4KXLA

Crystal structure of dnph1 (rcl) with 6-cyclopentyl-amp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
144
structure length
135
Chain Sequence
RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVAEAAGGDQFIHEQNLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
publication title N (6)-substituted AMPs inhibit mammalian deoxynucleotide N-hydrolase DNPH1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 53
structure length 135
sequence length 144
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kxlA00
3O8NA 3U39A 3O8OB 4RH3A 4JELA 3SBXA 2Q4OA 4WL0A 3OPYB 3EHDA 4I4IA 1S3FA 3MAJA 2IZ6A 4JENA 4LJRA 3HNOA 5AJUA 1T35A 2F48A 4LJLA 1S2LA 4FYIA 3O8OA 1WEHA 2HIGA 4LJKA 1S2IA 1F8XA 4KXMA 4PFKA 1RCUA 4KXNA 2F62A 1S2DA 4A3SA 4FYHA 3F5MA 3BQ9A 5AJTA 3QUAA 2KLHA 3UQZA 3O8LA 4U1RA 4OHRA 2A0KA 4JEMA 4NPAA 1MTOA 4FYKA 2F67A 2F64A 4P5DA 3IMKA 2KHZA 2F2TA 1KZHA 2NX2A 1YDHA 2IZ5A 4MEJA 4I7EA 3PFKA 5ITSA 3K2QA 4KXLA 6PFKA 4OHBA 3GH1A 2IZ7A 4MCJA 3OPYA 2PFKA 1S2GA 2A33A 4HX9A 1PFKA 2Q4DA 4I36A 2PMBA 1WEKA 1F8YA 1ZXXA 4P5EA
chains in the Genus database with same CATH superfamily
2QTVB 3BTSA 4HQOA 2Y1GA 1B43A 1QE0A 1X1RA 4BMSA 5JY1A 4ZHQF 3DH0A 2JANA 4UNNA 4NOJA 2C3UA 1RQLA 3SNHA 2XXJA 1H6AA 1VGVA 3ZBUA 1I7DA 3O4VA 5EHGA 5LA6A 4I4IA 3H1BA 3BHJA 2JFHA 1HE1C 4NULA 2ADMA 1PWHA 1AS0A 3L18A 3I53A 3ZBTA 1DV2A 5MFZA 4W5OA 1KO5A 2NSDA 1OI7A 1NJ6A 3B7GA 4YI3A 4MR8B 1E1DA 1AKNA 1CY4A 2W2LD 3JAWB 2XNSA 2GBGA 3G1WA 3UAWA 1PFUA 4M0MA 5K0EA 2FVXA 3KFLA 3E7FA 4RK1A 2X4IA 4J9UE 3TZ6A 2GHQA 4V24A 3QBVA 3T4UA 5IF9A 1PFYA 1DQZA 1N2JA 1S02A 2QVYX 4Y2UA 5AVVA 3F3MA 4Y3UA 5EPUA 2WJVA 4V0ME 3L6UA 4CYMA 1LI7A 1CUEA 3ZW8A 2V8BA 3RKUA 4DRYA 3DOIA 4UVHA 2R6R1 2V4UA 4IFIA 4MICA 5JPIA 3CXRA 2A3RA 4EY3A 2FPGB 2PG3A 5DNUA 2DPLA 3U61B 1XOIA 1RQNA 1QHYA 5AESA 2Q07A 2HW8A 4YJGB 2AXNA 2CNOA 1OT3A 1FNDA 1X9IA 1Z2NX 3MLAA 3FE2A 1EFVB 3FVRA 4RAQA 2I3AA 2PKXA 1URPA 5AHXA 4PNHA 2O7NA 4BQOA 1II9A 1U0HC 3UHFA 4EYEA 1SVKA 4WOKA 1TMYA 4YAGA 3N07A 1FRQA 4WXMA 2ZRDA 2PX2A 4XWAA 2QTBA 3UMMA 2NTJA 2B7BA 5FUVA 4UOEA 4FHDA 3TLGA 1JL3A 1FNCA 1UWKA 5CK5A 1PTKA 3QLVA 4J7UA 4YUZA 4IJ5A 1A9YA 4C06A 1JYEA 2C8VA 2JJ1D 1Z4LA 1RW4A 4MRPA 1ZAYA 5DTQA 1VCOA 1XZKA 2H00A 3R0VA 3V1TC 5LOVA 1KS9A 2DLNA 2HWKA 4QYMA 4JXXA 3UGQA 1KP9A 1TM7E 3EAQA 4XGQA 4YO8A 3D6VA 3K70D 1OGIA 2C8KA 4QJ3A 2FRVA 3T6KA 4H7IA 1B3RA 1V8PA 1Z5NA 3G23A 3PFKA 4JJAA 4UHEA 1OJ7A 2W6JA 3HZRA 3WLPA 1EK6A 4F9GA 4INZA 1HZZA 1QRRA 2H08A 1HUQA 3ORRA 4FDUA 4EM6A 4MRNA 4ITVA 1JIKA 3R3SA 1EFAA 3ZVMA 3ROEA 3SY8A 1F38A 1BWRA 4I9GA 1PR2A 4D9BA 2W6JD 4A6DA 1JT2A 2VYCA 2BTOA 4F2PA 2FGJA 1MV5A 2HCTA 5ALOA 4CKYA 4ZT2A 4D0GA 2O8EA 3B5EA 5B1DA 2YJTD 2QG9A 2FJ0A 4RV9A 1PRYA 2YY5A 4M9RA 3KOZA 4HS9A 4JUIA 4KR9A 4EECA 2C4TA 2H9YA 1OFHA 1AGNA 1L7EA 1KVQA 3S5UA 5BW5A 5J43A 1VFNA 4RTJA 4HWGA 2FPLA 3WA7A 1P73A 3EE6A 4QPZA 3A3PA 3GJZA 3ZK9A 4FSDA 4JJEA 3B89A 2P4EA 4JELA 3S2GA 1IYZA 2JRLA 1AM4D 4KQ6A 1NYQA 2FQYA 1YDFA 4AAYA 4MVJE 4Q39A 3VZRA 5CAEA 2ZBFA 1HT1E 3A32A 2GCEA 3EYWA 3HU5A 5BSGA 5KOIA 1WBBA 2WOJA 2OFOA 4CEJB 4GXRA 2Y67A 2AZTA 4KQKA 3JVIA 1CJUC 1Q1NA 1QWSA 4IVRA 2HSEA 3IQXA 4HN9A 3PEYA 4US2R 2PUDA 1GSHA 4L95C 1RZVA 1CYEA 4MMZB 5KVSA 3VYRB 4F8EA 1J2YA 2VBCA 3R09A 4S2UA 5J4KA 1YONA 2QQFA 4XB1A 3B8EA 3ER6A 3WWCA 3G5UA 5TT1A 4EFDA 2FFQA 3ZIAA 1N2CB 5TF4A 2IZZA 3LKVA 1XXLA 3V1MA 2ID4A 3L79A 3EFOA 3TOVA 3A05A 3REOA 4XB6B 5C31A 1KS2A 2QVCA 3PCXA 4B09A 1PKEA 2IYLD 2X5JO 2PXCA 3OLQA 1QV7A 1V5IA 1T6NA 2M98A 2ZPTX 2YHIA 2X2EA 1M2NA 1LZKA 4PFSA 4AZSA 1LV8A 4AP9A 4DQ0A 2OGUA 4K9MA 1RE0A 2EKZA 2PTGA 4FN5A 4WI1A 4BO6A 4F4IA 2QLTA 5C81A 3FVVA 3AUSA 4YJ3A 4X6UA 5SZKB 2PGOA 1JKJB 5FUYA 3U31A 3FROA 1W9MA 2QM8A 4R2JA 5AVRA 1T6BY 2EC5A 2ZKIA 4LAFA 4PYNA 1QPGA 4A3SA 2RB4A 4FPXA 1TT5B 2P9JA 2SKEA 3IO3A 3OETA 3FAKA 1VLHA 1KAHA 1U8XX 2CLHB 2B1RA 2BP7B 2JIOA 4GOKA 4P3KA 4RSRA 1P18A 3ZX4A 2BGWA 1XELA 1SA0B 4D6XA 1M6VA 2UYQA 3AW9A 5AW3A 4MV4A 3IAS6 2BMAA 4MA0A 4GPZA 3IRVA 4PNEA 4K28A 1IVYA 5KOYA 4Q34A 3DKKA 4B5LA 2ZQ5A 4U4AA 4AX8A 4LV6A 1USKA 2VG8A 1BN7A 2NZ2A 1A5AB 1XTKA 4LZLA 2IOFA 5ALMA 4N3NA 5BSMA 3ZCQA 3C5VA 1O8CA 5EYPB 4XIIA 1LVHA 2B5WA 1MA0A 2C9OA 5JHGB 1T91A 1Y63A 5H3LA 1QTRA 2XUOA 3EPHA 3UM9A 1V3UA 2AOWA 2TRSB 3I2KA 1IXYA 1WUJS 3FCSB 2AV6A 1E6UA 2PWYA 2X5OA 4W5NA 3DLCA 5DK6A 1OFGA 4MI3A 5KTPA 3H1GA 4M0FA 1NFRA 2A5JA 4ENQA 2FMKA 4M9SA 5JEEA 2CLKB 5ITSA 4KQMA 5KTOA 4B47A 1DAGA 4FYVA 4QXMA 2RI1A 3R0QA 3B6KA 3LOPA 3LIIA 3EZGA 5A03A 4JMPA 2PUEA 2Q7OE 3W8DA 2P1RA 2G7ZA 3CTPA 4FB5A 5LUAA 2I4IA 1H93A 1WCIB 1MAAA 3CO0S 1U7TA 2R00A 2XGGA 1SVLA 4L9AA 4CTKA 5G0SA 4WCVA 3PQ4A 4A0GA 1GR1A 1RADA 3HFGA 4LQDA 1QBKC 3OZBA 2GM3A 3N53A 4INPA 5EZYA 2D0DA 1Q0QA 2DWOA 1AKWA 4BX0A 4JUDX 2WMOB 1V48A 3N0XA 3NT4A 3MRVA 4G8DA 4ZXFA 3V1YA 4EKGA 4N5LA 2OAGA 4DDUA 1M5RA 4XGKA 3S7TA 4AF8A 2WNHA 4QG3A 2R0QC 3C6BA 1FDIA 1ZRMA 1ZCBA 2O7SA 1OU0A 2WIAA 1M2WA 2EWVA 2GA9A 3U7IA 1PJSA 5BN5A 3P94A 3T9AA 3NNDA 1ZINA 2P9QA 1J99A 1YD7A 3QW4B 1PEAA 3PC8A 1DC6A 5M3BA 2GBLC 4N3BA 2ZREA 5DHUA 5BN4A 2VK4A 