUA 4JVMA 5CB6A 2QRNA 3T15A 1CEEA 2DFNA 2EU8A 2GTPA 3UMRA 4FCTA 3RRMA 3CKLA 3VU9A 2FEMA 1RYHA 5SZKB 2ERYA 1OH6A 4LUCA 1H8HA 3GLIE 4NKRA 1E32A 4D4KA 4M9QA 2BBWA 1YE8A 4MUBA 1JECA 3BRWD 5KO2A 1QHIA 4LJ4A 2D3WA 2GJ8A 3TNFA 1IOZA 4F91B 2VHJA 2LWIA 2PCLA 4HUTA 1N5IA 3RHFA 2GBLC 2ZRKA 5FUVA 1W1WA 5FTJA 2P2LA 1T8UA 3KUCA 4Q1FA 3BFKA 1SVOA 4D6PA 1XMJA 1F3OA 1YR8A 1E1QA 2BOVA 2IC5A 3TSWA 2XJ9A 2BIFA 4QM7A 2CNWA 4OHVA 3TKLA 2ZRDA 5BN5A 3TW8B 5L3SB 4BQSA 4TL9A 4KSBA 4PPGA 4L8GA 3UATA 1NVXQ 4BLOA 1E69A 2JATA 3K9GA 2ZI9A 3SR0A 2WWWA 5JHHB 2QSZA 2WKQA 4TQUS 5AUQA 4OI1A 1W4BA 3NH6A 1FQKA 3QNUA 4RFSA 2ZE7A 4MKIA 2ZJOA 2JJ1A 3LLMA 4PXAA 2WM9B 3I8XA 1GTVA 4DLRA 1MABA 4P3YA 1ZD8A 1R0WA 2OBLA 1M74A 3IPXA 4IFBA 3SOPA 3VX4A 5BYKA 2YYZA 4G5QA 1IN4A 1XD9A 3HU3A 4OL0A 4JLOA 4ZI3A 2BCJQ 4NYMQ 5JECA 2GXAA 4B43A 2V8OA 3GLIB 3NVAA 3THOA 2ZR0A 3NKVA 1WCV1 1VCNA 2P67A 4Q7KA 3U7GA 3ZD6A 4DIEA 3EZ2A 1W2GA 1WF3A 4AKGA 1EFTA 2W58A 2UZ3A 4IEEA 4RZ2A 1P62B 5J40A 1XTRA 2FPLA 3HYTA 4PHGA 5FOSA 1UEJA 1KI6A 4HDQB 1I2DA 1MOZA 4QHTA 5KDDA 2C9CA 4RD1A 4DLSA 4EFMA 1ZRHA 2C9YA 4QC2A 1JR3D 3IDQA 4LBZA 2WWXA 3KQNA 4GP7A 3CX8A 4JVSB 1XJQA 1OXSC 1QVRA 2RHMA 3T06B 2IWHA 4EPWA 4OK6A 2VEDA 3V4RA 4LV8B 3NIBA 1G7TA 1B0UA 1AZTA 2BCGY 3RC8A 4PHFA 2PX3A 2GWHA 4RSGA 1U8ZA 5CLQA 2IYQA 1D9ZA 4NCHA 5FOWA 1N5JA 3Q7QA 4ACAA 3TR5A 1FMJA 1IY0A 1KK2A 2AX4A 1YZQA 2PLFA 4MYUA 4ASUD 2IUSA 1SZPA 3LXRA 4MITA 4BPBA 1LS1A 3E2IA 1HURA 3AVOA 1KTVA 1U0JA 1DAIA 1GG2A 3AF2A 2NO0A 3L8ZA 2EWVA 3GJ0A 3I4LA 1IY2A 1T3HA 2GJSA 5D3MB 4LHWA 5KSYA 1EWRA 4MH0R 4DB2A 1NL3A 3CRRA 2YVUA 4HYYA 4TTRA 2B21A 3C8UA 3CONA 1JBKA 1CJMA 2D06A 2FNAA 3T1OA 5FPKA 1OFHA 2SHKA 1WRBA 2IF2A 4KCGA 4UJ3A 1VG8A 3BGWA 1XRJA 2J0QA 2BJVA 3CF0A 1VG0B 1TADA 3HDTA 5JWOA 5JWRA 2AKAB 1EGAA 4Q21A 4LHXA 3DKVA 721PA 2B7CA 3BOSA 4GP6A 4D26A 4KFRA 2WWFA 1TL7C 3ZQJA 1IY1A 1P75A 3DEFA 1FW6A 3IUYA 2I4IA 2HUPA 4TLAA 4Q4LA 2CEAA 3K9HA 1JR6A 3W8RA 1UFQA 2A30A 1YVDA 4NYJR 4IOMA 4PANA 2V3CC 1L4YA 1AQYA 2P6UA 3VR2A 2FZLA 1E2FA 1BO6A 3AKDA 4PO1A 2C5LA 3LBIA 1ZM3A 1FTNA 4BFYA 4JT2A 1ZM2A 4M9SA 1CS4C 3PITA 2IS2A 2Z5FA 2ZS9A 2NO1A 3KKOA 1OLOA 2WBLC 1N0VC 5FI1B 4CT5A 2QAGA 3H0KA 1M1YE 1AA9A 2P0EA 3ONWA 1J7KA 1XZQA 2QPAA 3B7GA 1S1CA 1SVSA 1DEKA 1G1MA 4PQYA 4G3XA 2DWOA 4C30A 3K0AB 4C0HA 1KO5A 2GJAA 3C41J 2ZE8A 5CIQA 1RC8A 2CMKA 4DIDA 3UANA 2AFIE 1CRPA 4LJ6A 1XTJA 1ZINA 5L8VA 1AGRA 1K5GA 2ZI7A 3BJIC 4MRSA 1HUQA 1HQYE 2J7PD 2Q3HA 2PJRA 1KDOA 1G7SA 1Q22A 4P4TA 3UMSA 1QBKC 2RCNA 1U90A 5BQ5A 4O2LA 3R9WA 4UXHA 3U5ZB 4Q1CA 1II9A 5GJVC 1RW4A 5L3RA 1F2UB 1KJWA 1S9HA 4JLVA 3OZXA 4NHOA 1XEWX 2FPMA 5EJEA 1U8AA 2OFOA 1A2BA 4LBYA 4CGZA 3D7MA 1XBTA 1HYQA 3H86A 1ZCAA 1SKYB 2BM1A 2Q21A 4M9ZA 5K8TA 1W0JD 4Q9LA 3Q7PA 4F92B 3CPHA 5CK4A 3SQWA 1YZUA 4RFVA 5LB2A 4AY2A 3WNCA 2MSCB 4Q4JB 1H8HD 3CX6A 3OFNA 1BMFA 4B47A 3FPAA 3KQHA 3EAQA 4MRRA 1OFUX 3W5IA 1TPZA 3EZFA 1XEXB 2CK3D 2ZU6A 2JLVA 4URZR 1LV7A 1ZM9A 1P60A 3OF5A 2ZRCA 1U94A 2OE2A 3OE7D 1R0YA 3QVUA 4WZAE 4DWJA 3K8YA 1S4QA 2R6CA 4B3FX 4A15A 2OG2A 4TYYA 1CJTC 3W6PA 5F3WB 2F9LA 1KAGA 2EW1A 2FFAA 3LD9A 5FL7A 5BXQC 4HUQA 1Z6TA 4Q01A 1EFRA 2VP9A 4JVLA 4LJ9A 1E1QD 2C9OA 1P2TA 1Q21A 4RD4A 3VHXA 1JQLB 3B82A 1J90A 1KI4A 2ZQ5A 3FMPB 3VR4A 2OZEA 3CWZA 1QG4A 2WWHA 2YHSA 1FPMA 4M1WA 3TE6A 4BFUA 5KSOA 2GCNA 4OQLA 2F3RA 1OF1A 5FBRB 3RNLA 3ZZ0A 4JJZA 1KAOA 2ATVA 4M1SA 1KO7A 2D7CA 3WNDA 1JXOA 1W5TA 1BYIA 2P6NA 3FMFA 1W36B 1OSNA 4B71A 1X8KA 2V9PA 3EIEA 4PHTA 4X8OA 2KWIA 2J1LA 3SFVA 1I2MA 4DT1A 3AP2A 2OAQ1 2Q9AA 1IAQA 4B3DA 4KBFA 3ZS9A 1KIMA 5CYPA 4BLRA 5JS7A 1JXMA 1E96A 2B8WA 3MWLA 2OXRA 3A36A 4NU0A 4Q9JA 2NTYC 4QGHA 2QM7A 2RGNA 3BFVA 1GL9B 1SXJE 1CLUA 2ZRNA 3KQUA 1W4AA 4PR0A 4GZLA 1OB5A 5JEEA 2A2ZA 3OE7A 2JLYA 1NG9A 3KB2A 3BH0A 3QXJA 3GJ5A 4V0LA 1TEXA 4LGMA 3DZ8A 3K0CC 3W90A 1S3GA 3GJ4A 4GNKA 4CVNA 4HAZA 1UAAA 3NEJA 1WXQA 3NWJA 2G1JA 3U7HB 4AI6A 3LNCA 1E9FA 1E79D 3DPUA 1YKSA 3WBKA 1UEIA 2ZJZA 1D6JA 4BLPA 4DRZA 3GFOA 1G5RA 1YHNA 3IBYA 3FHCB 421PA 3R7WA 2ZSFA 3HPQA 4FMDB 4DCNA 3FKQA 1J8MF 5L3QA 2FSHA 5DHAA 2XTZA 4W5HA 4KYIB 2EFCB 3A1VA 1SULA 3AVPA 3CBQA 2BBTA 3F0TA 2IYXA 3LRPA 4OI2A 3TUJC 2WPDD 1E0SA 5EZ6B 4XVRA 1JEEA 1KSJA 1JAIA 3RSOA 2QENA 3ZVMA 1O3YA 1QHHA 1R5NA 4FMBB 3GEEA 2QE7D 5HZHA 3W3AA 3DL0A 3W6NA 1NN0A 4KHZA 3GLGB 1J70A 2IYRA 1E9CA 2P65A 4B2LA 2HT1A 4YDSA 1OIWA 1GM5A 2OT3B 