5KEIA 1QOQB 3SF0A 4BC0A 1F17A 1EVZA 1IBCA 3AF1A 3J7TA 5EIEA 1JR6A 2P9GA 3NDIA 4QDKA 3I72A 3V2UA 4DLTA 3ESDA 2O0HA 3RYIB 1S2LA 2BR4A 4EKYA 4ZANA 3LUAA 3RLFA 4WD3A 3NDPA 1Y7PA 1KJ9A 1QYWA 5L8VA 1MJFA 3TPFA 4EG0A 1ZXLA 1QFMA 3UA4A 5LZ8A 4K5QA 5KOHA 1KJZA 4KE6A 3V7NA 1VG9B 2HM7A 1UPUA 2DWUA 2J7PD 4OQZA 3SLKA 3WQHA 2BDTA 1R64A 2ZFUA 4C7BA 1W581 3GLGA 2IBTA 1T1SA 1FTWA 4BRSA 2OK7A 3U19A 5CFRA 1BOOA 5C0OE 2R5WA 2W2NA 5AUOB 1N5DA 4JMLA 1YS9A 3C3CA 3ZLTA 2YWFA 4RZ3A 3QHQA 1IEQA 3TB4A 4D41A 2H11A 1YHZA 2C29D 3C5EA 3CEMA 1UODA 2AC4A 2OD2A 2OY0A 5AW9A 2UZ4A 2PSFA 4NONA 3VNBA 4UBNA 4A23A 4MNTA 4JUAA 1VLVA 4G1BA 3OG9A 4ZRDA 3QPUA 4GBED 1PIWA 1RBYA 1ZKDA 3S28A 4C7MA 2IYOA 1EIWA 3J81A 1T9CA 1RWMA 3EF3A 3PNPA 3KXKA 1QZ3A 5B37A 3SEFA 1CQIA 3WA6A 3OJ0A 4OM8A 3KAJA 4Q9KA 1YTUA 2Q99A 1WXGA 4L0MA 4BO9A 3IBGA 1P0FA 2JHCA 2DRIA 2ZRLA 4FLMA 1M3SA 4MQBA 2BE7A 3WJ1A 4FTWA 5A71A 4ZYVA 1G66A 3IEXA 2B4TO 2OD9A 1JXQA 3QLTA 5JCZA 1D2HA 4BDTA 1QG0A 1ZI9A 4BCDA 2QNBA 4QOSA 3SBOA 3JPYA 1J97A 1IMJA 4TSRA 1UJMA 2PAFA 4YB8A 2C0PA 3NONA 3MLBA 3ZWKA 5BRJA 3P0FA 1K66A 3B1ZA 3U6KA 2HIAA 2E0IA 1DXOA 3M9WA 4JGBA 4BPRA 4V0LA 4GBGA 2IE0A 3ZJ4A 4M1ZA 3HFJA 1YQEA 3V8QA 4TXNA 3JTEA 2YNMA 1AC5A 2WWRA 3SJBA 4Y2TA 4YQYA 1ISIA 1X9HA 4RYLA 1ZMTA 3HDTA 1HNZB 3ER9A 1JLSA 4MWSA 4W7SA 6LDHA 1RLOA 3GEHA 3OLZA 3PL5A 1OREA 5FFNA 3T4EA 4AYXA 4O2BB 1I2MA 5TB5A 1QMPA 1UOPA 4GX2A 3ZXUB 4DFDA 4DMHA 2FSFA 1PJ3A 5DX0A 1U4NA 1VBNA 1YS6A 4FFOA 1ONOA 5HBGA 4FBMA 2VPZA 4GW3A 4GC9A 3TW0A 4ZAGA 1S2NA 3TTTA 3VMMA 4G4IA 3X1WA 3TLAA 1PLLA 3EGDB 2BFFA 4HRAA 3W5BA 1LRLA 1C7RA 1UBCA 1LU9A 1C4KA 4KQIA 2NU6B 4TVOA 2AUMA 1H2FA 1QVWA 2O1WA 2B1GA 1MOPA 3TVTA 3DOJA 3W4KA 3R5SA 2HGZA 3QMVA 4I0WB 4O4JA 4ALNA 4CDGA 2BM9A 2NZVG 5AO9A 2B8WA 3N8DA 4GYYA 2Y9MB 1HC7A 1ZW1A 1KYVA 3O95A 2HYDA 3BXHA 3BORA 5K8UA 1YVEI 4RM3A 1NWHA 1NF2A 4IQGA 3GFRA 5JYDA 2C5BA 5A9TA 4ZZ3A 3L7NA 1LPMA 1Z9BA 2QGNA 3KVYA 3U3XA 1HOXA 2XI4A 2MHCA 4NARA 4RF4A 4XX1A 3LA8A 3Q85A 2ZWOA 4MUMA 4XDYA 2UVQA 4WK4B 5FT9A 1N7HA 5L3QB 2J0VA 2XW6A 3FTPA 4RGYA 1RKVA 4TXMA 1Z6GA 2IDMA 3RV4A 3AB8A 1W30A 1HT2E 1WNFA 4URZR 1AQLA 1OFUX 3ETDA 2WV9A 4M0PA 1NXVA 5IWAB 1NP6A 4QPJC 3LE8A 4U2CA 5FTJA 4EPXA 2BGTA 2IK8A 3WX0A 1JB1A 4UAUA 5LQRA 3KDPA 1U2QA 1T9GR 4G0MA 1JT9A 3DHYA 2HO5A 4JXJA 4ZOLF 5JZSA 3TPZA 4K1LA 5JARA 3ISVA 5E9JA 3ABQB 3ZE9A 3MTEA 3JRXA 5K4AA 1JG4A 2C2OA 3WB0A 3E9EA 2BEUA 3VDMA 1U0BB 2D0OB 1U3TA 2EP5A 1HT0A 3K0CA 3WLFA 4CJXA 2QUIA 2W58A 4NZYA 4FFMA 4FIDA 1U0JA 3PUJA 4M60A 1PX2A 4X6YA 3IE1A 4AW9A 4QGGA 2XD9A 3DEKA 3KE8A 4O0MA 1G5RA 4WERA 2DHDA 1BX1A 1RPJA 4TKZA 1S8NA 5A7FA 1KETA 3BULA 1D1TA 2FWAA 4GGMX 4EW6A 4Y6OA 5EUQB 4ZI2A 2WD7B 3AEKA 3RFTA 1IJEA 4FC7A 4NU6A 2PS0A 2O3SA 2ZJFA 1UBHS 2CK3A 4BGVA 3PNOA 1MZVA 1AB5A 4IEFB 1GPWB 1PJBA 1MPTA 3CLHA 4OBBA 3NHRA 4HLQB 2P0YA 3ZWXA 5B1EA 1S8AA 1UADA 2CVHA 4RZUA 5BV7A 1SCJA 3E9NA 1YZNA 2WV7A 4PO9A 1N2EA 4JX8A 2OCIA 3VC1A 2M6KA 3AP1A 3ONEA 4ZICA 3C5HA 3N74A 3PDIA 3QI7A 2VXOA 4LHZA 1AF4A 4LOHA 4Q3EA 2HRRA 3MT7A 4KWHA 3FHLA 4RTKA 1DS6A 1E3WB 1H8HD 1GGHA 3AHHA 4MCJA 5HIKA 4FD3A 2FFBA 2OZVA 5IJAA 2FW0A 2C2BA 1D2RA 1XQ6A 2QD3A 3FX2A 3VMFA 3S1SA 1QTIA 4B76A 4KYVA 2JPDA 1KH2A 3GWZA 3E5HA 3IEKA 4LY6A 4O4HB 1XL1A 5DSTA 4YRBA 4HNVA 5JS7A 3EIEA 1I0LA 3RTEA 3T1HB 3HDJA 3K9CA 4GPAA 1WCV1 3JQ7B 3QU4A 5KJ6A 2RDMA 2DPMA 3BJIC 3GMIA 4ER7A 3IEIA 3EBLA 4DTCA 1NYLA 1X1DA 5JSQA 3PC4A 1A9XA 4C08A 5KYYB 4TMTA 3ZV6A 4UCXA 2SKCA 2VXYA 1TJ5A 2BEKA 4QTYA 4BFTA 3DB2A 3R74A 4WXPA 4YCCA 1X92A 1DWUA 4CIWA 2BC9A 5CA0B 3OZTA 1GQOA 2D7CA 3I30X 3N2KB 3QFRA 4YPFA 1GP2A 4V1CI 5D8DA 3E4CA 4CCSA 4U5QA 2J3KA 4BYGA 4N4AA 3DE6X 3D8TA 1UWCA 3G6KA 3RVNA 5COBA 5FUQA 1EM8A 3JW8A 1RWPA 3CNEA 2D3WA 4IV8A 2Q9CA 4II7A 4OI4A 1AT1A 1SKYB 2VDNB 3MJRA 4XSGA 3ED1A 2ZTVA 3LW7A 1C1DB 5A6SB 4S0ZA 121PA 3NFRA 5SYNA 4HFMA 4NP6A 4K0KB 1CNMA 2W8ZA 5LDHA 3L9WA 2A9OA 1W85A 1FCJA 5F9FA 2JGIA 4TMFA 2MYUA 1XNGA 2CUKA 3LRXA 2BMWA 4C89A 4PC1A 4GYKA 1H66A 4K26A 4FE3A 1SXJA 2DBRA 2W6QA 1NT2A 1KMNA 2CB9A 1II8B 1WCWA 2JH3A 3MK31 5B2ZA 1ZVQA 3P96A 1DXQA 1XBTA 2PX3A 1BZYA 2FOIA 2VPIA 4RHTA 1G5PA 1MF7A 1TFRA 3CNNA 3WBFA 2WYUA 2AKEA 3OLVA 3R77A 1N2CE 3EK2A 4NNJA 2PNJA 1R15A 3HJHA 1YI1A 4P80A 3ASUA 1RRKA 3MWDB 5IX8A 1NQTA 3EVCA 2EZ8A 1E1QD 1JIIA 3HVHA 4M49A 2F4NA 3UT6A 3WLMA 3H2YA 1Z22A 3W7AA 2H4YA 4H16A 5JAUA 1W4BA 1OYWA 2W0SA 2Y0CA 2YWHA 2EV9A 3DMFA 3MIZA 2YY6A 3DW1X 3KZ1E 4RJLA 3D1VA 1ZM2A 4GE3A 4JKOA 4Q3DA 3W2HA 3DCYA 2C7RA 1ZIDA 1P4RA 1FL9A 2H5IA 3DWFA 3WGJA 1BVHA 1LF5A 1E5XA 2PMDA 2W71A 3I2GA 1QGDA 1KL7A 2I4LA 4KN5A 3RTBA 1Q12A 3CSDA 5AFSA 1ZU4A 1S3IA 1Z8DA 2PR7A 3HY6A 2H6EA 3EUEA 1NURA 3LUCA 4B7AA 2PZ8A 3QEMA 1GNLA 2D62A 4ZOAA 3O1JC 1NR1A 4WH0A 3GZNB 3KQYA 4B84A 4BKOA 5LKRA 2WP8J 2IX9A 2P9CA 4YP5A 3VVBA 3B52X 3LP8A 2VHXA 5KC8A 4AICA 1AH2A 3PE3A 4S3MA 3M6VA 1PZFA 5CT4A 1BRMA 4CFYA 3CE6A 4QUDA 1WXXA 3W4JA 4CLHA 3THXB 2BKXA 1R10A 2R6ZA 1UFKA 2ZYHA 1KSHA 1ORDA 3BCRA 3O21A 1NKSA 2PLRA 3ZQJA 2RHHA 1N3YA 5F33A 1G5IA 1N1GA 2WWGA 5L4NA 1RAAA 2E4VA 2W2KB 1E1RD 4YFVA 1XV5A 3DTVA 2AYYA 3NHZA 2XCRB 1E7YA 2HHLA 3VR5H 4ZVOA 2NUTA 2B4YA 3CWZA 3KU4A 1B2RA 4M36A 2X8AA 3EG9A 4QLBA 5H8WA 1PBNA 3EWIA 1Y4UA 2GLUA 3G0BA 1OB5A 4JI5B 3LC2O 1PGJA 2I29A 1PT9A 3K8ZA 2E7ZA 4CETA 3ELWA 4P4SB 2GCOB 2HMAA 4AECA 5EMNA 1DFHA 4XUDA 5LQDA 3QEOA 1JS1X 3ZJTA 1ZH2A 2GK7A 1ZOLA 3OPYI 4MW2A 5C1BA 4ZVPA 4TRRA 4BQSA 1A5BB 3DGFC 3HADA 5LFAA 3TNFA 2B61A 5EZ6B 1KVSA 2VJAA 3GA0A 1QFJA 1QHHA 2J33A 4OATA 2A88A 4MI1A 4EPTA 4EG6A 1U7HA 1E63A 4HB2A 4BAUA 3A7DA 3KPJA 2XKBA 3KZMA 1DO2A 3C43A 1OGYA 3MQ2A 3F6BX 4G0QA 4P4TA 3R8XA 3W04A 2X7JA 4B83A 2CW5A 2FPWA 3NAGA 5I7VA 3NW9A 4HWTA 4N9WA 1RPNA 3TMKA 2ILVA 2P69A 1J2EA 2RHWA 1BFUA 2MSNA 2YHAA 3CPSA 3H2KA 1J8MF 4LA4A 4TMVA 5LM3A 3QK7A 5JQGB 2Y99A 2O2IA 3L9XA 3STHA 2TMKA 1UMDB 2WZBA 4NIMA 5EFZA 1V11B 1EUCB 1ADCA 1NP7A 2FAXA 3CRNA 2JATA 2K7ZA 2ZBGA 3MC1A 4HH3C 4XSHA 2I67A 1N2BA 1NZDA 2UYOA 5JXWA 5E1BA 1ZSNA 3WIVA 1UQUA 1JVSA 2ZE6A 3DOFA 3AVQA 5LWQA 2JI9A 2ZP1A 3QXXA 4YC7A 4MUHA 1FU8A 5ALSA 1S1CA 4TYNA 4RENA 4QULA 3QG1A 3ED5A 2ZWIA 1J90A 2UUCB 3AEUB 2VEDA 5GONA 1A9ZA 1F3LA 5JV5A 3W5CA 3F7NA 2MSDB 4QO7A 3HL0A 1AZLA 1N6OA 1R37A 2HXYA 4GRDA 4OBXA 3THRA 5KSPA 2GAJA 2JFUA 4CMBA 2VA9A 3NT2A 2ZYGA 3JRWA 4HH1A 4M0DA 5EFOA 3WYBA 1A4XA 4ZC8A 3HM2A 1XF9A 3CLVA 3F4LA 5M2QA 1VPTA 1VRCA 1ZH8A 2ZT6A 4FDLA 3WWPA 1UBEA 4AG5A 4WCDA 3RKRA 1CQIB 1B0UA 4JLJA 4E5VA 3ANNA 4MJXA 3TRKA 8OHMA 3LIPA 2VDLB 1ESZA 2J41A 4U39A 5E9QA 3TIIA 4D6YA 4NMHA 1SOWA 5DLDA 1GFSA 2PYZA 4NEGA 4BZZA 4KBGA 1MHTA 2F3QA 1NVUQ 5FBWB 2G9ZA 1EAMA 1KE1A 1T5LA 2ZUTA 3UAOA 3M89A 5IJ9A 2HOQA 1PGQA 1XZDA 1M34A 2EOAA 2GJAA 4NBTA 4QARA 5JJKA 2XGSA 1NJ8A 2Q50A 3K0CC 1AF7A 1W2WB 3DE5X 4M76B 4YNBA 3QIVA 5DBEX 1L1QA 3WHLA 1RWXA 1UUFA 1XDDA 2Z9CA 4FT4A 3FCXA 5E7IA 1KWGA 2NXJA 1LPNA 5ALWA 3ZLBA 1U1CA 1UFOA 3R5FA 4MPPA 3KB6A 5FFMA 2WG1A 4ACAA 4GS5A 1ZUWA 3AFMA 3U9SA 1I4LD 3CYFA 4MEJA 4ZAFA 1ZC4A 2IHVA 2W90A 4K03A 1Z63A 1TQDA 4N12A 4OJTA 4U2KA 1YS4A 3SYMA 2Y0PA 3FYUB 4YUAA 1N1DA 3OCUA 1XMIA 1C3LA 4H35A 2CKDA 2XMDA 3TQHA 4O3MA 4REMA 4EFMA 3TINA 4TZTA 4F4UA 5HILA 4BL5A 4Y1GA 2VDWB 3PX2A 2O7VA 3EGEA 4C0LA 1G2IA 4B3MB 2HCRA 3IAFA 4WFJA 1IB6A 5FO0A 1LRJA 2MSCB 1E8NA 1J2JA 4P0QB 4LZOA 5LQMA 4ARCA 3GLHB 4YJ2A 3RVOA 3VPHA 2E48A 3I12A 2DJ5A 4LVNA 1EK1A 1G5HA 1W1WA 3NOXA 5B5SA 1VIDA 2FI1A 3PQ3A 2JFZA 3I28A 4A6EA 3AC0A 4PAOA 4CW7A 3FSGD 2FE1A 1F8UA 1SCBA 5HUHA 5JJCA 2NVWA 3G89A 5TQVA 3CSSA 4BX3A 3UN1A 3A26A 1BROA 4QSHA 1G21B 3ICEA 4P9NA 1XQVA 1CY8A 3SZOA 3HO8A 1QH1B 3GGOA 1B0ZA 3PWZA 3I9NA 4PZ9A 4BMNA 1N9ZA 2ZRQA 2AHOA 3NGLA 3JAKA 1RYEA 1CRWG 2RAFA 3BEOA 3P2IA 4Y7CA 4DUPA 5JBIA 5IAAA 5CFOA 3BAFA 3FSJX 4LZPA 1GPMA 1SAYA 3EH1A 2XGJA 5SZIA 1R8XA 5JANA 3GUVA 1JP7A 1HL3A 2XB6A 3GW8A 4EY4A 2GN6A 4BMYA 4J07A 3FSRA 2QYSA 4IJUA 3DDZX 1TI7A 3AINA 1KPGA 1CS0B 5AR1A 4XI9A 1CJMA 2QMOA 2ECOA 4YYEA 5BOSA 3AL2A 3KSBC 4ILEA 4BWGA 4G5QA 4DMMA 2E5WA 1JDVA 3NUGA 5JEDA 3ZHQA 1YJXA 4NCIA 1N2XA 3AOEA 1PWZA 1CRQA 1JEQA 1WMBA 3CC8A 3IBYA 3KR0A 4FHEA 3B3JA 4UE6A 3PF9A 3ZTWA 4BMVA 4OP2A 3N76A 4QYIB 2VTBA 1ADFA 3L8DA 3M7IA 5ERXA 4Z1MA 3RK1A 4J1TC 2ZU6A 2POCA 4FEAA 3HBLA 5A3JA 1E62A 3F5MA 4I1VA 5JVDA 5K0ZA 1PW5A 2EKPA 4MVJA 1LW7A 3G2IA 3IKLA 3W1EA 4KUHA 1YC5A 3Q1LA 3TZCA 4IIJB 5JSUA 4P22A 1T4GA 3HO1A 3ZY2A 4MR9B 1X7XA 4X20B 4TKLA 3F6YA 1BA3A 3GPDG 3HYSA 4RY0A 3U3JA 3AOGA 4KYIB 1BXZA 3EXG1 4EABA 2B92A 2KW5A 5TMEA 5J2UA 1KP3A 2JRCA 4JEMA 2IPNA 1QS0A 1ZRSA 3OZIA 4MKHA 3KKNA 1FQWA 2R1UA 5HIIA 4LQ4A 1NUHA 4YJ2F 2IYXA 1DEOA 4BNVA 1L5VA 1HURA 2QTGA 3K4QA 2Q46A 2RKBA 5LR6A 3MYRA 2HWWA 1WB6A 1X86B 2W8BA 3PIRA 3RVKA 3IQWA 2QSJA 5T8KC 1JHRA 1QQ5A 2H2IA 1V47A 3QVTA 4KYTA 4QU5A 3ZGVA 1TIBA 3KVOA 2ETXA 2REOA 3MMZA 4BS9A 3F4KA 4XJTA 3M6UA 5EGSA 2PUGA 2NADA 1M54A 2Z5VA 3RC2A 4CKZA 4BN0A 3F6CA 4PBRA 3F6PA 3C3YA 3N0TA 4PC7A 2OM6A 3R3UA 3I9V1 4DMFA 3GDGA 1F2DA 1P17A 3AKCA 1JWLA 4HAOA 1DBIA 4PG5A 4ZAYA 3CPJB 3ZKWB 2G77B 4CHTA 3ZVRA 3QXCA 3NHKA 1MNQA 4IDPA 3L0PA 3VZDA 4B48A 4REQA 3HPQA 5LQUA 1L3BA 1Z5OA 5AI0A 4YRIA 4CT5A 5HBRA 3VX4A 1XEXB 1Z6AA 2GZMA 3N9IA 4H4DA 4XYGA 3CUTA 3KWMA 3S27A 2AJTA 3ZE6A 3IUQA 4DQLA 3AEZA 1O96B 3JQAA 2WB2A 1TT7A 4LDAA 1E79D 1KQGA 2TSYB 3JALA 1K8ZB 3EF0A 3ULKA 1KH1A 1KGSA 4DHWA 4I5GA 3TXAA 4RA9A 4C22A 5B4VA 4TXHA 3KJNA 4C2TA 1FE8A 1W87A 2XTZA 3HGMA 3WRWA 1PW7A 1LC0A 1VMDA 1ZLXA 3RU3A 1NASA 2DVMA 3PC8C 3IXLA 3M8KA 2E89A 3G5MA 2I2DA 4G5GA 1CT9A 3WGTA 5B2FA 3L41A 1OAAA 2WPDD 3IDQA 2GNAA 2XT6A 3LSYA 1EX1A 2VN8A 5CTAA 3TYXA 2B94A 1JZTA 2AUNA 4MRAA 2IYSA 5CTJA 3LLVA 3ETCA 3GMSA 4LJAA 5I9SA 5A0FA 3FSEA 4TN5A 3WTCA 1EH5A 1RVDA 4IFEA 1E7SA 3VI4B 3HY3A 4DB2A 5ARBA 2EYQA 2R6GA 4Q24A 1J5XA 4JL5A 4L4RA 4F5EA 2GBCA 2B9EA 5IC5A 5TJHA 2QTZA 4UCQA 3O4IA 3NNNA 4YECA 1R6TA 3ROMA 3NHSA 3CONA 3EWAA 1U4SA 1U0SY 1RKUA 1CJSA 2HSDA 4DNPA 4B3CA 2LWIA 1SRRA 5E2IA 5I4CA 1GGEA 3CCCA 4QQKA 1T9AA 1CY2A 3T3OA 2GZHA 1NF3A 2QV7A 1KKUA 2XUGA 3CGWA 3DO5A 3E5RA 4FFBB 3U7RA 1YRQA 3UKDA 2UZAA 3R4VA 4DNOA 1INLA 1OJLA 2VHUA 2O3QA 2VQEB 2QE7D 3CBQA 2EFCB 1WSBA 1W5FA 2V74B 2XQVA 1DSSG 2PEYA 3ZUPA 1E7MA 1JDBB 2VNJA 4I08A 2AKAB 3QBDA 1G0NA 1RI1A 3NIBA 3QOFA 