2A5DA 3QF4A 1ANKA 1FOEB 1RRGA 3HR7A 4R7ZA 4C9BA 4TYNA 1G3IA 1WA5A 5AR1A 1YZNA 3W8NA 1ZD9A 3A37A 3K09C 3EPJA 1T9HA 1LNZA 2AXPA 5B2ZA 2FH5B 4GSYA 5FI0B 1IJFA 2A5FA 1N0UA 2ZJ2A 4QHYA 1IN8A 4YMTA 3AF3A 4TYQA 1MO3A 3UG7A 4FCWA 5HZKA 3KUDA 4MGKR 1B23P 1FMLA 1AS0A 2EFGA 2ODBA 4D25A 5K8UA 1JB1A 1OXTA 4I1SA 3WHLA 2R6DA 2IL1A 3RS4A 4MRNA 1JI0A 3BAFA 1OJLA 4PPFA 2G0TA 2W6JD 5FBQB 4JLPA 3V00A 3QQ5A 3OAAA 2D2FA 5HE8A 3W3ZB 2AL7A 1XWIA 3KFXA 4DVGA 4ZV4A 1XEXA 2QN6A 4NYJQ 4P4SA 5EP3A 2J0UB 2NZ8A 2VP6A 4Z8XA 4NZYA 1II8A 1P6XA 1OV4A 4I4LA 1W46A 1R8SA 1V5WA 2CCJA 5GADl 4OJKA 4PSVA 1P61B 2IXFA 3SJCA 1E9EA 4ARZB 2JJ1D 4FWTA 3IBGA 1N6PA 3LW8A 3OEHD 3N2IA 1XB2A 4A0RA 1U81A 2WVJA 1GKIA 4QL3A 4DCSA 3GMTA 3K70B 4TT3A 1PJRA 1SXJA 4FXPA 2ZXUA 1KK0A 5DNYB 1SKYE 5LDDC 4B32A 3I1FA 1E2JA 3A4MA 2CJWB 4H9GA 1G3MA 1SKQA 1R10A 3F8TA 1WBBA 4KODA 4NDZA 1E2MA 2VTKA 2QRZA 4QFMA 4CDGA 1JR3A 2RGAA 3AEZA 3B9QA 3IQWA 1ZNYA 3PIRA 2HDNB 2IHBA 1EFUA 5E4FA 3W9YA 4DHEA 2VL7A 4MKHA 5DO9A 1P9RA 1XTKA 2XEXA 3SC3A 1OXVA 3U7EB 3FGNA 4QG7A 4FMCF 2HLDD 4ACBA 3TBKA 1U9IC 3VR6A 2PLRA 3OIUA 4U00A 5CM9C 2B92A 4OBEA 3B9PA 5DIFA 3KXLA 2ZETA 1K5DA 2W83A 1X1RA 2ATXA 3LQQA 4LV5B 2ZI4A 3RRZA 4DJTA 1J99A 1GRNA 4UXIA 2WMOB 4POAA 5FL3A 4W5JA 4AC9A 4IVPA 4R2HA 3OEHA 3VFDA 5J4KA 1GL7A 1G3QA 1CULC 1KY3A 2CK3A 2WJGA 5FPSA 2PX0A 3QUSA 2N42A 4LBWA 4NL4H 3WRXC 4ZIRB 2WAYA 1KO8A 3SDZA 2O8DB 5EE3A 5CK5A 1YR7A 4ZCMA 3EWSA 3PXGA 1Q0UA 2GZHA 2QP9X 4KFSA 2VF7A 3G82C 2NMVA 3FVQA 1JJ7A 1Z3IX 2ZE5A 2ZYUX 5DI3A 4HZUB 3QE0A 3QKSA 5JI3E 3NDPA 5EP2A 2H7VA 1CTQA 4L9WA 3CRW1 4RFSB 1JEDA 2FE4A 1G17A 4XVQA 4C2UA 4M0LA 1Z2CA 3K9LA 2QL6A 2NZJA 3CNOA 4JT4A 1Z2AA 3GEHA 1MV5A 3DO6A 4NPHA 4E07A 3Q9LA 1QG2A 1E1RA 2A78A 2IT1A 4GRAA 3B1ZA 3QVVA 1PUJA 1R0XA 1HA3A 4B3XA 3CX7A 1EESA 2NGRA 4QRHA 5FPYA 4N3NA 4HDCA 1TQ6A 4Y0AA 3BB4A 4HZIA 1NIPA 1T5IA 1G4AE 1W44A 2IEZA 3T1VA 3ADDA 3QXHA 2FOLA 3HU1A 4BZQA 1N6KA 3MRSA 2UVQA 1GNRA 3X1DA 3O8CA 5DYGA 4GI7A 3H84A 1IQPA 1OW3B 4Q48A 5K8LA 1VIYA 4QNRA 3AGQA 1US8A 4K46A 3P4YA 4KU4A 1F2TA 4A8JC 4ESVA 1X6VA 4BWYA 3VKGA 4DBLC 3U3MA 4RJLA 4OI0A 2XITA 1ZW6A 4A8JA 1G16A 2JASA 1KJYA 3BBPA 4G5RA 5KU1A 1WP9A 4BEBA 4DLZA 1TU3A 4UQOA 2Z4SA 1G19A 1KSFX 4PPNA 1XXHE 1D8TA 3I92A 5GVSA 5CM8B 3L0PA 3QG1A 1XCPA 5HPYB 1JR3E 1N3BA 3K9NA 3KKPA 3I61A 4NYMR 1X8LA 2GJ9A 2HCBA 5EE1A 4XTRA 4ON9A 1N6HA 3Q5EA 1G3UA 1UKVY 4O3MA 2RGEA 5KSZA 5JHGB 1SHKA 4JBWA 4C3ZA 1IJEA 3GJ7A 1GNQA 1US8B 3O8DA 1N0WA 2ONJA 4F4JA 3TRFA 4M1TA 1YZTA 2PEZA 1GUAA 3FYHA 2ZSDA 3N70A 4HB4A 1G64A 1AZSC 2HYDA 1GKYA 3OIWA 2RGDA 4MGIR 4CRWB 2YWEA 2BEJA 3C15C 4I1VA 2GK7A 3QSYA 1CF4A 1X86B 1Z22A 2JGNA 4UNRA 2W0SA 3CRQA 2ZRBA 3VNVA 1KNQA 5KOYA 2IK8A 3IILA 821PA 1N6LA 2OCBA 3LDAA 3NG1A 4DEYA 3P26A 4IRUB 3DOEA 4JKIA 4B33A 4A4DA 3U44A 1NVUQ 1ZU4A 4Q47A 2W00A 1Z0AA 3IO3A 1GZSA 2KBEA 4HATA 2IYWA 4TYPA 1W0KA 2BV3A 3WHKA 4A92A 3ZDQA 1GWNA 1DELA 4JJKA 3T34A 1IONA 3ZZUA 3LX5A 2XXAA 4RD2A 5JSZA 1SVIA 2QMEA 4LJYA 2NIPA 5C46F 3GLFB 4DEXA 3RANA 1SVKA 1W49A 4X8HA 5G41A 5JCPA 1TQDA 1Z08A 5G53C 1TUEA 2WMNB 1FFHA 1N5KA 2GILA 4C4PA 1MO5A 5KYKA 3OAAD 1GIAA 5JLJA 4FW9A 1VG9B 3K0EA 3V4FA 3U44B 1P5ZB 1E6CA 2H5EA 3OIVA 4LYAA 1RVDA 4B74A 4C7OA 2OEPA 1M8PA 1N6RA 2B8TA 2DFTA 5EE0A 4C0LA 1ZNXA 3AKCA 2O0JA 1UDWA 3JZAA 3NC0C 3C7KA 2WSSA 2HXSA 4BFTA 4BLSA 1J2JA 2IW3A 3P4XA 1HH4A 1KNXA 1XMSA 2H1LA 3VHLB 4KV9A 1AKEA 2CXXA 2ECKA 2YOGA 5JSZB 4I1UA 1KK3A 4RZXA 2WV9A 5CIWA 4JLMA 3EC1A 3LBHA 4QM6A 1W0KD 4KXFB 2IS4A 1AM4D 2MSDB 3PEUA 3PUYA 3CF2A 4HLCA 4BLQA 1HEIA 1QHSA 4TMXA 1GAJA 1Q20A 3CPJB 2V4ZA 3QKTA 1T91A 1XD2A 1RRFA 4IFEA 3SFZA 3UXMA 4EIWA 4IDHA 1ELOA 5FBVB 1TQ4A 2I3BA 3PUZA 4BGDA 1RJ9B 2ZI5A 5JI2E 3ADBA 1N6NA 4J0QA 1JPNA 1LVGA 4TLCA 5FFMA 2A5GA 1G291 2JA1A 4GPTA 2VSOA 1OH8A 1Q1ZA 4XIGS 1E9DA 5EUMA 1VDZA 1E2HA 4S2EA 3MD0A 3U3OA 5DI3B 1XXHA 4DSTA 1IHUA 3MCAA 4EFLA 3R9XA 4DLUA 2HLDA 3ADKA 4TMVA 3WNBA 2CLDX 4P33A 2CCGA 4V0NA 2X1VA 4DKXA 3ADCA 2PEYA 1CP2A 4TMKA 1RIFA 3HR8A 4LWZA 2QE7A 2I1QA 4TLEA 1ZM4A 1MT0A 1N25A 3GLGE 1ZC4A 3TMKA 4LPKA 5J47A 1Z6AA 2IEYA 2P5SA 1ZNZA 2OLKA 3WP1B 2O8FB 1X1SA 3AM1A 4I81A 3PV0A 4MQBA 1OIXA 4L15A 4TL7A 1UBGA 2J0VA 2TMKA 4YONB 3CNLA 4DC9A 1FUUA 4Q9IA 1ZIOA 1VCMA 2O8DA 2KB0A 2F7SA 3WMGA 1OXUA 2VHQA 5CB8A 5EUQB 3LX8A 4D4MA 3WMEA 4PZLA 1QHXA 4AYWA 1M7BA 3CH4B 2XZPA 1UBCA 2CVFA 1NLZA 1PZNA 1T5LA 