5F5LA 3DB1A 2VQDA 3ZV5A 6GPBA 2R8BA 1SBHA 2WUEA 3FTEA 5D5PA 4MCHA 4AMBA 2Y6VA 4K86A 5FYQA 3ZW9A 1Q6YA 4TX1A 4LX8A 1ZM4A 4ZAXA 3QRWA 1MH1A 4ZJZA 2PFGA 1DDOA 2GCPA 1B93A 4JN6B 4ZZ2A 4KYUA 4IKOA 3M4YA 1W48A 4AKSA 4EG1A 5FBVB 1HQDA 4H1WA 4TTVA 3PNYA 2OAEA 3UWKA 1HEUA 1QAMA 3EVEA 5CT6A 3SF8A 2XE7A 3OT4A 1SC9A 1T5TA 1XLTC 3RU7A 2Q1WA 3EARA 3HJFA 3JQ9C 1NJSA 1SXJC 3AWDA 1XZNA 3FTNA 1T36B 2P79A 4Q7LA 1VXOA 4RGQA 4Z7JA 5B58C 2JCGA 3RHTA 1A8IA 2XSZD 1WM1A 5K3FB 4UMVA 3VH2A 1T9BA 2Z58A 2D6FA 2EG5A 2Z4TA 1D5CA 1DLJA 4K6CA 4PZAA 3IB3A 4IIFA 3ICOA 3O6VA 2DUJA 1IY2A 4K40A 2OYSA 1P4SA 2J0EA 3ZS9A 2ARKA 2FP3A 1PD0A 1S5PA 4J6EA 1ZGGA 3S81A 4FNMA 4DUGA 5KYKA 5EQFA 1LPOA 1MU0A 4JITA 1E4EA 1OSNA 1RBMA 1JF8A 1HE8B 3U4AA 2GK4A 2ZIAA 1I01A 3DFKA 3SSNA 2IUYA 4NZNA 4PO1A 1RWVA 3C7TA 3EDMA 1NFQA 4KV9A 2RFLA 1X7WA 2VNSA 4R8SA 4NJEA 5ED4A 2PVPA 3C1AA 5CPBA 1E89A 2MSLA 3BIXA 2QMEA 2QZ4A 2F1JA 4LDPA 1RRVA 4RMGA 1LRKA 1LC3A 2LIPA 2ODAA 3WBBA 5IS2A 4ZXPA 1J09A 1NRXA 3QEKA 3HU3A 4IWXA 4RY8A 3V34A 1ZXBA 1AKQA 3X2FA 4BMZA 5L3QA 2P6NA 4TTSA 5A3VA 4DR3B 3CF6R 5LBIA 4DIBA 2P35A 1E9BA 3NCHA 4E1VA 5CB4A 2DEUA 1HETA 5C52B 4R7GA 5EKDA 1V7ZA 3HWWA 3TH5A 4J4BA 4JVMA 3OPYB 1F0NA 4G6ZA 3CR3C 4XR9A 3T12A 3QXJA 4KH1A 1XTVA 2JIQA 4UNPA 3HXQA 1SELA 1BQ4A 4KX3A 1T13A 2CL5A 4OCZA 4XLLA 1MZPA 3QX8A 1GTSA 1FVHA 2WY2D 1DC8A 3IP3A 5T5QA 4EBBA 1SCKA 3A2LA 4OLFA 4C05A 2A9VA 2QTAA 1P6XA 3ZDFA 3D8BA 5ALRA 1I7PA 3VV2A 3JQ9A 1ODTC 1GNVA 2FOXA 1BMTA 2GF9A 1Y42X 3FM9A 1VLMA 4MX8A 1P45A 2PUFA 4OH1A 1NVGA 4MKZA 2CMGA 2I0FA 4FS3A 3WLNA 3HTXA 1SKYE 3I2JA 4Q15A 3Q0TA 4A16A 5TLSA 1L8LA 3N1UA 4HUQB 4N5IX 2XJ9A 3TXYA 4D9NA 4EB6B 1ID1A 3N8NA 5EHIA 1TRKA 5THQA 1RAFA 3DTYA 2RKWA 4FFWA 3LQ2A 1SXIA 3IBSA 3LK7A 4G86A 4R1MA 2NO1A 2EJBA 4I4TF 4JUBA 4CQNA 3G6WA 1DOAA 1RMTA 1U6IA 1WMSA 2V45A 1A7JA 3TRJA 2AG1A 4MVCA 3MMNA 4O4LF 4TXJA 2ZT7A 3Q8MA 1PJ2A 2OB1A 2TMYA 3OM0A 3QV2A 3QWFA 4IDAA 4G9BA 4INAA 4TZ0A 4BBPA 3DFMA 1K2VN 1Z7YA 3F0TA 4LKRA 5AM5A 5DNWA 1H3NA 2Z3WA 4LPSA 4YT2A 3U13A 1FFSA 1FJXA 1XTJA 1IK4A 1TK2A 2DFPA 4L28A 1U7XA 1JR3E 2MTBA 4AS3A 3L5KA 5JT1A 2UDPA 2JJ2D 1K98A 1E2IA 1UT5A 4WECA 4ARSA 2AW5A 4FHGA 3H87A 3TJRA 2YXDA 1HE5A 5AW4A 5F2KA 3SYLA 4G56A 2IU4A 1CK4A 2BEUB 3ZGXA 4AD8A 4E21A 1Z3CA 1K92A 2OT3B 5C1DA 4ZMSA 3FLMA 2E5FA 1GRNA 1FW6A 3TRDA 5J1TB 4HXGA 2PSSA 3C7DB 2QZSA 4YAJA 1L7MA 3C70A 4F1JA 3BFXA 2PQMA 4OREX 2VUSA 5ALXA 4L85A 3NU1A 3LNCA 3LPLA 5JATA 1FUEA 4P32A 3TG8A 2I22A 1VCIA 1ZS9A 3ENQA 3I0MA 1NBEA 5ENVA 4BQPA 2CXOA 1Z33A 4IF6A 4DZTA 3CNHA 4G8CA 3N58A 2XCQA 1RLUA 3I9LA 3PPXA 2WYOA 1L4EA 1V16A 4FUQA 3NIFB 4EY5A 3FFBA 1FMTA 1QIIA 1VL1A 4MQMA 3FPEA 1KMIY 1MBZA 1PO7A 3H2ZA 5DW0A 4EF5A 4OFZA 1P1KA 1FW8A 2XQKA 3SWWA 4PR0A 2JIMA 2QYHA 4I66A 3SHQA 3PF8A 3QVUA 3NAZA 4GZ5A 1WDLA 5JD5A 3KCQA 3NTQA 2F1KA 3D7NA 4D8UA 2Z8XA 3DMDA 5TQ0B 3KAQA 2XODA 1X80A 3EDYA 1UPFA 3K72B 2OYRA 3BJEA 3IQDB 1Q1AA 4F6RA 4RTLA 4NENA 4Y8VA 5AOAA 6ABPA 4NXMB 1FNNA 4OHYA 1SH7A 4BUCA 3W5AA 4D9CA 3AL3A 1IWPB 2GCGA 4GC5A 5EIFA 3ERCA 4IMRA 2ZCVA 4F3RA 1JXOA 2PJRA 1MJGM 2RGBA 4GM4A 4ARBA 1DE0A 4I1YA 5TQJA 6REQA 1XD9A 2YDYA 2KI5A 2C04A 1IU9A 2QY6A 2GMWA 3VTFA 5B57C 3VO9A 3ZH9B 1ZD9A 2VQ6A 3SZLA 4B3GA 4LOJA 1QSGA 3TDMA 3CA8A 5G3ZA 3TSYA 3WP0A 2OBBA 2ZYVX 4OQFA 1R0SA 3ADPA 1T2DA 3GEEA 4XQ9A 1IBSA 1MIOB 4P6VF 3DE4X 4DNXA 2CFSA 1ZMXA 1W75A 5DCYA 3AVVA 5C37A 4MQ5A 3PVCA 2GZAA 2XQIA 3EXFA 5A3SA 4C76A 3LCRA 2QRHA 4H60A 4FD2A 5LNK1 5GIOE 2CE2X 2GDJA 3IT3A 1O6FA 3W5UA 2EFGA 1OBVA 2OBLA 4RDCA 1R6AA 4FNAA 4WKBA 4ZO4A 5I7EA 1M1NB 2XRZA 4D0NA 2J3HA 4I99A 2BHTA 2X7XA 4GDFA 3E9YA 4YUXA 3QNMA 4RKWA 3L02A 2OO3A 3F5SA 2WC1A 1XTZA 5E6SB 4D5GA 3KAKA 3O8LA 1FS4A 4B3DA 1TKRA 2WI8A 1KEEA 3QQ5A 4I1OA 4ALJA 2A30A 2Y27A 5JSKA 1JIVA 2YV1A 1N9GB 3RNOA 4E46A 4GLOA 2IITA 3QF4B 1SM4A 2CYCA 4R0NA 4BEJA 3HYTA 5THKA 3ZNQA 2LCIA 3RHZA 5FV4A 1EINA 3ZK8A 5AVOA 2O2DA 2XOEA 3AUFA 4RULA 3ZR4B 2H92A 2OSVA 4ND8A 2W2QA 1WPQA 3NB0A 4G0OA 3BGDA 1BEUB 3ZHVA 3UANA 2UZ0A 2ZIEA 3PITA 4JEHA 3TD6A 5KTNA 2WSLA 1YOVA 4YP0A 4ZI7F 2P2CA 2M6RA 3K05A 4KR0A 1UOEA 1Z74A 3NBKA 1A72A 3LPMA 2Q2QA 3CFYA 1N36B 2WHEA 4AJHA 4A7PA 1D9XA 1Y1QA 1MH9A 5KOJB 1AXGA 1IPHA 3CZAA 1ZN2A 621PA 1YJ5A 5EE5B 4CG0A 1RJDA 2CY0A 3N2YA 2VDKB 2I7XA 1EVJA 4PCUA 4HWPA 5KJFA 4DR2B 2H4FA 1FMFA 5FLYA 4NBNA 4TUYB 3NO4A 4MK4A 4IUYA 3S2IA 2Q4BA 4EELA 1W5TA 5A4AA 3UBTA 5EIBC 2Q5EA 1MOSA 3EOZA 2WJZB 2WM8A 3I9V6 4YJHA 1SUIA 1U31A 3SLRA 4D25A 1HYEA 1QG4A 3L8ZA 5E8JA 4ZQFA 3WAKA 1Q0RA 5IG2A 1Z0SA 4JOBA 3A6ZA 1GPLA 1R18A 3RF6A 4JSTA 1U0LA 2I1VB 2VHEA 3FNQA 5BMVB 2I6QA 3JASA 2EKQA 1ZCZA 2R11A 2FU5C 3NKFA 4YALA 5F78A 3UYLA 3PRJA 2GNPA 3E27A 3ILVA 4RH1A 1L4LA 5AK0A 1QV9A 4EGJA 3HWX1 1PSZA 2BGJA 3VBCA 1GU1A 2F1OA 3KXLA 1F60A 1S4QA 4D99A 3BD6A 3UXMA 4BIMA 1H0RA 1WD5A 1XVLA 4LXTA 3WGLA 3T0FA 4BIIA 3LPDA 5KMGB 1N7GA 2HIMA 2KJQA 3B6EA 3N2LA 1MC1A 2R4QA 1VP9A 2VDOB 1LPSA 1W25A 4C7JA 4DC9A 4A0SA 2VHVA 3AI2A 1NN3A 3GNQA 1B0PA 1LLDA 4P86A 3N8GA 1HFEL 2O4CA 3ZQ4A 5EZYB 1JJIA 4I8XA 2F48A 2GOYA 2IC5A 1J21A 4IMIB 4YCSA 3AESA 3H0CA 3CPHA 3KTOA 2OCLA 