2PT7A 5GJBA 1ZCBA 3B78A 2GEDA 2FFQA 3EA5A 4ARZA 2J59A 3A1UA 1EK0A 4NCIA 5GVRA 4MGYR 3QJYA 5FUYA 4M1MA 3UKDA 2XTNA 2ZJ8A 2FWRA 2JLXA 3PQCA 5LD2B 1NMXA 2N46A 2QMHA 2NG1A 4ZDIA 4YMSA 3RWMB 3AVTA 2IYYA 2MSEB 3KJHA 1G5PA 1U9IA 4Q02A 4MKGA 4BFZA 3W34A 4HLQB 1FTSA 1NVWQ 1W0JA 2F43A 2VHUA 3AUXA 5FR2A 1KSGA 3QXXA 2JEOA 3R9IA 3EZ7A 1UDXA 3VKHA 2XZOA 2XOKD 4V02A 1BMFD 3RC3A 4JSTA 1RFLA 1S96A 1UBEA 2CL6X 4TT3D 1SXJD 4TTQA 3KXIA 3LLUA 4YMWA 3GJXC 3BD9A 4GOJA 3R7WB 2FU5C 1Y63A 1ZJ6A 4TMZA 4C0QC 3THXB 3CUEF 4B44A 3CNNA 5KDLA 1SXJC 2AR7A 2YC4C 4HAYA 4EUNA 1TTTA 1IN5A 4LZZA 2ZR7A 1OE0A 2JLWA 1XTIA 3L0OA 4Q4AB 2GHIA 3FTQA 4US1R 5FOVA 2BMFA 1W48A 2YNMA 2FG5A 2QQ0A 1OXXK 2GETA 5JEDA 3H4MA 5E7JA 1PUIA 2DWQA 2JLSA 1MKYA 1GNPA 2VPPA 2W0MA 3O47A 1SVLA 1VHTA 4JKYA 3X1YA 1GOTA 3QKUA 4AWXA 3BERA 4G1UC 4OQMA 4BRWA 3K1JA 4DLWA 3JZMA 4URWR 2N1BA 3BS4A 2GVZC 3NXSA 4DDVA 4U7DA 4RD0A 4V0KA 1W5SA 2E9SA 2Y8EA 4MYCA 4QOSA 2C95A 1CJVC 2UKDA 2WZQA 4G5SA 3FKSD 4BE7B 2GDJA 4HLUC 3P20A 1KSHA 4IDNA 4Q18A 5G40A 3WMFA 2ZVPX 4NCNA 3IGFA 1EG7A 4FIDA 3SHWA 3LQRA 4Q4HA 4DLXA 2J41A 2BMJA 5J4HA 1TAGA 3TH5A 3VNUA 4JL5A 1E2LA 1Q1EA 1EFHA 1DO2A 2AFHE 3SNHA 1UJ2A 4A6XA 4B34A 3B60A 4GBMA 5JMTA 3M1IA 4BFXA 2J3EA 3REGA 4EPRA 2CBZA 2F43B 4TL8A 3A58B 4NE2A 4D82A 1DADA 2V55B 4EJSC 3M6AA 3F5FA 1EWQA 1PLKA 4KYUA 1NJGA 4WZBE 2ODEA 2PZFA 3PEYA 2XZLA 3U6BA 2GRJA 1PV4A 4TLDA 1JNYA 1P4SA 3WYGA 4B76A 3KDSE 4DLVA 3RS7A 2BBSA 3A4NA 4NP6A 2FA9A 3B1XA 5BYJA 1IN6A 4Q1DA 3IKJA 1LF5A 1CR4A 3OEEA 1M2OB 1A7JA 2Q9CA 2ZRMA 3A1SA 3DZDA 4JZKA 4AD8A 1SQ5A 3IIMA 5CDFE 2WPDA 3N5CA 3SYLA 3F3YA 4GOXA 3VQTA 4B35A 1Z5ZA 3CLVA 1AJEA 1MRNA 1IM2A 1AS2A 3QKSB 4E09A 5KNDA 3KZ1E 5FH9A 4ZKEA 4S35A 4HDOB 3AQ4A 2FSIA 2KSQA 3GLFA 2DHRA 3VR3A 2D4HA 2ZAMA 4JL6A 2WWIA 4UNPA 4DDWA 3U2QA 4DT1B 5BN3A 5ELXA 1BKDR 4PPQA 2F1HA 4KO8A 1NNEA 2QG6A 1XMIA 3WP0A 3WYAA 2AWOA 3CB4A 1NG1A 2DR3A 2ZYVX 3RS0A 2Z6VA 1JAHA 2V1UA 3K0FA 4EAQA 4LHZA 1KO4A 2RKOA 2CHVA 2YZ2A 2IXEA 5FOTA 5IK2A 4QBFA 3VKWA 5AUOB 5H70A 4EKDA 3IIJA 2O0KA 3LO5A 4M1YA 3VMFA 4A82A 3ZVRA 4QGGA 2R6AA 4ZDJA 4RCYA 1KOFA 2FEOA 1E2EA 1R7RA 1II8B 2W6JA 3MJRA 121PA 4C0SA 1RE0A 1RRCA 3Q3JB 2REBA 1NN1A 2IYVA 2W2XA 1CR2A 3R20A 4EPXA 2ZJ5A 1D2NA 1OYYA 1G6HA 2QMUA 2Q3FA 3QENA 4UNSA 3UG6A 4QHSA 1CRQA 5JS8A 2C2HA 3O8RA 2X2EA 1ZNWA 1QHGA 1NBMA 3QPVA 1Z8FA 2AXNA 2BKEA 3SQXA 2O8BA 2OBMA 4Q00A 4XWKA 5TMPA 2F3TA 2VHCA 2G1KA 3B13B 5CITA 5DN6D 5JRZA 1PLJA 4MKFA 4BLTA 3QIAA 1LY1A 2ANCA 4UKDA 1DAEA 3PG5A 3KQKA 3PR1A 2ZRIA 2J5XA 2XJ4A 2ZRJA 3RS2A 1LF0A 5C4MA 1M34E 5EXSA 3A4LA 2QGNA 4HB0A 5FOXA 2WJHA 5FTLA 5HKKA 3I5YA 3AF1A 3SZRA 5TARA 4P4UA 3BB1A 3EG5A 1NN3A 2GF0A 4B3CA 1AK2A 4PO9A 2QY9A 2V6IA 3NHBA 4ABYA 1IXRC 2Q6TA 1MRSA 5EXPA 3U4QB 2ZSEA 3LFUA 1R5OA 3THWB 1KMHA 1O87A 1DS6A 2FV8A 2VH5R 1OIVA 2V1XA 3GQBA 1NRJB 4F7WA 1NIJA 4ESHA 1R0ZA 2L0XA 4LJ5A 3EA0A 2HXYA 4OHWA 4XSHA 4TZ0A 5SZJA 2YV5A 3FFAA 2F1RA 4IKEA 2WTUA 2KI5A 2XSZA 3AKYA 4CYMA 5A4JA 1Q1BA 5F98A 2ONKA 1WBDA 3QF7A 2J46A 4NYIR 4RZUA 3QEJA 2QGZA 4TZ6A 1OFTA 2ZE6A 3GLFE 2GZDA 3ZLJA 2OUKA 3KKQA 2HEIA 3KL4A 2YOFA 3VTKA 3NC1C 3BK7A 4HB2A 2DFKB 2X19A 4LYHA 5KNCA 4KI0A 3EZ6A 4W7SA 5FBLB 5TB5A 1E2KA 3L8YA 2ERXA 4KSCA 2WSSD 1GSIA 3WYFA 5UKDA 3AVYA 1TEVA 5GJCA 1A5TA 2VHTA 3GJ8A 2QU8A 2ZYTX 2GJKA 1G18A 1TF5A 1E94E 2EWWA 1TMKA 2QUZA 4KFUA 5HKKD 4URYR 4AKHA 4E22A 2ZS8A 3AP3A 4HUQB 5G3YA 4FINA 4I99A 2P3SA 3ICQB 3B2EA 3ECCA 1U98A 4Z1MA 4G5GA 2F1IA 4P0TA 3EASA 1TUIA 1JQJC 2OO7A 5AK0A 3KX2A 3AF0A 4LOAA 2AHOA 3SJBA 3GD7A 3KJEA 4GMDA 2V7QD 3NBFA 4FD2A 4LDJA 3P32A 4HSEA 3TLXA 4AKEA 2GBLA 4E03A 4IVQA 1L8QA 2XTMA 3QEOA 4IDOA 3MMPA 2WJVA 2XSZD 5FPHA 4F38A 5EXXA 3IEUA 4WAUA 3TW4A 3DMDA 4D4LA 1E1RD 3JVVA 1XF9A 1AKYA 2A7QA 3FDIA 4XTCS 3TVDA 4FCVA 3EXAA 3THWA 1KDPA 2QZ4A 2EQBA 1G7RA 4RD6A 1E2PA 2ZU0C 1MO4A 2HF8A 5IRCD 1R6BX 1VECA 2FX3A 5CJ2A 5JCZA 2Q0HA 3BORA 1SVWA 5EZ5A 2PZGA 1GRQA 4IOJA 3SYNA 4KLZA 3THYB 1HQCA 3CZPA 3NBXX 2ZRPA 3M0EA 4RKEA 5KSPA 1DOAA 4MDFA 3RS5A 2GAAA 5M04A 5DHFA 3ZS8A 4LBVA 1NBME 2LKCA 2GEUA 1EFCA 2DBYA 4FWIB 4L9SA 1SGWA 2NO6A 5BWMA 4TSFD 3BH6A 2LKDA 3LY5A 4ILEA 5E7MA 4DDUA 3PJRA 3TQFA 1F2UA 1FUKA 1P9WA 5FUXA 1L2TA 4V0MA 3C4JA 2X8AA 1XPUA 1E3MA 1Z63A 2PMKA 4NONA 4QXAA 3MWJA 4NH0A 4NCKA 2YJTD 4PAQA 2EYQA 1C4OA 4BFWA 4PHHA 2ZSBA 3U6KA 3EX7C 4PQRA 3HP1A 4V03A 3GLGA 2C03A 2QTFA 1YZGA 