3KB8A 3PRYA 3WTBA 4I14A 3MWFA 2N0SA 3M9XA 1K6MA 1OXKB 1QUEA 3QYPA 1L7VC 2W4QA 4CIBA 3ILSA 4H7HA 3EZYA 5AJVB 1MFZA 1IUOA 3ZDZB 5F2OA 2HA0A 3T3EA 3HFRA 1U04A 3SC2B 4O25A 3UWPA 4UOZA 3IAM1 4UMDA 5BWBA 5KYWA 1ONPA 3ASYA 4ZQHA 4QUJA 5BSTA 2QPOA 2YXPX 5EUBA 4MQ4A 4YA6A 2C4UA 2LBPA 4PG4A 2YZMA 3RPEA 2Y0DA 4HJRA 2GN9A 4DCNA 4ZPJA 1VHWA 3D4LA 3G8DA 3PKIA 3QI2A 2JFYA 4JYMA 4IXMA 1MAVA 4LYYA 4YO7A 1X38A 5SY4A 5BSEA 4NCBA 4FFPA 1PZEA 5CDTA 4WJZA 1T9DA 3LBFA 4X45A 5BNFA 4QOJA 4NDNE 5FHQA 2GK3A 3ZWVA 5FOSA 2R4TA 3V42A 4NBSA 3SBDA 3TWOA 3SG0A 1JECA 3BF7A 4LSZA 3GG2A 3HXKA 2EX0A 2PGNA 4LRQA 3HSKA 1NDUA 1UPCA 1EYZA 4CL2A 4CR7A 1IJBA 2Z57A 3DE0X 1GT91 2H4ZA 2Q3LA 2UVPB 4OYYA 4RF3A 4YJ3B 5D3MA 3RS8A 1O6CA 3SJAA 3OZDA 1E58A 2OL4A 3M1YA 4RELA 3SI7A 2RGCA 4BMDA 4W99A 1UFVA 2M6SA 3C1UA 2Y4NA 3NOQA 4YDQA 1DBWA 2VDRB 3K6JA 1TM3E 4E6EA 1Y9JA 4C2UA 5G53C 2CFCA 3K1AB 4Q00A 3A25A 1PJLA 3KLNA 4UW9A 1NJ1A 2IGTA 4MWDA 4TT3A 8LDHA 4OOFA 2B3TA 1GVNB 2FN8A 3AF2A 4BLOA 2JGKA 5I01A 5IAJA 5ALGA 4L27A 3QU2A 3Q88A 1H1TA 4LQCA 2GEDA 1S2GA 2N46A 3JQCA 3TAUA 5BSVA 5ENZA 4JLNA 4ZK6A 3GD7A 3F2VA 4HWKA 2Y92A 4MV5A 5IK2A 3TZLA 1CRLA 3LQ1A 3UFXB 4DIEA 1PQ4A 4I36A 3KT0A 3L77A 1IHYA 4ZMRA 5IUKC 4HAIA 5HE8A 2J09A 3EUAA 3KPWA 1GR0A 1WV1A 1JE0A 3SQLA 4LBWA 4F6RB 1CZKA 5JJLA 3GJ6A 1NOJA 3F67A 5LQAA 3HL4A 2XWBF 1JHZA 5U4QA 1QLHA 3C8HA 2IZ0A 1HSOA 1YBHA 2VRCD 4NCHA 4CTJA 1LSSA 5AHWA 3WYAA 1ORVA 1OYOA 1ODCA 3AIOA 1W94A 5EYPA 2Y1CA 4PS1A 3V55A 4B32A 1KEZA 4JI1B 2NXNA 5G1PA 4WNYA 5DHAA 4YUYA 2PGLA 4ZFNA 5B7PA 1E2EA 1CU1A 1ADGA 5LL6P 3P52A 4XD7A 2HDWA 1W19A 2YV3A 5FULA 4M89A 3N05A 1NVFA 4IF4A 3N7UA 7ABPA 2CD7A 4Z3KA 5JISA 4JI8B 1TLLA 4IO1A 3QVWA 4HN2A 4PM4A 3DV0A 4GSLA 4K81B 3W2EA 2IKQA 3L06A 3NPMA 4ZQGA 4Y67A 1FUKA 3F97A 4ZYWA 2QKYA 5DM4A 1WP4A 2QZJA 3DWIA 4J0EA 3QXGA 3I34X 3BJMA 2HPVA 2NPOA 1T0BA 3O90A 1V11A 4NJMB 2EKDA 4NBRA 4RD1A 3BFVA 3F8WA 4BNXA 2ZJ4A 5BXYA 1H8ED 1VE9A 1K7EB 1EXVA 4YV1A 4BMOB 1T0PA 2YMMA 2IP4A 1LLFA 4Q7JB 3OQVA 2PL5A 1LI5A 1PN3A 1KVTA 2B20A 4HDRB 1YZYA 2FSVA 3P9CA 1V8OA 3K09C 4COKA 3LP5A 2XVMA 3CCFA 3IVAA 3BPSA 1U5AA 3D8UA 4KE9A 2PBRA 3VR4H 1LLCA 3FMFA 9LDTA 1E2DA 5I9MA 4CF7A 2AOXA 2FZKA 5KQPA 4ZN6A 3JARB 3O47A 2HRDA 1OT5A 1MMFB 2XDQB 4DLSA 2NSHA 1V8BA 1U7UA 1N8KA 2ZIFA 4YRDA 1YZKA 4R2IA 4UUBA 1LX6A 2WQZA 2FETA 4P4SA 4B3TB 4CBVA 1CEEA 3KQVA 1Z26A 3V8MA 5IKPA 3ENNA 1G3UA 3Q7PA 5ER6A 4KMRA 3WYDA 2O54A 1TCCA 1ZC3A 4FMCB 3AZPA 2G6BA 1F4PA 1NIJA 1QDEA 2AWOA 2IEYA 3HXOA 4P08A 5DNEA 5WRFA 3F7MA 2XUJA 1DBPA 4KIJA 4NZMA 1YZ3A 1V2GA 3I05A 1H2RS 1FTSA 3JQGA 3T7KA 3QIAA 2D5CA 1YH3A 3G2JA 4XLTA 3GLGB 2IYYA 3KL4A 5AKHA 1XEFA 2SCUA 1E2PA 5D85A 3WHPA 4ALIA 4YHHB 1N8SA 3X1DA 3P0IA 4YMVA 3UAGA 3EVDA 4TYWA 1EK2A 1NKTA 2I1WA 2FEAA 2PGAA 1QP7A 2F3PA 2UYCA 1VPDA 4YP1A 4NU0A 1VJDA 2Z08A 1XT6A 3DT6A 2V4MA 3ICCA 3FLBA 2G63A 4KSCA 3PBKA 1HO3A 2NZXA 3DM9B 3QVGA 1B2LA 3HCOA 1XRLA 2ECKA 3P4YA 4XDGA 3VR1A 5JS2A 2DR2A 1TYAE 3GARA 2QD1A 3H2SA 3TW8A 3GK3A 4HXEB 2EJTA 4GOJA 4PF1A 1QYCA 2CLCX 4LCBA 3DFZA 5H82A 4NMWA 3Q5EA 1IJKA 2WD9A 1E0JA 1SGWA 2I7VA 1ODFA 1QR6A 1WUKS 2I7CA 5LXTF 5A4KA 3MCUA 4P4GA 3DLHA 2B25A 3IOMA 5KNBD 1P19A 1Z0KA 4ZT4A 5EKSA 2ZS8A 3W5HA 1PR4A 2ZYWX 3NV7A 1FU4A 3U48A 4TPKA 4W1SA 4GR9A 3PCTA 4DDKA 3K1TA 3DQQA 2ZJ1A 3ZWOA 1GN8A 4J7CA 3T7DA 1UK8A 1O87A 3PJGA 3RT1A 2B2XA 2FRDC 3BRWA 4DCSA 2FX3A 1L3IA 1QIKA 1ZSYA 2C84A 3JD1A 2PY6A 4LEIA 2A94A 5CGZA 5KYXA 3QENA 3JZIA 2Y77A 1ZK0A 2BBSA 2QP9X 3LFTA 1M0EA 4ENWA 1DUVG 5KJ1A 4CI9A 1BMQA 1IBRA 1EE1A 2YDXA 3H1PA 4I8IA 5L53A 4NV0A 1ZUNA 1SKMA 1SIWA 2HXGA 4C6SA 4LDJA 2QQGA 4D4HA 1FDVA 3WXMA 3WQQA 1KDRA 4TV8B 5DI9A 3ZWBA 5BT8A 3ZD6A 3GXOA 4YMHA 3IVCA 1RCTE 2PKQO 3OURA 2OQ2A 3ZIAD 2IXBA 3H5TA 4GMXA 1JHXA 1G64A 3BK1A 5DISB 2HKIA 3SQNA 3K5IA 2GXQA 3L7YA 2JGNA 2G1JA 4Q48A 1O95A 3F5FA 5LQKA 2NAFA 1PGNA 1SR8A 3WJ7A 4FFLA 1U99A 4RW0A 4QXPA 4WIAA 5H80A 1RC8A 3PXUA 1IN6A 2QP4A 1C8VB 1Q77A 2HY7A 3EDOA 2WP0A 4O29A 2V5UA 3N75A 5AOBA 4I6EA 1GHTA 4MGYR 1LFDB 1GZVA 3T4PA 1YGPA 1P2TA 4ZHQA 3LY5A 3NXSA 4RVOA 4UCFA 2GM9A 4P54A 5L3RA 1LWOA 5GWXA 2I6XA 1U11A 2C3YA 3PV0A 1O4VA 3RBZA 4MGEA 4QNMA 1Z29A 4KUGA 4JP1A 4ER0A 1NF8A 1RIFA 1Y89A 2WJ4A 3CRZA 1Y6ZA 3BB1A 3LQFA 4U5XA 4WNCA 4WW0A 5H5JA 3U4QB 5JW6A 2FPMA 4ND6A 5GOTA 4KFTA 1WDMA 3KTAA 4PG8A 4CCAA 2YR0A 3EGXA 2ZGVA 4L73A 4F46A 4JP2A 2O8BB 1C41A 1QDUA 3IYLW 1I24A 4H31A 2WWIA 1MO3A 2I3DA 5AKJA 4BE4A 1MQSA 3ND7A 1EFLA 2OILA 3JYLA 4KPYA 2HDHA 2V3WA 2FPUA 2Z2JA 3KWFA 3QMPA 1IAVA 2BFOA 3BTOA 5EMMA 2R97A 4KPGA 2VJKA 2M6LA 5L6MB 2C7PA 4HTAA 1MW8X 1OW3B 3BREA 3L0CA 1H69A 1VPVA 2GPAA 1KI6B 3H42B 1BH6A 3SZRA 4RABA 4M1TA 1EZZA 4R3UC 2NQTA 4NOLA 1EAYA 3ADBA 4B4VA 3PI7A 1PHPA 4RA6B 1Y82A 3UH0A 5HZHA 4FHZA 1Y6FA 5KNCH 1FXUA 2WJWA 5FBKA 3GMTA 5ALUA 4C07A 3ZJVA 1C7EA 2NOAA 4JI7B 3FYSA 3T9DA 1H4VB 4BVAA 4FJ2A 1E20A 3WC4A 4BLSA 5IPFA 2VUIB 3ASZA 3DG9A 1ESCA 4CCWA 1ST3A 1GKUB 2Z8YA 3EIWA 3MWDA 2AYXA 1FDRA 1MX5A 3N28A 3A4YA 2WKWA 4EEKA 4GDMA 3GGJA 2IEZA 2O2SA 4HAZA 1C8LA 3A58B 4U2EA 3GLFE 3AGQA 4HNHA 3EGXB 3LO8A 3B78A 3CMMA 1RI5A 