2WSMA 4WVFA 3X1ZA 4CW7A 4PC6A 1DAGA 1FP7A 1CXZA 1P2VA 3UK6A 2K5UA 3TR0A 3NH9A 1GKUB 1QVAA 1KI8A 2AK2A 5HE9A 4HB3A 2QEQA 3L0IB 4LCBA 2XB4A 1VG1A 3LXXA 1GFIA 2VRWA 3DOFA 1U0HC 5JWHA 4B73A 4US0R 1Q12A 5DSZA 3IHWA 2VIIA 4KITB 4FMCB 1Q3HA 1DBSA 1Z6XA 4M9XA 1ESNA 1OT3A 3ASZA 1NY5A 4HAUA 4LSGA 5TVKA 3DHWC 2GKSA 2RHDA 4GMXA 3ZD7A 1ZAKA 1UKYA 2B7BA 3A1WA 2F1JA 4PO8A 5IHPA 1DG1G 2ODNA 4EPYA 1YRAA 1T8TA 2VBCA 2JJ2D 1WDTA 3X1WA 3TAHA 2HT6A 2W2TA 2CDNA 4EPTA 4UNNA 5FUWA 4B6FA 3JVUA 3BE4A 3BB3A 1H8EA 4YXWA 3K0AA 1YZLA 4DUGA 4C0BA 1II0A 1K8RA 2JJ8A 1LW7A 1CBUA 4YMVA 2GCOA 3EW9A 3ZZTA 2ZUDA 3CF6R 4JLAA 1VCOA 2R65A 3FE2A 3WBJA 1E9RA 1NF3A 1G6OA 5JJLA 3SN6A 4CZ2A 3TUIC 2MMCA 2QORA 4NMMA 4WIAA 5D3QA 1G8FA 2BEKA 4OQXA 4EDHA 1CJUC 1U2RA 1COWA 2NPFA 5JZVA 3T1TA 3K0FB 5SZIA 5J4YA 1UF9A 3QPUA 1VCIA 1W4CA 3LW7A 2C78A 3TVTA 2ZRAA 3BC1A 4ZDKA 3T12A 4OJQA 1Z83A 2ASEA 4H1UA 2RH5A 1G41A 1NLYA 2OM2A 1UPTA 1OFIA 6Q21A 5KNBA 4Q9KA 4QGFA 4M22A 3U61B 2BM0A 2VSXA 3GEIA 4R2IA 3R8CA 3RRYA 3U3JA 2C99A 4AKIA 2O52A 4TMTA 3P27A 1E98A 4AK9A 3THYA 2JJ2A 1XPOA 4DLTA 2GXUA 1NMYA 3U60B 3TSZA 1LFDB 1D5CA 4DLYA 3CIOA 4QJ5A 3O8BA 3KB1A 3FMIA 2WWYA 4IJMA 1DPFA 3MFYA 3MSXA 5L3SA 5KPJA 3RAPR 1Z6GA 1D2EA 1RRPA 1VYUA 5HTKA 1Z07A 1DG3A 5FOUA 4KVGA 5JRJA 1KDRA 1YU9A 4OKSA 4Q1EA 4TTPA 1ZUHA 1YZKA 2YOHA 1XFAA 4MYTA 1GDDA 4D0LB 2OESA 2RGNC 2WIBA 4EQ6A 1M6NA 2R6GA 3OEED 1Z47A 4WA7A 4URXR 1T0HB 4C0KA 2FFHA 1HE8B 1GILA 1P2UA 2BHRA 3AUYA 3CO5A 2JLRA 3TJZA 3GLIA 1I4TD 2GXSA 1M7GA 1NVVQ 1R4AA 1FZQA 1TQ2A 2KJQA 2RGCA 3GFPA 5EP4A 3W6OA 5KDOA 4TLBA 4B6EA 2HF9A 2QPOA 5ANRB 4N0DA 1VTKA 1KI9A 3ND8A 4UNQA 2AK3A 2VP4A 1ZYUA 1FX0A 2OHFA 3C16C 2G83A 4MRVA 1VYTA 3LA6A 521PA 1Z0KA 2H18A 2WKRA 3CRVA 3K53A 4GOKA 4R71A 2CVHA 1NKTA 2J45A 5FTNA 2H17A 2GEVA 1KY2A 4FI3C 4IDQA 4AG5A 5A5GA 4HEJA 2ORWA 1RPZA 3KXKA 4YQFA 2GK6A 1ZM7A 2ANBA 2W6ID 4DCVA 1OH5A 2CL7X 4OQFA 5EP1A 2ODWA 1R2QA 5H8WA 1JALA 1EXMA 2V7QA 2ZVQX 4LHVA 3MWYW 5GJWC 3X1XA 5IT5A 3HPRA 1IXZA 1NN5A 4A6PA 2JLZA 1Z29A 4MYHA 1BIFA 2IYSA 3IO5A 4Q4JA 5B57C 1YR9A 4B48A 2UZIR 2JLUA 1W2HA 1Q44A 3GJ3A 1BYUA 2GXQA 1XEFA 4YMUA 1S9DA 1X8JA 4GFDA 4A1FA 1KI6B 5C2JB 1F5NA 1KMHB 4XJXA 3SI7A 3U4QA 1DO0A 3GPLA 4R9UC 5AJZA 4BRUA 2O5VA 4ZKDA 2WICA 2XNSA 3L43A 4XD7A 3K70D 2WHXA 2HV8A 5DN6A 3QPWA 3B85A 4PFSA 5D3MA 2E87A 3MJHA 2XOKA 5FTMA 4A2PA 1KI2A 4C0JA 1AIPA 1F6BA 2QPTA 4XH9B 1LS6A 1S8FA 2QQEA 2XNDD 3WY9A 4MDEA 4YDHB 1U8YA 3QKRA 2DYKA 5G3ZA 2XXAB 5AUPB 1V43A 4Q4AA 4BUJA 1QHNA 2ZRHA 4ZPXA 2C96A 4DCTA 4OHYA 2C8VA 1NJFA 1R5BA 2ZJBA 1U99A 2J0SA 2O8EA 3UIEA 3LVRE 4AYXA 1E2GA 1RKBA 1RYFA 1E9AA 2ZYWX 2ZROA 1WE2A 1VPLA 2WOOA 4D81A 1WMSA 1Z28A 1XXHB 4F4CA 1LB1B 5AJXA 4LYJA 4DXAA 4AIIA 3AVQA 2CE7A 2CHQA 2XAUA 1T4GA 5DH9A 2PH1A 4LC0A 3EIHA 3SBEA 3SU8A 4K81B 4ZDWA 2DB3A 4URUR 3W5JA 4CEIA 1ZUIA 2G6BA 4D2IA 1HE1C 3NTUA 5TXGA 2QA5A 2YC2C 3PCRB 3NEYA 4LK2A 4NTZA 3RABA 4Q1AA 4IHQA 621PA 5CJPA 1OH7A 2OSBA 5FR1A 2QP4A 1CKEA 3UWOA 4XD7D 3B1VA 1E9SA 4A0FA 2E1RA 4Q19A 4E5UA 4QJ4A 1KZGB 2J9RA 5DYIA 2FZ4A 3SHFA 1NMZA 2WJIA 1Z0JA 3B1WA 3U7FB 2GA8A 2AD5A 2GNOA 4ZCLA 4JIMA 3FKSA 3NHAA 4M53A 3LAWA 2IHYA 2ZAOA 5AJVB 3G5UA 3CZQA 2QAGC 1ZU5A 4IXMA 5F9FA 1KO1A 1XMVA 3GFTA 5B30A 2P6RA 5E3HA 3I3SR 2EYUA 2CCKA 1C9KA 4G01B 1QF9A 1T3SA 3WRYC 3THXA 3S1AB 5DI9A 4DSNA 1CR0A 5L3VA 2RGXA 3D31A 3HYRA 3UWKA 4KAXA 3SYKA 2Z83A 4JL8A 1OKKA 1SHZA 2A9KA 3QXSA 3ND9A 3DM9B 4LYFA 1XCMA 1KI3A 3GLHE 2R9VA 2ZRGA 1M7HA 1XU4A 3IPYA 3M4YA 4ZO4A 1NP6A 4JLJA 2QT1A 4DB4A 1ZMXA 2ZRFA 4AYTA 1Q1QA 1GP2A 4CF7A 1RZ3A 1KZ7B 3MAAC 5SZHB 2VA8A 1HY3A 4TQAA 1P7CA 2QROA 4QNMA 1QHYA 3NDBB 1ZD1A 4D80A 1G20E 4O0MA 3TGPA 1P2SA 3RVBA 5H68A 3ZH9B 1ESMA 1P9NA 4OI4A 2QMOA 2QBYB 1Q3TA 3IHLA 3E5HA 4XWAA 3UPUA 2XB2A 1L4UA 2QAGB 3BXZA 3PVSA 4Z8YA 4JS0A 5TDHA 5DGXA 4D0GA 4N1AA 5AUNB 2G0NA 1RJ9A 3B8HA 5J4VA 2R6FA 5E7IA 1MH1A 2FFBA 2GESA 3DMNA 3AH8A 4KBGA 1G8PA 1E0KA 2YINC 1W36D 2BVNA 1P3JA 4EJSA 5AWFC 1SVMA 2R62A
chains in the Genus database with same CATH superfamily