5HK8A 2R00C 4Y30A 3TVYA 4DUZB 2YOGA 3M81A 1JPJA 3O4HA 5D1NA 5JDCA 5H1YA 1GQQA 1IL0A 1QRAA 4X64B 3A2KA 2QSZA 2WQ7A 1WB4A 1OLUB 3P2MA 3LZDA 3N8IA 3S1AB 5JC8A 4MW9A 4UQOA 4EBFA 1ADBA 1AOXA 1QGZA 2JAOA 5GV7A 5EJ8A 5CX1A 4I19A 1ZA2A 2IPXA 1P2BA 1YVRA 1LS1A 4JBNA 4RJKA 3Q8XB 2R7KA 3B3FA 1HRKA 3HBJA 4IKPA 4MUJA 4N8EA 1Z4NA 2FZWA 2JFVA 1I4DD 4TM7A 2FWPA 5IBQA 3W4IA 2C8JA 1PEDA 4V1CA 3E2MA 3TRHA 3LQ4A 1T5IA 2HNKA 4G0WA 4MVJD 3O4GA 4US1R 3CG4A 3HC7A 1ZGHA 2COUA 3NRBA 2XZDA 3FZEA 4K3UA 4N6NA 3R7FA 3JWJA 1ZMBA 3ZBPA 4KLZA 3DMRA 2AJ8A 2FWRA 5EVJA 4Y1RA 2ZRAA 1MLDA 1EEHA 2ZJ6A 1L8QA 1UM8A 4Y6SA 4HK4A 5ALHA 3JR3A 5DM2A 2R9VA 3VKHA 4W9RA 1U80A 5IUJC 2QMUA 1UF9A 3TO5A 2YWEA 5JNLA 2C2HA 1N3BA 2YS6A 1X1SA 3WNDA 4ZVUA 5JU6A 2R96A 4TKUA 4OQNA 5AUPB 4MR8A 4JLPA 4BFLA 3GG9A 5E1OA 3JD0A 4HVCA 4TOIA 4B3JA 3SSAA 1UBNA 2AMJA 4P4LA 3VUEA 5ABPA 2ZCUA 1JUDA 2HFKA 3K20A 4LYJA 4PAGA 4DDTA 4AY6A 4EVSA 2CLLB 3KSDO 3THXA 2Z95A 2VZ9A 1VGQA 3OC6A 4OO3A 2PR2A 5K3AA 3LX5A 4KJXA 4HRXA 4PPGA 4XEHA 4C29A 1QQ6A 3KVRA 3UJ6A 5HS4A 3T3NA 1RACA 3LD9A 4PNPA 2YIJA 3FCEA 5KNBH 2C9CA 2RAUA 3LDUA 3MMPA 5TEWA 3ZS8A 1RHQA 1US8B 3I64A 2RGGA 3T7TA 3CT4A 3HB4X 4C4PA 1MT3A 3OQHA 2LKDA 2VT6A 4L76A 3IXMA 1QC5B 4GPIB 4MYCA 2V6IA 2C5FA 2XY4A 4QU8A 2HHJA 3IPAA 2CEKA 5A0TA 2V54A 1JG6A 4FMDB 1KDYA 1TA4A 4U63A 4N0QA 5TGTA 1J1ZA 4ZCLA 2ASVA 5KSWB 4DMLA 2V5AA 2VDPB 1KEEB 4OMDA 2VPQA 4UEOA 4IZOA 4CM1A 1J4AA 3SX4A 3GRRA 5CA0F 2OCDA 2I2FA 3C14C 2G80A 4KDFA 3V7FA 4X1YB 3BL6A 4QUKA 2QUKA 4CCYB 3N5CA 1PL8A 4LSWA 2BFMA 3H5WA 5KQGA 4KNYA 3G85A 4UUOA 1EFCA 2AYZA 3GJ4A 3H6GA 1MO2A 3OQ6A 1MQAA 4HX9A 3SAJA 3U4GA 1X1AA 3T54A 2C57A 3CX7A 4DMUB 4CTNA 5LVAA 3PDWA 4YGXB 2WZDA 2OECA 1RAGA 1JB9A 3OU2A 4LRUA 2QRVB 1D6NA 1IPFA 2Q28A 3ROGA 4QU0A 4P34A 2AZMA 1RXWA 5IP5A 1A3CA 5AHKA 5LP6B 2VL7A 4QOFA 3GJ3A 2E85A 1VE7A 3S3TA 2GBIA 3HI6A 1EK5A 1B8NA 3ZE0B 4J4HA 5DGXA 5JZBA 3AY3A 2VJMB 1PYGA 4Q37A 3URMA 1SUDA 4DZZA 3TLYA 1VOTA 4EMTA 4IVPA 4I55A 2FV8A 1JHUA 2GWRA 2YHSA 5TIIA 1GUZA 5K0FA 1OFIA 3WQSB 1N6NA 2ZI9A 2GJKA 5IJZA 1JMKC 4ZV7A 1W5EA 5JYEA 3ZDCA 1NLUA 4QNRA 2CJWB 3DSRA 2Z6UA 1ADYA 3I6IA 2EVWX 3A1VA 1J9ZA 2UVDA 4ATNA 5HQ3B 2QGZA 4NI5A 4UAJA 4C2BA 3PIDA 5A4MS 4RJTA 5HPYB 2QNRA 4MYDA 4GYJA 2JFNA 1XKQA 2Q1YA 3PQ8A 4DA6A 4YRKA 2PXXA 2Z3VA 1JAZA 3VAZA 1MO5A 3DE2X 1YJBA 2Q4TA 1P0MA 2E82A 8GPBA 1H4TA 2BEWA 2DKNA 3A6JA 4C21A 1T10A 2JARA 4UREA 1G6OA 1CD5A 2QAGA 1E2MA 1W2HA 1YI8A 4MV9A 2EARA 3VPDA 2WIBA 3EZ7A 4KN6A 3C3DA 3W3ZB 1PHRA 4E11A 4G81A 2HAEA 5EWMA 1XF1A 4JZKA 4MQFA 5BN5B 1PSDA 1GNTA 1YBAA 3GCZA 3LW8A 2AQKA 1T0JB 1IEWA 2YTZA 4NFLA 3ZVNA 2WIDA 1QH9A 4Z8XA 4OX9B 2X86A 2ZIXB 3ROQA 4IHJB 4Y2GA 1XCJA 4FFBA 4KW7A 1J8QA 3K7EA 2D7DA 4R9UC 5J5CA 3ZDQA 3BQMB 2PM8A 5D6NA 4MJ3A 3Q7IA 1UDCA 4YAKA 4LJSA 1O03A 1A9OA 2DE0X 2VHQA 4RSGA 2GUGA 4PYMA 3NHLA 3QF4A 4M0KA 1AU9A 2IOYA 2WKRA 5LZ7A 1PL0A 5BQOA 3TNYA 4ABTA 1B6GA 1FFXA 4BRUA 1B14A 2IYFA 4E7PA 4IRXA 2VA8A 5T8KA 4IHQA 3DVSX 2ZTMA 1V71A 4RK0A 3MRXA 3VPFA 4B4WA 3BXXA 1ZJZA 3GVXA 3D3WB 2ZETA 3NUZA 1XFAA 3R9WA 1X7WB 3JZFA 3H5IA 2JLUA 5LQNA 1CNEA 4FYKA 1VSUA 4Q4JB 5DHTA 3N86A 2HJVA 5KYTA 2MSWA 2X8JB 3FDZA 1UP7A 5K51A 5FTLA 1WSAA 1UZUA 3C6MA 4PBSA 2NSYA 3IXQA 4G36A 4BKUA 2PZJA 3M5PA 9GPBA 1N2IA 4AUEA 1XHEA 2EG9A 1C7ZA 1Q7EA 1R5BA 3NOOA 1MX3A 2W83A 4H7EA 1ZH6A 1RR6A 1WBDA 1QORA 1P5RA 3A6KA 3AVXA 1KI9A 3L7IA 3R3VA 2Y9PB 3D2CA 3NHPA 2NUAB 3WLRA 1NW7A 3ZOZA 4YQZA 3OQIA 1CDDA 3RHFA 1M2OA 1DIBA 3C5CA 3UUEA 4AL4A 4B35A 3NPAA 2RHRA 3QEAZ 2BZ1A 1Z6YA 3GDWA 4R2WA 2H2AA 5DM0A 1P2UA 2N9UA 3JQRA 4XOIA 1P3DA 5K05A 2JJQA 3NRCA 1V9LA 4ZARA 5I9BA 1P81A 5HM6A 5DE3A 1QP8A 5EEGA 1QR2A 1GFWA 3Q1KA 2FFJA 3QLUC 1U5CA 4BO1A 2C5EA 3BCSA 2DM6A 4YGYA 5LMNB 3SDBA 1S8OA 4X85A 2VRCA 3AVTA 1VPWA 4QHTA 4QUEA 3TZEA 4BLUA 1M76A 3DDWA 4S04A 4WLOA 3E2PA 1QRUA 2MMCA 2IEAA 2B8JA 2V8OA 1USVA 4R6WA 2R87A 3QU9A 3UJDA 1YQDA 4N65A 2YYYA 3PTZA 1DIGA 2W37A 2XHZA 5SV2A 3WISA 1EVKA 2UVPA 5D3MB 1OTHA 1X80B 2QSYA 3GJQA 3OEED 4L07A 4L6IA 4BRZA 2OYCA 2H1WA 1LXCA 3DE7X 4Q9HA 1YA8A 2QORA 4G24A 4N82A 1B26A 2ZSJA 4TKMA 3HJRA 5L7YA 3R7NA 4QUIA 2EATA 2RIRA 3D8NA 4HGYA 5A1TA 5FX2A 4LV8B 2LP4Y 1GGJA 1A9RA 4P82A 1DO8A 2X9GA 4O4LA 4C14A 3WRYC 4YV2A 1G3MA 1I8TA 4J90A 1UM9B 3TX6A 3EY9A 2Q3CA 3GGSA 4I4TA 3GRYA 3ADKA 4YIKA 2K2WA 3IC5A 1H0SA 2XBLA 4BE9A 4H2DA 4CQMA 4YRAA 3TR6A 3W79A 3QLUA 1E9VA 3LTNC 3PVZA 1G21E 4IR7A 4DAEA 4OQPA 1NBIA 2AEFA 4R69A 1T2NA 1ZVKA 2P91A 3NTRA 1V5EA 3EPRA 4TMZA 5BSWA 1ACMA 4OFWA 1JKIA 3RAJA 1G8JA 1II0A 1XN1A 2WJ6A 3ANLA 4FT2A 3KKQA 4OTZA 4R1QA 4C7KA 1QHFA 4FGWA 3RJTA 4DR7B 1FQJA 3VZQA 2ZWVA 3GLUA 2C2MA 1HYBA 3QPWA 4I5EA 5FBQB 5HMLA 2I6UA 3U7QA 1Y98A 5DOZA 5EJFA 2NTNA 1EDBA 2PQ6A 2O4UX 3E3AA 2VTEA 3D8HA 1NVBA 3EVGA 3I6ZA 2PCJA 1GTJ1 1UPAA 1CVLA 1QHSA 3RWMB 4JFRA 4WJLA 1U6KA 1OWPA 1V8FA 3DHWC 1UAYA 3V7UA 3TLMA 2QVXX 1V3TA 4WGFA 3U26A 5DT9A 4DLNA 2O19A 3K3PA 5JAHA 2LNDA 2M9MA 4O2BF 1NMEA 4KO2S 3IUYA 3TOZA 3NX4A 1TA9A 3FPBA 2EFYA 1L0BA 2JI4A 4GNKA 3RVJA 2UXDB 1NTRA 2EQBA 2X1MA 2VAVA 4X84A 3JWHA 1OBFO 1OBOA 1UBSB 1EM8B 2H17A 4JC5A 3B20A 1R16A 1GYPA 3PKJA 3EXEB 2OFFA 3SZUA 3UT5B 4XPIA 5JH7A 1NUPA 3H2HA 3WZ2A 2ERYA 1EFKA 1PL7A 5TQ2A 4B7UA 2PV7A 1QH8A 4QWMA 2A5GA 3PK0A 3R6TA 7REQB 3NHYA 3LGSA 5J3JA 3ZJ5A 4JIGA 4QICA 1O97D 4OGFA 4KWEA 3FYUC 3HFSA 3SKYA 2PX5A 3H4VA 1VKZA 1TIPA 5MN4A 3ZQKA 2AXPA 1VLZA 5EIOA 3LY7A 4UTZA 1ATIA 4AX4A 5FQNA 1UZLA 2C4NA 1DV1A 4UHFA 2P9TA 2DECA 1JPNA 2VLIA 3KP1A 3QGMA 1Z8NA 1M7BA 1ZH0A 4DOMA 3H9BA 3WAGA 2DG2A 2WINI 2ONJA 3P20A 4HUQA 4MS3B 4BVHA 5GTDA 2CVPA 2HSWA 4ZT7A 3I1IA 1K1EA 4X3CA 1XZEA 1DMRA 1A5TA 1L7PA 2AJBA 2CC2A 3HP4A 1H2BA 1XTIA 2YNMD 3WSTA 5DJ5A 1SBCA 3FPHA 3DHVA 3RGWS 4F3YA 4EYQA 1VJ1A 1J00A 3BMOB 1CY6A 2OK8A 3KPUA 4HYYA 3E9QA 3MTAA 3FTCA 3C6YA 2FZGA 3AEQA 4KPEC 3OHPA 1QS0B 1EESA 1PJTA 5KWVA 4UHKA 1L5SA 3GRFA 1ZR2A 2OR3A 5D6OA 3N2EA 4H17A 4X8MA 4G0VA 1VYUA 1YV9A 3LRTA 4G5OA 3HCAA 4FDAA 4KLNA 5AJXA 3L0IB 3ELBA 3OO1A 3PUKA 4EL0A 1JIJA 1KHHA 1PT6A 1WW2A 2HLDD 2P8JA 1CERA 1Y3HA 1VBMA 2CXTA 3FWPA 1TYZA 4FZJA 4RCZA 4WTOA 3UGJA 3TFQA 2CJPA 4IHKA 4PX5A 4N3AA 4LXGA 4A91A 1QQAA 4II3A 4QFBA 1NBMD 2H7CA 2G5GX 2R2GA 4RXUA 4TTRA 5KNLA 4E5UA 2GKOA 1E7WA 1Q5PA 3B6JA 3OFNA 3W3AA 3G49A 5DI3B 4E4TA 3HJUA 3TEJA 4RLQA 4JR0A 3OX3A 1KXJA 4CFSA 4B0PA 4F4CA 4XH9B 1NI4B 1H6CA 1Z15A 3JWPA 1Y5RA 4GX5A 4ZV4A 4Z4GA 2CUNA 1GUAA 3REFA 5BN1A 1CTQA 3PNMA 3ZH2A 1X8LA 5KKCA 3FWZA 4EJSC 3A9UA 1ZD4A 3DV9A 3RT7A 4YYZA 3K8YA 4MKRA 4PHTA 3WK4A 2ZM5A 1W8IA 1SG9A 1WUTA 2XNDA 2OZEA 3VNRA 4LISA 4BNTA 4YCMA 2WTAA 3LUKA 3Q9SA 3T5PA 2JA2A 4JLDA 4HWOA 3R76A 2ON6A 4ZU1X 4PIVA 1XZJA 3RB8A 4Y1FA 4YJFB 3IL2A 4EJFA 3IP8A 5EOVA 3RRXA 3DWGA 5GZ1A 4D42A 4Y7DA 2IY9A 1GRRA 1RI3A 2QP3A 2VYFA 3M5CA 1LS6A 2HU7A 3ILYA 3MGAA 4MPJA 4R1TA 2DBQA 4RJ2A 2D5AA 1T5HX 3PEEA 3QA3E 4JL8A 4RKEA 5I7RA 1ZHHA 1NE2A 2C92A 2BISA 2I34A 4JVNA 4L4YA 2EZ4A 3VR5A 2ID7A 2V97A 5DNAA 4X6XA 4YRFA 5FOWA 3VJMA 3FFXA 2VPYA 1DCTA 4D02A 1N5KA 3WICA 1ZL2A 2HQBA 3LG2A 1U98A 3Q3JB 4WV3A 1M83A 1GRCA 1T8YA 2CSUA 4NKRA 5BVGB 1UZMA 5D3QA 1UBFA 2N42A 4GI5A 2GPYA 4BNYA 2AE1A 3G0CA 3U7GA 3K0SA 1YJQA 4WCFA 2H7VA 3LM8A 2ZB8A 2RGNA 1NSFA 3D0OA 3MW8A 4R71A 1EBUA 4JLAA 5IRCD 1GV1A 3H4TA 1QGOA 5K4GA 4AKHA 1LQUA 2ADOA 3CLSD 5AKEA 2PKQP 5ELXA 4MUYA 4P36A 1U3WA 3PUHA 2JEZA 1WZIA 3IFSA 1MGPA 4K1XA 5DTIA 5T3YA 3U56A 4TQGA 2HBZA 4UUAA 2CCKA 3TQQA 3SBEA 4M9QA 4EKEA 1E8DA 1NZJA 5BV1A 5DTJA 3GEDA 5DLYA 3M49A 2Q3BA 3UQYS 5LSAA 5E2AA 2QAGC 3ZDDA 5IT4A 2V3CC 4B6QA 5BWCA 4Q9AA 3DYIA 1RHJA 1C9NA 4YXWD 1GUDA 1E64A 3WLOA 1B8UA 3OOWA 1VBFA 2ODEA 4J3JA 1P7YA 1QFSA 4FFSA 4C88A 2BTEA 2XT0A 3CR7A 2J3MA 3PPVA 3JQQA 4QYWA 1KNXA 4W6ZA 5HKBA 1EFRD 1RXEA 4ND7A 4DW8A 1LNSA 2DR3A 2GZRA 3L0OA 4MCIA 4UPDA 3ER8A 4FP9A 4ED9A 5BNIA 4A6XA 1DAHA 3LT0A 4LF9B 1LJ8A 3PFHA 4WEOA 4DEXA 4OGKA 2X2PA 5JJBA 1VKNA 2PWZA 5F4ZA 1DAMA 5A02A 5K4HA 2VP3A 2FQ1A 1NYTA 2A5FA 1RVV1 4Z9XA 1JHDA 2A4KA 4GOMD 1YMUA 3JQAD 2ACWA 3FRJA 4OQXA 2ZPAA 1TC1A 1P31A 3WB1A 4G2NA 3B1VA 1QE5A 2GAFA 4I2VA 4I1IA 1OZAA 2EKLA 1T3SA 1E9EA 1OLOA 2FRDA 2D0PB 1HYQA 2PZEA 3UG7A 4EJMA 1KEUA 3IV6A 5J2UF 4MIOA 4CMGA 2F3RA 3O8OB 1UDRA 4RORA 1Z4IA 1V45E 1G9XA 1PJRA 3UJNA 1RXCA 1UQTA 1UOQA 2P2YA 4PC6A 1AXRA 4YAOA 5CFZA 3EZ9A 3RH0A 1Z7WA 2GERA 2QLBA 5TE9A 2Y1KA 2VT2A 1GGNA 3K9HA 3WKEA 4KO4S 5MGBA 4JV5B 5GONB 2ZXUA 1AMNA 1AQ6A 4H7FA 1DPGA 3MSCA 1ND5A 3FDJA 1WDKA 4L2IB 4YCDA 4U7HA 1QO7A 3QBTA 3F78A 3H9JA 1YCFA 4QATA 4E6PA 5IT0A 3KPVA 2WTNA 3QEMB 4D3FA 1RZRD 5DFAA 5DMHA 4NZOA 2P5UA 3SLGA 1Z4JA 1PZHA 9ATCA 3A0RB 4GQAA 3OCZA 3WG9A 1BHQ1 1T35A 2W2XA 3DE3X 3STVA 1NXSA 1U1IA 1WKVA 2LE0A 1ISJA 2W2OA 2XKKA 1SU4A 4RIEA 2ZDHA 3HKEA 5KVCA 5BW6B 1I7NA 2I62A 3I8XA 3LDFA 4D4MA 2FH5B 2HBQA 2XRMA 4HRYA 2FPKA 2ORIA 1OKKA 3H8VA 3OX2A 1ISHA 5KIAA 1QHGA 5JYBA 1JKMA 4FCVA 4S1TA 5HM8A 1HDIA 1QGAA 4V3CA 4K6FA 5JDIC 5B4UA 5AVJA 2IL1A 3OSZA 2HEGA 2ZBPA 5H9WA 2JLZA 1SBYA 3FPLA 3Q5GA 4DLYA 1V9CA 1Y7HA 3SE0A 1TE2A 1XYYA 1EUZA 3WYGA 1IZ8A 4PGAA 4ZOCA 3UVEA 2EZUA 2P9BA 4A03A 3ZE1B 4X95A 1PR9A 2WRZA 1SBNE 4XR4A 4C1BA 5H4GA 3FZYA 1WHSB 5CB4F 1NM5C 1SUWA 2CDCA 3DZ8A 2X9NA 1UKAA 3GRUA 4GOLD 2FW7A 2PU7A 4RPGA 5DGDA 3W8EA 3QUAA 1Z6TA 2HMTA 1VHLA 5BY2A 4HN4B 1E1MA 1WW3A 4HUJA 3I52A 3I9FA 2J67A 3EWNA 3FYUA 4MLPA 5CG2A 4PAMA 1OCEA 2WTXA 1GV0A 2IEDA 2ZR9A 3QMWA 1QCDA 3WWYA 1OXVA 2D1YA 2Q0QA 1WF6A 1SK8A 3ESQA 4Q9IA 1DELA 4DAOA 4EENA 4DIOA 3EF1A 3RYFA 1A2KC 2ORYA 2OUIA 4K9SA 3C7KA 4BEVA 2GS9A 3PCRB 3HR7A 3ZY4A 1NBOA 5EESA 1QLJA 2YOHA 3M82A 3B9QA 5JCXA 3BHNA 2PWPA 1BJRE 1QYDA 3WLSA 3CEHA 1U0RA 2VQSA 4RPKA 3NWPA 5HDBB 2AEMA 4LDNA 2CMHA 2X23A 2JHFA 1X8KA 1A8HA 1ZIYA 2BFEB 4CODB 5FI3A 3A4TA 5DBIA 4ZEXA 4EK9A 1YRWA 4PLGA 3P9KA 3MD9A 1Y48E 1YJAA 4QOEA 2FOLA 4EI7A 2RGRA 3KK0A 1T1GA 4N5MA 5EWLA 4JSYA 1BS1A 1L7QA 4YREA 1QVVA 1X39A 1J0EA 4N49A 4YJGA 3IX7A 3GGPA 1GSIA 1VQ1A 3COJA 5B1IA 3MQ4A 2O5VA 3G82C 5DF1A 2RHOA 4FYWA 5CX1B 1E94E 1TA0A 1ISPA 1QYVA 1T0IA 1EPUA 2PMCA 4M53A 2J0SA 2A2ZA 3M2TA 3VH3A 1FDUA 2XZTA 3O1HB 3NC0C 1MEJA 4G4SO 4P7KA 3BERA 3O73A 2OP1A 3DZHA 3DKPA 2LW7A 5B4TA 1UT6A 2QUJA 2VS1A 2VYND 4Z0TA 4A2QA 4E32A 4EB0A 3PSHA 4DRZA 2LR0A 4W1PA 4HP8A 1JHAA 