1OKKD 1A82A 2ZYSA 4QUBA 4II2A 5IK2D 1FJGB 1UADA 2C8JA 1RZRA 2AUMA 3B6EA 3ILVA 5FF9A 1FBTA 1NT4A 3M6LA 2G72A 1JSZA 5KUTA 3SS8A 1J8YF 1NPDA 4WXPA 4YJHB 3T5BA 1U5BA 2YBDA 3Q9NA 2Z95A 1IBKB 1ACJA 2XY4A 4HD8A 4CIVA 1CY8A 5IJZA 2OHVA 2A0KA 2QR2A 2HN9A 1UOPA 3B5IA 4EMUA 3CIFA 4TOIA 3GRPA 4B2PA 2CDAA 5AJYA 1MABB 4QVIA 1VYVA 1T2VA 3BWCA 1RLJA 3LUJA 4LC1A 3UT5B 1N9GB 1QFMA 1USKA 1XNQB 3IR5A 3WLTA 2DFDA 1CRWG 2C98A 2VTVA 3RSLA 5BSHA 3KPVA 5K01A 2OORA 2BR3A 1UOQA 1WHSA 3F1LA 1A50B 2C0CA 3MGKA 3C14C 4TS4A 2M6LA 2RHGB 4DYVA 3PWSA 1TCAA 3DOCA 3OPXA 2BC9A 2P9TA 2WFZA 3R44A 3IMGA 3ZI7A 2Y0DA 4KXUA 4E3WA 4KR0A 3N2ZB 4BLVA 3MIZA 3UMGA 3FMOB 4UARA 3N87A 1R4NB 3I6MA 5YASA 5CDGA 1E6WA 2CMHA 1EVYA 2ZT7A 3GCZA 3Q7TA 3ZWQA 2X8WA 4N12A 1JSLA 3T5DA 4X1KA 3SEZA 1ADCA 2E1PA 3FHTA 2IUEA 5JY6A 4ZTBA 2EZ4A 4QFDA 1XD2B 3OEWA 2H48A 2L17A 3DVLA 1B7GO 5EHNA 5ALTA 2JAWA 4ME6A 3WIBA 1DE0A 4OYRA 1MZVA 4YRJA 4JIGA 1TF7A 2IHVA 3VPCA 3PQEA 5JJKA 4NAHA 4MGZR 1SZJG 4DNPA 3LL4A 4QREA 1Y5RA 2MR5A 3FYDA 3KXDA 4KUGA 5HUQA 3A2NA 4BP3A 1XMQB 1TNDA 2ZVDA 2E5FA 2GM5A 2QLJA 2W4IA 1NI3A 3KD2A 4R68A 4Z4EA 4S1VA 2WC1A 4ZQGA 3SIRA 4ZHSA 4FDAA 1X3SA 2IS1A 5EWLA 1SUSA 4WH0A 4XM1A 1NSTA 2ZJYA 1FPQA 1ZVMA 4ZOLA 3G7UA 5AW5A 2ZREA 5GV8A 1NW3A 5TS3A 3VZDA 3SQLA 1CJKC 2AOWA 3ZYZA 4PSCA 4ZI7A 5IKXA 1I4DD 2QVXX 1R6DA 3UK7A 3W77A 4YLGA 5BWLA 2GAOA 4DXDA 3L82B 4Z3KA 4KIWA 3ASVA 2H4WA 2LR0A 5FBWB 1XLTC 1GQOA 3TNLA 3VYTB 3BXEA 1WF6A 3BIJA 4AX8A 1T2DA 2NO5A 3DV9A 3LVQE 1YK1A 3ZBUA 2H9YA 1Q5PA 3VU3A 1AV6A 4B2IA 1J5EB 3CR8A 3HB4X 4RL6A 3A6PC 4JLKA 1URPA 2WTXA 3L7IA 1IDOA 1KEEB 2IUTA 4BFSA 4BNKA 2IHUA 1C2YA 3TTXA 4EG7A 2QD5A 3JD0A 1Z68A 1HDGO 2PL9A 3PDUA 2DH6A 3L93A 1H4VB 4HWKA 3WBBA 1H0HA 2FGJA 3AV0B 1YF3A 4JLNA 5A0TA 4MAAA 1M2JA 1K7YA 4GI5A 4BNUA 3NNSA 1DJOA 4IH9A 3CQ9A 4KX5A 2SKDA 4N18A 4PC3A 2O6LA 1C50A 3D0RA 1D03A 2JCVA 1HE5A 4G1VA 4PZDA 1ZR4A 5HUHA 4IXNA 3L92A 3KSDO 2MYUA 1G9XA 1AZLA 4U02A 3ZE7A 1C7ZA 1KMMA 3CE9A 4I5DA 1P18A 4OA8A 3GU3A 2OFWA 3PTAA 1TOAA 3FOZA 3L7YA 3S81A 1ZP6A 1XP8A 1VE6A 2PBFA 1UKEA 4OP1A 3F6YA 4RTMA 4W9MC 1HFWA 3V7FA 1MHPA 4ZOEA 3ND5A 4HLNA 3WGZA 3ZCQA 3GGGA 4MUKA 5A4MS 2VZEA 3QV2A 1YK0A 2XZTA 4RENA 1PGNA 3I5XA 2J5QA 4PGGA 3M9XA 1KP3A 3ECAA 4EA6A 4X44A 3QBDA 3QBEA 4MDHA 3PUVA 2RBEA 2CKDA 3FVVA 3LWNA 4OSPA 1XDBA 3HJHA 4YI5A 1QYWA 5EJIA 4D97A 3QVLA 2GBCA 5AO9A 4ZZ1A 2ZWMA 1DJMA 2I3DA 5IM4F 2O2ZA 3SBDA 4PSDA 1SHJA 2C42A 4OP3A 3V7UA 1Y98A 3IEVA 1KHTA 1L8XA 3MVEA 1QV7A 1RBYA 3GRUA 1PYGA 3H3JA 4ARSA 2AQHA 2FVYA 3NAQA 3I62A 4YFYA 1ESCA 3K4HA 4B5LA 3FNGA 4R0NA 4OXRA 1KFEB 3TLAA 4UDOA 1UZNA 4EO7A 1N2XA 3MB5A 3WWEA 4FYYA 4PC7A 3G88A 3D3QA 2O8BB 1JQEA 1NBHA 2D2EA 2JBAA 3G5LA 4GOND 2DFLA 4RADA 2JHCA 4RCZA 3LWDA 5IABA 1Z0DA 1MAAA 1VHWA 3L0CA 1OPXA 4OMFG 4IHJF 4DIKA 4ZGBA 2FYTA 3N53A 4O2RA 5EQFA 1S3SA 1KRWA 1DL5A 1C9EA 4QQRA 1V5FA 3EPLA 3G9QA 3OJXA 2BMDA 5B36A 2IZ5A 3MWKA 4RVSA 3UHOA 1EZ4A 4MA0A 3LBNA 1PO7A 1P0PA 2ZR9A 4FE4A 1WHTB 2GH1A 3L8DA 3OOWA 4UM5A 5T4BA 4YDQA 2FSFA 4P7FA 1CUZA 4TLLB 3FH0A 3S6JA 4LF7B 3DQQA 1YFKA 2TS1A 1GGEA 3I73A 5MGBA 3LZCA 1W9HA 3VC1A 1CYDA 3OJCA 3WKEA 2OY0A 5M5BA 4RY9A 4CM8A 3UJ7A 4XJTA 3LT1A 3TLEA 4QDUA 5FLEX 4LJ8A 3QF4B 1RLOA 1VIMA 2XZDA 1UXJA 4L0QA 1ZQ1A 1Z16A 2XWPA 5TV2A 3GUZA 5AKLA 3D6FA 2P3LA 4Q7JB 1CUJA 3FFBA 4FMPA 5DT2A 3STWA 3ZLUA 4Q7LA 4WK0B 2IBTA 2YWRA 2YIVX 4WUTA 3UQYS 5C8YF 5IUNC 2H5IA 5KC9A 3VI3B 2BFDA 1WCIB 4N8SA 1Y42X 3HGQA 1DQRA 2O4UX 4X9XA 3HKBB 5H3LA 5BVGA 4YXWD 2A59A 1J0CA 4U2EA 3HJTA 3H1BA 2I7VA 1NHWA 5EXDA 2IYZA 4GVXA 1JIJA 4ZCPA 3TCKA 5KKCA 1NMEA 3RSQA 2FDCA 1NY6A 2Q4EA 4KR9A 4ASUA 2EZUA 3CPEA 5AK6A 4C3UA 3CA8A 2FEKA 1FFDA 2PXXA 4JP5A 4QWMA 1RKUA 1K9SA 3ZCVA 4US2R 5LJLA 2G7MC 2Q4TA 5M3BA 3V2GA 5LIPA 1ILWA 1WL8A 1G21E 1M1XB 3LKVA 1N5LA 3CW2A 1IBRA 1QYDA 4Q66C 3RT7A 4QDOA 4E5PA 1H1LA 2CBXA 4DLKA 1RKQA 3AY6A 3SXJA 2NU6B 1QIHA 1WKVA 3CLTD 4FFNA 3FM9A 1UDCA 3VTFA 3D8BA 2C92A 3HWSA 4JEMA 2R68A 3VUFA 3ZN2A 3ICPA 4YCCA 1Z06A 4RXUA 4KIJA 4FMDF 2ZFUA 3O95A 1UAYA 1UL1X 1D7OA 2W43A 3MF4A 5SY4A 3TQCA 1IVNA 2CJFA 3IFSA 5AMXA 1Z5WA 3SZ3A 1G3RA 3FWNA 1GTJ1 1MR3F 1RWVA 1SNYA 1F38A 2JFYA 3AJDA 4RM3A 2BTOA 5BSRA 5EZYF 3ELBA 1KI1A 2ZI3A 3B6KA 1XCGB 4Q9HA 3T6KA 1U0BB 4M9RA 1I6KA 1UMCB 2Q8NA 3VKUA 2B4AA 2BMEA 3ASYA 3COZA 3I6QA 3QWHA 4G81A 4I19A 3RVMA 4BQIA 4BU1A 3T0FA 2ORIA 3ZU4A 2PPVA 1YJ5A 1Z0IA 1SWVA 3HACA 3QI2A 3QW2A 5EAIA 2OFXA 5C1BA 3V9PA 3NTXA 3OA2A 1YA6A 4XWOA 3LCUA 4IMJB 5LQKA 3HUDA 2IX3A 1K6IA 2X7HA 1DQNA 2NYAA 3V42A 1XJ0A 1GR1A 1SIOA 4WHMA 4Z51A 3SXUB 3BTUA 3HV2A 3RDPA 2ZM5A 2NVBA 1G4UR 3O3OB 4FDUA 4IILA 1L5HA 1SA0A 4DE5A 2XYGA 1SKUA 1HXHA 3I37X 5DW3A 2GN6A 3E3OA 3J81k 1TU4A 4EFKA 3A14A 5C3UA 1IOLA 