4RMNA 5BRAA 1DEAA 2I03A 1NOIA 4QDZA 1JPVA 3T1QA 3IURA 1NP3A 3N6RA 4KKXB 1UBGA 4GP6A 3ZHTA 4DBZA 3ZDAA 3C4JA 3M4XA 5IVIA 1M5TA 2PWBA 5IVPA 3WNZA 2B83A 4TTAA 1AO3A 1EVLA 3NCTA 2HCFA 2X7HA 4MTLA 1RPAA 2B98A 2C88A 4K05A 2Q4OA 1PJQA 5TVGA 3KFVA 4TV9A 2WFZA 3TZBA 3BH6A 2B5OA 3HACA 4Z5XA 4GL4A 1J2TA 2BM1A 2AGVA 1UMBB 3MWJA 3PFFA 1RYNA 1Q1ZA 2C4KA 2H51A 2NSJA 2O2XA 5FIUA 1X2BA 3Q87B 2GYUA 4U8GA 2WQ6A 1FZTA 1C3VA 2XZLA 4CG2A 1DQSA 2QRZA 3FCUB 4MDEA 2VDWA 3ZWCA 4ZRNA 3KKZA 1GDHA 3IJEB 1J42A 1KMHB 4O4LB 2WSIA 1GG5A 3DQPA 1JDNA 3H2IA 4DV0B 1FRZA 1TO6A 1XTRA 2DPHA 2A9QA 2QM7A 4G84A 1P6UA 1RAHA 4JBLA 4JOCA 2BH9A 4PAWA 4DCTA 4BQIA 4MGZR 4EJSA 4KRXA 1G38A 5BYKA 5JROA 4HHEA 5HSGA 4FZ5A 1KSFX 1NYRA 5CFNA 3NALA 2VHJA 1Q0LA 2AVNA 4D6PA 4MYRA 4ETIA 1TTHA 3HUUA 1L7NA 5BMOA 1KOLA 1VA4A 3PHHA 3ZWMA 1N2OA 4AJEA 1UBTS 1FSZA 1BH2A 2O50A 3P0RA 3DFFA 4F7WA 2F6RA 5H68A 1DFIA 4TZKA 2JW5A 4QBGB 5I7WA 1TB4A 4R54A 3RS2A 4TTQA 1KOGA 4FYHA 5JD3A 4DBLE 4EB3A 1A9TA 1TK3A 4C4AA 4RQUA 2G83A 1IM2A 4PSUA 5DV9A 5FQOA 3VKFA 1YS1X 3VOTA 2XTAA 1UWVA 1N0UA 3Q8LA 1A71A 3T1OA 3UAYA 2XYVA 4QVIA 3FMGA 1W5SA 3VJRA 1AN0A 3K1AA 1BGVA 3FZGA 4BQRA 5EJ5A 1RJEA 1FNBA 3HE3A 1LBHA 1P2FA 1UKYA 3AZQA 4XX0B 3P9RA 1V43A 1ZK1A 3CB4A 2V0GA 2H57A 2HQRA 1YKGA 3IQFA 2ID8A 2BR3A 3VR0A 3CJRA 2L0XA 3EXHC 3K5PA 4WNAA 4ZVTA 3T8YA 1XPUA 5B7NA 4KVAA 3ZZ1A 4EUNA 1A1SA 4HY3A 2CV1A 1UK6A 3T9EA 1YR9A 5CG1A 3R2JA 2H52A 3G2OA 4OIFA 4RA9B 1SMKA 5EP4A 3DBLB 2N47A 4DCMA 2JFFA 2IZ1A 4HEA1 5FI1B 1F2TA 4NCNA 3AJ9A 3K31A 1LTKA 2BMVA 3ELYA 5HCUA 3ZDRA 3D5EA 4HSGA 1KQ3A 5I7FA 4LIPD 5K3BA 3RNLA 2NU7B 2P7IA 4JQYA 1XP5A 1SVWA 2XAUA 3UPUA 4M1SA 2AZXA 5HW0A 3HN2A 3DAOA 1E3SA 4JLUA 4OOEA 3ADCA 4HQFA 1TF2A 5HE9A 4ZA2A 4Q7KA 1ZOIA 3R23A 1AKVA 2ZTSA 4LWZA 3Q3GE 5E4TA 4OJMX 3BGVA 4CIXA 4ZYXA 3FRIA 3TXXA 1NATA 4ZDIA 2DYKA 2YJ4A 3BRWD 2QX8A 2QUAA 1I6KA 3NBZC 3GEBA 3FCOA 2RARA 3OQIB 4B43A 2ZM6B 2OXEA 4B6OA 1G1MA 2JGMA 3NBUA 4OAOA 3WK5A 4LYDA 2POQX 5DEIA 3Q7SA 3AL0C 3QVKA 4J43A 4HGZA 3FPKA 5ITZA 1O57A 1PFQA 2QTCA 3NP9A 2HGSA 1G2OA 1TKAA 3ZZUA 2FMUA 3EVZA 3P45A 1USWA 1N7JA 2R6DA 2WE7A 4CL0A 3FI0A 4C7OA 1D2NA 5KHOC 5H83A 1BXRB 4NR0A 4EA7A 7REQA 1ZESA 5LDDC 2QS9A 1CP2A 3WGZA 4EG8A 3KYJB 3L7LA 3IAS1 3NM5A 2I80A 4ZOLB 1TQ8A 4PPNA 3MBIA 4MIKA 4ALKA 1X3LA 3TDKA 2HL6A 2IHBA 3FUWA 4E70A 1OYVA 1ZL0A 1C4OA 4L5AA 1U4OA 3BK7A 4QFDA 1KGDA 2XMRA 1A2BA 5EP1A 1NF9A 3WWZA 5IBCA 2GXAA 1O08A 2D1TA 3WLHA 1E5DA 3C3XA 1Z6XA 1G8MA 1TECE 2DWCA 2G9VA 2IP1A 4YRJA 2FPSA 2ZSDA 5IZ4A 1N33B 3AEXA 1WQ1R 5KVVA 4GOND 1KQFA 1HRDA 2OVFA 4IUBS 5LOVB 2VYNA 4X7MA 1VIAA 2QAJA 1R12A 3DTVB 1KK3A 4EUFA 4I9FA 2GN1A 4M9CA 4QO8A 5HRAA 4A5OA 5IM5A 3OTWA 2CVQA 4TLCA 2X4LA 3EH2A 3TQSA 4MWEA 3EZ2A 2OKCA 3BWVA 1DIAA 3Q5DA 3TTYA 3OUZA 2PT6A 4H7KA 1UP6A 4OHUA 3SC4A 1W7AA 4HGPA 1DFGA 5FUXA 1RABA 3GPBA 3VR3D 1AZTA 2EHJA 3LXRA 4JJFA 5C8DA 2R85A 5DK4A 2WEKA 4FCCA 4JZYA 1QJ4A 1T2VA 4ZVMA 3L40A 4FFDA 1WMDA 4R2XA 3CBGA 5J5VA 3ABRB 3ZTTA 3FD8A 4LGVA 5LIRA 4NJMA 1EA7A 3L0BA 2OOSA 1HH4A 1DNPA 1EFHA 3SC2A 1FUYB 4RKFA 4M0EA 1FFWA 1DQYA 2FW6A 2GEVA 3R1IA 3U3DA 1P1IA 2O8VA 4N8SA 5TMDA 1XKTA 2VJLA 3DUFB 1DJMA 1GXSA 1BKDR 3S6JA 3WKDA 2WU3A 2QD4A 4D9IA 721PA 5JTUA 5A4FS 5K6RA 4NTZA 2Q5QA 2RGYA 3D4NA 1PZNA 5C7YA 3BGSA 4LGYA 3ETLA 4WY5A 1L5MA 3Q7EA 1NN5A 1Z68A 3V8NA 4DS3A 1JAXA 1ZM9A 5CLFA 1OV4A 3NVAA 3OZUA 2HDNB 1H2EA 1PX0A 2Z1MA 4NECA 4UVGA 4BX9A 3RUCA 1M1XB 3E8XA 1EVYA 3CXUA 3FCCA 4U7TB 2IEIA 4J0DA 4AJKA 4V0QA 4JOQA 1TGYA 4FFVA 4MV6A 5F7ZA 3VVLA 1FNMA 4J75A 1Y1TA 4LPKA 1FTYA 3TMAA 1OR8A 2VSQA 1E9CA 4KAXA 2HBRA 5FFFA 4EMSA 1OZGA 2J5RA 1JVBA 3KJXA 3FHCB 3GT0A 2PA0A 2D1FA 3LPNA 3QKSA 2BFNA 5F1YA 3K9BA 1TC2A 1IWOA 1SUEA 1HTWA 4HLUC 3OJWA 5FOTA 3GFQA 1ZCAA 5IH3A 1XSEA 4L7QA 1Z2EA 1JILA 3DBHB 3I4CA 1VYTA 5HWSA 2ZZMA 4CF6A 1Z0JA 2YZ2A 1U2EA 3Q6MA 1JN0A 4FQ8A 4KC0A 4Q1DA 1XXHA 1VHDA 3WGOA 3PNKA 2HU8A 1FFDA 2QRUA 2PYDA 3E7PA 4XUCA 3DJFA 4FJ1A 3TR0A 3V8PA 1C0IA 3ZZNA 4LJRA 1BMFA 3L6BA 4B2LA 1N3IA 3PUZA 1FFEA 1E1RA 4J0GA 1RXIA 1J8VA 3AERB 4X60A 2OXFA 1XMQB 2D54A 2SICE 4HGQA 3NOVA 2VF5X 2WF5A 3DM5A 2PRYA 3P2OA 3SEAA 4XWTA 2QU8A 4AY3A 4QGSA 2R44A 4PEVA 2G08A 1LK7A 1U9ZA 2COKA 1T4BA 1CJKC 3EEQA 4WA8A 1WPXA 1IATA 5HCIA 4JGIA 1F8XA 4IIBA 2P8SA 4XFDA 3PTAA 3W77A 4LQLA 1P77A 2V9PA 1FXSA 4OHKA 5HF9A 3KXPA 2IOQA 3K0KA 4IG9A 5FL7D 3LHFA 1V4VA 4F6CA 4AMZA 3A4IA 4RLSA 3RUHA 2JLYA 2ST1A 1E96A 1VLLA 4MUFA 1HE3A 3AK4A 3ZZMA 5B7QA 4QAQA 4RZXA 4WADA 2JCSA 3EFHA 1OGJA 3WQRA 4FB4A 4RWEA 4EJ2A 3KSZO 1XVUA 1AKUA 4O4JF 2AMFA 1QH8B 4DLVA 1T0UA 3MLEA 5DIFA 2PT5A 2Q6VA 4CM4B 3UJAA 2RCNA 1WW8A 2PLWA 2HMVA 2MWMA 3K0AB 5GINE 3T3DA 2PUBA 3F90A 4UE3S 2ASEA 3HDHA 5KYWB 3ELDA 2OE2A 3ILXA 1JIXA 2C3PA 3OM9A 5GIPE 1P1BA 3QUTA 1KJJA 2VHTA 4HLNA 1JTFA 3BZWA 1XG5A 1VRWA 2I8CA 1G17A 1G60A 1N6HA 1FS6A 2LV8A 3BE8A 2AC7A 2DQSA 2ZEJA 3DLPX 5KWIA 4DV6B 3NAQA 1XK7A 1XGKA 5EXTA 1CUXA 1ZYUA 1N6PA 3JCZA 2Q21A 2XUFA 3N0WA 5DYYA 3TOSA 3WFJA 3A1FA 1HM5A 3PGVA 4RPJA 4YCLA 1FSFA 1JFFB 4RD2A 3P71T 3W7BA 4GKJB 1J0AA 1S8FA 1V8DA 4HDCA 4I50B 1EWVA 3OPNA 4X1KA 2ZYIA