4D9HA 4P83A 3ZKAA 4LOHA 1NW9B 3ZW9A 3WDLA 4X8MA 1VGQA 4P58A 1E92A 1DAKA 1MNQA 1YDGA 2X2PA 2C94A 3MPUA 1GPUA 1ZBDA 3NORA 4BO3A 2VF8A 5JBNA 2HU2A 4CCSA 2M6KA 4P08A 1ABFA 1A9PA 2JD1A 3WLMA 1EDOA 5BWOA 4CQJA 1LJLA 1N2BA 1DJQA 1O6GA 3W06A 1HI9A 5ENVA 1H65A 1L7QA 3OZDA 3E9MA 4TQGA 4DWOA 4RTKA 3KWLA 1Q84A 1C14A 3BA1A 4K6HA 5JSYA 3E53A 2PQ2A 4C2TA 1ADBA 1EINA 2DWPA 4RY2A 2DM6A 5AYVA 3DBLA 4P9NA 4C0AC 3PFGA 2DCUA 3D6TB 3HU2A 3WMWA 3FYUC 4EEXA 2C0QA 4MWSA 3RU2A 4OHXA 4IDPA 1B00A 2WOJA 2IS6A 3A11A 1U0TA 1FFWA 2AZDA 2QD2A 4MTCA 4QFBA 5FV4A 1RMQA 1YTLA 1WMEA 2XYQA 3GP8A 4HGNA 2Y1LA 3HXMA 3KALA 3AVXA 2PVPA 3GLUA 1IULA 1FDSA 3E1SA 4ECAA 4IDGA 3UT5A 1G21A 3ZU6A 1N1MA 1E3EA 2I4OA 1D07A 1MVNA 1QSGA 3V7YA 1OU0A 1C1YA 2C4TA 1RI3A 5JNLA 4OX9Y 4P93A 4GQIA 3KOUA 4K05A 4IGIA 4YRQA 3QVJA 3TZ6A 3FCSB 2OXFA 4G41A 3L6DA 2GHTA 3I30X 3OFND 3UZUA 2G77B 3ABQB 5JNWA 4RAOA 4B7ZA 3P9KA 5EL0A 1M8KA 1SEVA 1D9XA 4F93B 1QQ5A 2YKGA 1I7PA 2ZYHA 1KDVA 3I83A 3TAUA 3OIYA 1W94A 5IAJA 2XHZA 3N59A 3EWNA 4XXHA 5TE9A 5CCBA 2X8JA 3EIQA 4R4JA 4MQUA 5BUQA 1I3NA 2R8XA 3OQMA 3L49A 1AB6A 4KXMA 4OREX 3ZDAA 4X7PA 3CZRA 1F60A 1M72A 4RVDA 2XRMA 5F2KA 5E6SA 4U2CA 1N78A 2YFKA 3KT3A 4D9GA 3Q5DA 3VTZA 4EJMA 1EFRD 4Z4GA 2ZANA 5NLLA 2FMXA 5CLJA 3T1QA 4L4UA 1SG0A 3WJAA 1GG5A 2CJXA 2XE7A 3E84A 1YA8A 4GRIA 2XNDA 1ZBQA 1JU3A 5AI9A 3IMFA 1Z6QA 2ZTVA 3MCVA 3HI6A 1QYIA 2XWJI 3H1GA 4PZYA 3F4BA 2FPWA 1Y7HA 3P9YA 2HHJA 2NSHA 4MRAA 4FHFA 1AMNA 4P31A 2PX5A 2PCJA 2WW8A 2AOUA 5C5CA 3ROXA 3VR6D 1R8QA 4KRGA 4V0RA 2FSVA 4HVLA 1XNJA 2R1TA 3KJGA 3ZGOA 4ZJYA 2IWRA 4XR4A 4NOJA 1T2FA 2D1TA 4TL6A 1LD3A 3SSOA 1BOFA 2ZEJA 3VR5A 4CEIB 2YY7A 1E9BA 3A4TA 5IYZA 1UXIA 4GI1A 3P9IA 3FCOA 5J2UB 1QH8A 1CQPA 4MB0A 4I6GA 4E5KA 3LZ6A 3T5MA 2YZNA 2Z43A 2Q07A 2I8CA 1RM0A 2BGTA 2XYVA 3L7CA 4K9LA 1DAFA 1OGYA 3V3TA 2NZUG 1KDTA 4ENSA 5F7JA 1SJ9A 4BQFA 3NJ4A 3UMFA 1REQB 4CIDA 5TIIA 5K0SA 2LV8A 4ZAVA 1E18A 4G67A 1M5RA 3DC2A 3KSUA 1A1SA 4HH0A 2P90A 1RXIA 2WYIA 4XRRA 3I9MA 3UOAB 3T61A 1ZWKA 2JCXA 5CBPB 1L9XA 5JSKA 2Q41A 5ITZA 5JATA 3WA7A 4ZVKA 1U1DA 2Z3ZA 3L0SA 4W5OA 3T5GA 2WFMA 1HZJA 4NPCA 4GT1A 1FVHA 5HS4A 5LQUA 2F9MA 3RBAA 2IBMA 4BB6A 3GMSA 4ZZ3A 5B6IA 1GNSA 2V58A 2GCOB 4OK3A 3EGCA 4BIIA 4AW9A 1I36A 3MMNA 3AXSA 1XA4A 4N3AA 3S2EA 1UMBB 2RGBA 2YTZA 2WAXA 5CGZA 3NM6B 5LQSA 4CUKA 1W85A 4ZODA 1OPRA 5LPNA 4IM7A 4RPJA 1TCUA 1SXJB 4M1OA 4P35A 3O26A 1FSFA 4MA4A 2R44A 4QBHA 1L8AA 2FGKA 1WUIS 1XLVA 2H9AA 3GRCA 5EIXA 1XMOB 1V3TA 4WCFB 2N1MA 4J43A 2ZATA 3S1AA 3R0QA 4DSUA 1D5WA 4KPUA 4P34A 3DBHB 2I03A 1L5OA 2REQB 2EU8A 2GGSA 4JCOA 4IJ5A 5SY6A 3RRMA 5ED4A 1M2EA 2FEMA 2YN2A 5J5VA 4D3ZA 4F2GA 5ALYA 4PONA 4YAIA 1H8HA 4D6XA 3LPNA 2VBGA 1E32A 4UVHA 2BBWA 1FRNA 3A28A 2GEFA 3QW4B 2Q0SA 4N3GA 4YXFA 3GV0A 2BM9A 3HMQA 4LJ4A 3TNFA 4DQDA 1IOZA 3U16A 2VHJA 3BF7A 3KLPX 4RS4A 2PCLA 1N5IA 3GGDA 2W2KB 3ISTA 3KZNA 4HNHA 1DSSG 2GBLC 3B6IA 5FUVA 1ZK1A 2O3JA 4ETMA 3GNTA 5G4KB 1W1WA 3EISA 1T13A 2P2LA 2BFEB 1PJSA 1PKEA 4BBJA 1SVOA 3DAGA 1MB4A 1PJQA 3D6JA 3VZQA 2F9FA 4Z4CA 3DP7A 4E5SA 3O1HB 4W5QA 1XMJA 1YR8A 3L7MA 4BRZA 3OC0A 3CXUA 5I9BA 5A3JA 4BHTA 2OHOA 1JKIA 2XJ9A 2A86A 4ETWA 4QM7A 4EY4A 5BSKA 5FA6A 1SXPA 3KQPA 4M8LA 4IZIA 4OHVA 2DLCX 2HGZA 1DXYA 1USVA 4GLFA 5IBCA 6YASA 3DMTC 5TGZA 3L1UA 4JQYA 4KSBA 1QH1A 1NVXQ 2J31A 3JR7A 3W2FA 1E69A 4HYQA 2EDCA 2JATA 3K9GA 1PTJA 3JYLA 2ZI9A 2NSJA 3AIIA 1C7FA 4FFOA 4IO1A 2ID7A 4RLFA 3GJRA 2P5YA 1I9CA 4LNUA 4D9NA 1BE6A 1E5DA 2NUBA 2QSZA 2VJNA 2CSXA 2GX6A 4KRYA 3H8JA 4S0XA 1W4BA 1KAHA 1LVHA 3A7EA 1U6IA 4MKIA 2MSNA 3LLMA 4OHUA 4PXAA 3A27A 2I7CA 3IULA 1MABA 4UAVA 2OBLA 4C0WA 1CSEE 2CHUA 1TM7E 2YYZA 4G5QA 3RSGA 4AS1A 3CWCA 1XD9A 3GI1A 1E89A 1K1EA 1RAIA 4XQGA 2GXAA 4NYMQ 2JFBA 5HQJA 3R3VA 4B43A 4DWWA 2HLPA 3RYCA 2OP1A 3HGTA 2PBZA 2MTBA 4FNOA 4REQA 1QE0A 3U7GA 4D79A 3ZD6A 4AKGA 2C3YA 5KCMA 2UZ3A 3K8OE 4A27A 3OC6A 3LL7A 4DDHA 4ZA2A 1TM1E 4FYIA 3HYTA 3PCTA 1AUXA 4PHGA 4DHWA 5FOSA 1MOSA 3LIPA 1NQUA 4G65A 4J1TC 5CM2Z 1RC1A 2ENUA 5AI8A 3ODGA 4X91A 2RI1A 1MOZA 2CGEA 3V8RA 1J6UA 2P4SA 4IIXA 5DNVA 1OY1A 1X0XA 1ZRHA 1NVKA 1X38A 3L6UA 1N2OA 4DQKA 3K9FC 4WY8A 5ALUA 5F1KA 3HV0A 4FONA 4PCUA 3K2BA 3HCFA 5IASA 4ZVOA 5IKOA 1QVRA 3ZW7A 2RI6A 1FB5A 2QQFA 1WDLA 2I4NA 4OK6A 1O94D 3G1WA 4LTDA 3IAUA 2VEDA 1IWPB 4UHKA 2X3UA 2XWBF 1B0UA 3D4PA 4TXLA 4DDKA 2D7JA 4G9BA 4PHFA 1BHO1 2PX3A 4R2WA 2IYPA 4RSGA 4L4SA 2Y27A 4NCHA 1YFJA 3KU1A 3AUAA 5FOWA 4ER7A 3KT8A 2R7AA 4KQJA 3TR5A 1FMJA 2R85A 2Q5CA 4PS0A 2GUGA 5E9WA 3RQIA 3EK2A 4MYUA 1TJ4A 4IJUA 1LPNA 1SZPA 1QU3A 1E7MA 1JFFA 1U0GA 1JYEA 1QIJA 3DA8A 3LU1A 3PTLA 4MITA 4CV3A 1HURA 1X15A 1KTVA 3L6EA 1C81A 1DAIA 1FYVA 2A0YA 1ENPA 2P9BA 4YV7A 1GKLA 8GPBA 2NO0A 4FK8A 2HCTA 4LWOA 3LHSA 3LUFA 4HNRA 5BN5B 4ER5A 1Z4MA 4F4UA 3DHNA 2GFIA 1TLTA 5TNXA 3HDYA 3IE0A 5BV7A 4J0IA 3T3PB 5C37A 4D92A 3BIOA 4WCDA 3CRRA 3KDAA 2NNWB 1N5MA 4DYHA 4U7HA 3I9LA 5DRYA 1JBKA 5IVDA 2D06A 1KBOA 2FNAA 5CA1A 3F6SA 4NJEA 3W5CA 5CCEA 1JHUA 2IF2A 3WGTA 4KCGA 1GG8A 3L02A 3W79A 3BMXA 1VG8A 1JEAA 2VAWA 2EKDA 2VPYA 1HLPA 2WP8J 3AW9A 5DGIA 5AOBA 2OV8A 2VA9A 3KHTA 4V24A 2AUTA 3TFOA 2JFQA 2PWPA 3DKVA 2HMVA 1U9ZA 3Q0TA 3U7RA 4GP6A 4GO1A 1REQA 1JQ3A 1QFYA 2XLBA 3R8XA 3URKA 5B5SA 1TL7C 2LXNA 3JSAA 1IY1A 3KEFA 1P75A 2QUKA 3AJRA 2PRSA 3NMUF 4CODB 3LLVA 2VK2A 2YXLA 3FDFA 3UJ3X 1A8HA 4RIIA 4LDRA 1LBEA 3O21A 3ZV4A 1APBA 1ORRA 2NVWA 3O7MA 4HDAA 4IMIB 2FPUA 2OYRA 3U1VA 3VR2A 4ZMSA 3DDSA 5B7PA 1BO6A 3WRYA 1PNRA 1FLDA 1V8BA 1NYTA 3WDKA 2AFRA 3LBIA 4XGQA 5F5LA 4BAZA 4B7AA 3UAXA 4MXDA 3TFWA 2AJBA 3MHPA 3H87A 1POXA 2RGYA 4FGLA 4UDNA 3KKOA 4HN2A 3VPDA 4JR0A 1N0VC 3GG9A 5FDFA 3GIDA 3LY8A 2QAGA 3ZUPA 1M1YE 1DKUA 2P0EA 4XX1A 3JD4A 1BDIA 3AFIA 1Q16A 2I6GA 1DEKA 3BK2A 3BJRA 3ENQA 4EL0A 1FDRA 2FX2A 3FA2A 2VAPA 4NCXA 1KO5A 1N7JA 2Q5OA 3LT4A 2GJAA 5JSZB 4DIDA 3MQ2A 3HO6A 4R2XA 1MAVA 5ALHA 2AFIE 4BO7A 3EDCA 1S8AA 1B6TA 1NJ8A 4LJ6A 4DV3B 1XTJA 4JC0A 1AGRA 3I58A 3JQCA 2ZI7A 3ER6A 3S2IA 2H1HA 5AVTA 3GEGA 3ER9A 4YAFA 1QX4A 1HUQA 4FHDA 4MVCA 2J7PD 1INLA 4YYEA 2I7XA 1Q22A 2EKLA 1A7UA 1L7OA 1PJ4A 4O2LA 2H31A 3HWWA 2I34A 4OB8A 1LRJA 1OWMA 1D6NA 4JJ4A 1I30A 3COWA 2G9QA 1E58A 5AK4A 1JFVA 5ERYA 5B1SA 3IP7A 4DG5A 1S9HA 4DXHA 4UHJA 1E9VA 5K05A 3OZXA 1U8TA 1F4PA 3VDMA 2OECA 5KZMB 3DT9A 2FPMA 1U80A 5EJEA 2QMQA 2M6SA 2CT8A 3E5MA 2OFOA 2IZZA 3RVSA 4FVTA 1U2EA 4AMYA 3H86A 4CGZA 1N77A 2HCRA 3HFRA 4UATA 3Q7SA 5A2GA 4HKTA 1W0JD 1OX4B 2XRYA 4ZEVA 3EGEA 3TTVA 4OXKA 3FOAA 1MVLA 1AKQA 4YALA 3CX6A 3KB6A 3P4UA 3Q0IA 4MP8A 5AKKA 4JI4B 3DLIA 3ILXA 3ZHYA 3TSAA 2AMFA 3FOCA 4E4RA 1H3FA 3W5IA 3BRWA 1TPZA 5IHXA 1UC9A 2CK3D 1VMIA 1T1RA 2QQGA 5ETJA 3REOA 2ZW9A 1P60A 2I1LA 4G4IA 1GPWB 2JCGA 4R05A 1YD7A 3WGNA 2OE2A 5EGSA 4JV5B 3OE7D 3QVUA 4WZAE 4ABTA 3CURA 1KIAA 4PAWA 4DWJA 1B8NA 4B3FX 4PYOA 4TYYA 5KQGA 1J0EA 3MRVA 3AK4A 3LOPA 1Q74A 1R8YA 4J0HA 5LCXA 2CNDA 3W7AA 3GVCA 3DEKA 2W2OA 4GH5A 1Z6TA 4HUQA 2VP9A 2X9QA 4LJ9A 1QTIA 3PX3A 1TVEA 2G80A 4Q01A 4X7BA 1GAXA 3PC4A 1GXSA 1CS0B 2VPXA 1FE8A 4RD4A 5KVCA 1J90A 1GHTA 1KI4A 3WIOA 5E0KB 4Y7CA 2AEFA 3RRJA 4KQFA 4W8OA 3NAZA 3ROPA 2G6TA 2P91A 3TE6A 4BFUA 1J8VA 3JVEA 4HFNA 4OQLA 3GC6A 1EXNA 3W1EA 1UXKA 1ZI6A 2J3QA 4E21A 1UM9B 3RHTA 2OMKA 1IYZA 2V7WA 3K71B 3HL0A 3OSUA 3ZZ0A 1S7CA 3WNDA 3SZGA 1QTQA 3FMFA 5AKYA 2NADA 4LZWA 1FS4A 3HVJA 4LJSA 5THXA 2OFFA 4CDMA 1VJDA 4JAVC 5HK8A 2IV3A 2OVBA 1IAQA 1CEXA 3BSYA 1LCIA 1LH0A 3OUUA 4ZXFA 4EG6A 2B8WA 1E96A 3NBUA 5LVAA 2OXRA 3NJ8A 2VJPA 2NTYC 1X7YA 5GY7A 2ZBGA 4MS1A 3ZK9A 2MT9A 4R1NA 1J2RA 2J8ZA 3BRQA 1W4AA 3BXOA 4CN8A 3KQUA 3PHJA 4FJ1A 2VCHA 3ROTA 1I5RA 1ZOPA 1JW9B 5C81A 1SU8A 3OE7A 1A8IA 2E4ZA 2JLYA 3O3CA 5EYPB 1UWKA 3KB2A 3BH0A 4X63A 5EQTA 5U4QA 3RK4A 2BGWA 4M89A 4YP7A 4BNZA 1KR2A 4YFVA 3RFXA 4LGMA 4LZPA 1BHSA 5KJEA 1T6XA 4GNKA 3AUKA 4YJGB 1I1QB 5DXJA 4BNVA 1DEOA 2O3RA 3OLWA 3IELA 3QI7A 3PF8A 4OOEA 2VYND 3UV6A 4KE7A 2W2NA 2AI3A 3O91A 3KPUA 3FPKA 1YKSA 3GP5A 1UEIA 1A8UA 2PRKA 4EB8A 1L5GB 3RYFB 5EHGA 3GFOA 1IDN1 1O89A 1YHNA 1Z8DA 2SCUB 3FHCB 421PA 3R7WA 1HQDA 2YCBA 2ZSFA 3U4CA 3HKDB 2FZWA 2PE5A 3JQFC 4FMDB 3IC5A 3WWDA 1JR2A 2DTXA 4O4LF 5TQ0A 4W99A 1K3TA 4QD3A 4DV5B 4W5HA 1G55A 3F0TA 1SULA 4R16A 5LWQA 2AMLA 3L8FA 5DMXA 1VDMA 5I4CA 2AN3A 4X1IA 4AUNA 4L0CA 1MB3A 4K1XA 3SLGA 1EFPB 2QENA 5A06A 2BH2A 3RVQA 1QHHA 3JRXA 3HVRA 2YQ4A 4FMBB 4IZ6A 5FNZA 2QE7D 2VHZA 3C3EA 4CIBA 3W3AA 1PG0A 3DL0A 1NN0A 3W6NA 3JAWB 1JQKA 1Y37A 2DLNA 2JFXA 2PX6A 2P65A 1J23A 2XGOA 4IICA 4LZOA 1VP9A 4ITUA 5JXIA 2X8BA 3W5UA 2FG7C 3ETJA 4WFIA 3H0EA 4R7ZA 3COPA 3WYCA 4TYNA 2BGGA 1WA5A 2V0CA 4Q6BA 2XE6A 5IJ0A 5FLXA 3TEJA 2HMAA 4MZDA 1T9HA 4DMKA 1X9GA 1GZUA 1YMUA 1MDBA 1Z0UA 2AXPA 2B4TO 3B53X 4ENRA 1Y6GA 3RFVA 2BEVA 5AHRA 4AS2A 1WJGA 4LI3X 1R8XA 3E58A 2PANA 3R6GA 1N0UA 3NEAA 4CG3A 1EWKA 1SPXA 1IN8A 1XZEA 1Y5NA 3R5KA 2A9JA 4TYQA 1Z7GA 5CFPA 2O3TA 5HZKA 2R4TA 1AQNA 1RQ7A 1CQXA 3G8YA 1B23P 1AS0A 1U3UA 4BE4A 1K5PA 4YRNA 1R6AA 3PC8A 5JFTA 4FGSA 4I1SA 5TGTA 3WHLA 5AKGA 3G2QA 3KPWA 5JYDA 2AB0A 4K9KA 3BAFA 3ANLA 3O83A 4KPGA 2WILA 4MS3B 1RXCA 2QRUA 3VA7A 2OC9A 1N8KA 3ZD8A 5AKJA 5H7XA 5A03A 5U9CA 4E12A 3BGSA 1NC3A 3GARA 3E18A 4ZV4A 4P2GA 3QUCA 4MDYA 2ATIA 1DC7A 1V7ZA 2IOFA 5EJ7A 4Z8XA 2J6BA 4Y1RB 2GRAA 2QRVB 4JI6B 4NULA 2E49A 4I14A 1W46A 1R8SA 2X4GA 2PGIA 3LC7O 4GX2A 5J1SB 1P61B 5BSUA 4CMIA 3HA3A 1P91A 1YIOA 1PDOA 4FWTA 2R1VA 3MCZA 5JAHA 3OA0A 2IUFA 4PFJA 1V45E 3LW8A 4ZT5A 4F8JA 1UCFA 4A0RA 3AI2A 1KJ9A 4KGZA 2WVJA 5GOZA 1M2OA 1GKIA 2I8LA 4QL3A 5FYDA 3GMTA 2QJOA 4Z53A 1P7ZA 2ZZKA 2CB9A 1NQTA 3VZCA 4IGEA 1X74A 5LZ4A 1KK0A 2XT6A 1SKYE 1O08A 2BGKA 5DNYB 3E23A 2R2GA 2KS6A 2I99A 3P2EA 4R8MA 1E2JA 4QPJC 4KPFC 1BSVA 1JGTA 1P4RA 1WBBA 1E1YA 1IPEA 4KODA 1W25A 4AICA 4IIYA 4NDZA 1GT91 2O2DA 3ZZMA 1JR3A 5J3JA 1JX6A 3NRJA 3B9QA 4YP1A 3PJGA 3O8OA 4QVKA 3R6TA 1JDSA 1BFKA 1TVCA 1X19A 3U9SA 3HYLA 2PLNA 5E4FA 3WO0A 4ER0A 1FNCA 2VL7A 2NWQA 2WKSA 5DO9A 4AJ9A 4HK4A 1BXRB 1GSAA 2ISSD 2WWTA 1TGVA 3NVDA 3U0BA 2XGMA 4BVHA 1OXVA 1WZNA 5K99A 1C0PA 1JEJA 1KVSA 1W75A 3KZOA 2HMWA 3SQNA 2R84A 4CT0A 4RMJA 1SXGA 2I4TA 2HLDD 1BZYA 2F48A 2J48A 4FMCF 4LCEA 3DLBA 2EC5A 3ZHZA 4B3CA 3VR6A 2PLRA 3FCEA 3OIUA 4U00A 3NI2A 2B92A 1Y5IA 2DOKA 1YQDA 2W83A 4UUBA 3GW8A 2QJFA 3C1UA 3UIEA 3MJDA 4C1BA 4PVDA 1N36B 5CA0B 4LF9B 1JB9A 4KAJA 4R2HA 4KLRA 2RHTA 4ZARA 3H17A 5TPWA 3KKZA 4GRDA 2G0AA 5J4KA 4RHXA 3BG5A 1G2PA 2NZYA 1GV1A 1M34B 4JHLA 4UEOA 5T4EA 1T5TA 4J3NA 2XNJA 3ZWYA 1PGJA 2PX0A 2XH8A 4OU5A 1DBPA 1JIQA 1S8OA 4LBWA 1CERA 1AH2A 5CK5A 2DTEA 1F6DA 5E0OA 4I4TF 5LBUA 3PXGA 1Q0UA 3EIFA 4B4DA 2HO5A 4LHEA 2DR0A 3G82C 1ZCFA 4B46A 5DI3A 6AT1A 2XTAA 2EW8A 4MIKA 5JI3E 5EP2A 4RV4A 2BHTA 1T0BA 1XZNA 2H7VA 3CRW1 4FX2A 4H7FA 1KXZA 5GZ6A 1QWOA 4IXWA 1DCKA 2P2SA 4YRPA 1NT2A 4M0LA 1B3RA 3JQDA 3S0JA 3TZCA 2QL6A 3H05A 2GUWA 2C1EA 1EAYA 1TM3E 4F6RB 4TWBA 2YYSA 3CZ5A 1P7WA 1DRUA 1Z2AA 2PNFA 4EY6A 5FI3A 2ODTX 1A8PA 1ABEA 3A4YA 3BF8A 3Q9LA 1N32B 2B36A 1E1RA 2A78A 3PSAA 1F8YA 2AFHB 3S2UA 3UKJA 2MINB 3C6ZA 1TYEB 1PUJA 4EZBA 1X9IA 1W88A 1W29A 1RAGA 2NGRA 3DEAA 3H5AA 4MV1A 4QRHA 3D4LA 1JHRA 3CKMA 1TQ6A 3WB0A 4RSRA 3CR3C 2EXXA 1N57A 4GBJA 4L3VA 1YUBA 1DFHA 2QRHA 1T5IA 4J16C 5DTQA 2FN3A 1W44A 1IY9A 2OQVA 1YVRA 5DOVA 3JZFA 1P2BA 3H5IA 1RHUA 3JTEA 3HVHA 3BCSA 4BO8A 5IM4A 1N6KA 1GNRA 4ZPJA 1F17A 1ZWLA 2NU6A 3L7NA 3MWFA 4L8FA 4PXSA 2FEAA 5DYGA 1IQPA 3TQSA 4F2DA 4Q0MA 4QNRA 3AGQA 1D2GA 1VXOA 3MWGA 2AI2A 4K46A 4LHSA 4RPHA 5AHKA 4A8JC 1X6VA 2JFGA 1CQZA 2QZSA 5F51A 3TPZA 2XITA 3GNSA 4PLHA 4A8JA 4BATA 2C4WA 2VXYA 1LC0A 2GR9A 3CSSA 4BNFA 5AIAA 3C3AA 5IDQA 4BEBA 1Z5OA 5FI5A 1L8LA 1CD5A 3QTTA 4EECA 4PPNA 2YFQA 1XXHE 3R7BA 1MPTA 1D8TA 3I92A 4X93A 1R15A 3OZBA 3SQOA 4F9EA 3TCXB 1NJ5A 1NYLA 2CHEA 1VFPA 3D7RA 2ZB2A 5B4VA 1TW2A 3UGQA 4OHPA 5HPYB 3KKPA 1V5EA 3K9NA 1AE1A 3U9TA 1ZXBA 1B42A 3FLMA 1C3OB 4H3VA 4RA6B 4XTRA 1MOQA 1N6HA 1G3UA 2UZ0A 3SZUA 4EGJA 4EI8A 2H11A 2FRDC 3T94A 3DMYA 5KSZA 4FJ0A 1M2NA 1UPUA 1SHKA 3TZBA 5HXAA 3GJ7A 2ONJA 3O8DA 3U37A 2UVPA 3TRFA 3N2KB 4G37A 3HC7A 3E3LA 2JW5A 3LCVB 1SD1A 2OKGA 3FYHA 4BYGA 4DIFA 3IE1A 2VZ0A 3A6EA 4HB4A 1KWGA 1P6UA 4LXHA 4GDMA 5DNAA 1CDOA 1GKYA 3F46A 3OIWA 3O92A 4CRWB 2BEJA 4I1VA 3M2TA 3AF6A 2SNIE 4PXYA 5DLPA 3CSUA 1OZAA 1PT6A 4X3PA 4UNRA 4FBLA 5LOVA 2X8LA 4CV0A 3RVLA 1T8WA 1JTEA 3WL3A 5KOYA 3VNVA 1GPH1 1YL7A 2H52A 2VF4X 4MSUA 3HTXA 1QKIA 3WGHA 3IILA 4I5IA 821PA 2ZT8A 3S29A 10MHA 2OCBA 4E4TA 3HCPA 3I1IA 5K3FA 3GDWA 1Z0AA 2NXCA 4G85A 4AXBA 4P80A 4EUKA 1RI5A 1JAYA 1DXQA 4JCCA 1W0KA 4TYPA 3UFXA 2ROQA 5K8CA 4A92A 3DDWA 4JJ6A 4CTJA 1GWNA 3DEJA 4BZWA 5BMVB 4V1CI 4H7DA 2HMUA 1JEOA 2BR5A 4IRMA 5K0GA 5A0VA 4EG3A 1XNGA 3TXAA 5JXWA 5EZYA 1U1EA 3EULA 2Y0BA 2XXAA 3TO5A 4ILKA 2MYPA 3ULKA 3ZBQA 1MIOB 1AO3A 4F04A 1KF0A 1MV8A 3GMDA 5LC1A 2ZIEA 13PKA 4B6SA 5BUSA 3HN2A 2ZP1A 1SVKA 1HNWB 3PLRA 1K6EA 4ZVTA 3E81A 1EZ1A 3U26A 1TUEA 1XA3A 1TO1E 2P27A 2RCYA 2WMNB 1N5KA 5BUZA 2V7UA 2DWCA 3CCBA 3UCXA 1SUIA 3FFXA 2YDYA 5AJHA 2PR7A 3SX2A 2QRGA 5TLSA 5JFOA 3U44B 4XQEA 5T6BA 3OIVA 1Y7PA 4LYAA 3WYEA 1RP7A 4B74A 1PNVA 4DBLE 2UYHA 3BWMA 3U81A 1SU7A 4GWGA 1M8PA 4EVQA 2FFRA 2B8TA 2WE8A 1KHHA 2DFTA 2B25A 2SKEA 4OGGA 5JOQA 3AFNA 2UUOA