4LIPD

Pseudomonas lipase complexed with rc-(rp, sp)-dibutylcarbamoylglycero-3-o-butylphosphonate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
319
structure length
319
Chain Sequence
DNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIACYL-GLYCEROL-HYDROLASE
publication title Structural basis of the chiral selectivity of Pseudomonas cepacia lipase
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Lipase
total genus 126
structure length 319
sequence length 319
chains with identical sequence E
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lipD00
1JJFA 1JI3A 4NS4A 5CH3A 4HRYA 1XRQA 1CUHA 1LNSA 1ZIYA 5LKAA 3ZLVA 4H7HA 2WFLA 5CT6A 3OTQA 4FBMA 2B61A 4BC1A 1CUFA 1EDDA 5EIEA 2CZQA 2PU5A 3G9XA 3WZLA 4G1FA 4Q3OA 5EFZA 1CEXA 4B85A 3AUKA 3ESAA 4UBMA 2Y1KA 4B9EA 4X92A 4U2FA 2XUFA 3TGLA 3WWEA 1GPNA 4IQ4A 2PSJA 1ODCA 4X85A 3WQHA 4AO8A 2PSEA 2WHRA 5ALYA 3C70A 5AKYA 3D59A 1B6GA 1DQZA 4HXGA 1AZWA 2ZJFA 5DYWA 3A2NA 5C8VA 2WUEA 3WL8A 3HC7A 1RP1A 1M33A 5IKXA 4LHEA 2JBWA 1Z68A 2V97A 1K4YA 3S8YA 3L1IA 2YXPX 3D2AA 4Y2SA 5ALSA 3QMMA 1EVQA 4IH4A 3O4GA 4FLFA 4C88A 1DT5A 5CXUA 3QPAA 1VKHA 1SOMA 3DQZA 3M82A 2HA6A 5I9IA 1VE6A 1SCKA 5K3AA 1DWQA 1LZLA 1UT6A 2X8BA 2XUJA 4H7FA 5E4YA 3CN9A 4Y2XA 2GBGA 3V48A 2R11A 1BROA 2OG1A 1HL7A 3OOSA 2OQVA 1FFEA 3H18A 1LPOA 1AKNA 1ORWA 3EBLA 3WKAA 2VT6A 3FOBA 3E1GA 1RWQA 2P8SA 2QS9A 2HL6A 5CT9A 3DYIA 3SC2A 1YR2A 5FRDA 3WI7A 5CTAA 3E3AA 2PKYX 2XUKA 5E2IA 3DNMA 4WFIA 5CXXA 1O6FA 3M3DA 2V98A 2XQIA 3R3YA 3IUQA 1XZJA 2WFLB 4BP8A 1TAHA 2XDWA 4GXNA 4MWSA 1WPRA 3IVMA 1VJ5A 1XZLA 2RHWA 1J2EA 2WTNA 3GROA 1R9MA 5JZBA 1MTZA 5HQ3B 5HQ3A 2WFZA 1VXRA 1CFJA 5DTJA 4OUKX 3W05A 1ODTC 3DD5A 2J4CA 3VJMA 3C6YA 2WU4A 4ZRDA 5FUMA 1QO7A 1CLEA 2WU3A 5ALLA 3HYSA 1DX6A 2WIKA 1BEEA 4J0IA 3BXPA 1ZI9A 4DYHA 4OCZA 5CRIA 2WSLA 2UZ0A 4H7IA 2PUJA 3PF9A 4JUIA 2HHAA 5T4BA 2H9YA 2WQZA 1QFSA 2AJCA 4A16A 2WG1A 1WB6A 4HZGA 3QMVA 1XRPA 4N5IX 3D7RA 3NUZA 1CUBA 1UWCA 3G9UA 5CW2A 4WDRA 2XT0A 1MX9A 4YPVA 2QXUA 1MT3A 1PJAA 4KE8A 2PUHA 3GELA 4X6YA 3G7NA 4DSAA 3HJUA 2XMCA 1YCDA 3D4LA 4LKOA 5ESRA 1QLWA 3RLIA 4B0OA 4AO6A 1ZICA 4OU5A 4BTLA 4KACA 4UHDA 2RIPA 3C6BA 3D2BA 4MWTA 4Y9SA 1T2NA 3ED1A 2QT9A 1THTA 4DIUA 4A5SA 5AM2A 4C6HA 1HPLA 3CCCA 4P93A 4EA6A 5JZ9A 2Z3WA 3BE8A 5H3HA 1RYYA 1DTEA 3GBSA 1C7JA 3QH4A 3DDUA 4I3FA 4XVCA 2HM7A 2DR0A 2XUOA 3G0DA 2ROQA 4Q05A 2XUHA 3O0DA 5EIHA 4AZ3A 4RNCA 3BDVA 5ALFA 1ZGBA 4ZGBA 5AICA 3VJLA 1JJIA 1QIGA 1AX9A 2ZJ7A 3CCBA 3QYJA 1DU4A 1XZHA 5FXMA 4G4GA 2JEYA 3FYUC 3K6KA 1UXOA 1EDBA 2D0DA 4P9NA 4PSDA 1YASA 2E3JA 4UBJA 4HXFB 1OCEA 1YS1X 4M0FA 4LYDA 1TCBA 4GWLA 4TVKA 1X70A 1UOQA 2WJ4A 5HK8A 3C5WP 4EY6A 2IIVA 1S8OA 3SK0A 4QDOA 4BRSA 2B4KA 1R1DA 1P0MA 4EY5A 5A2GA 4UUQA 3G0CA 2I03A 4WDQA 4WJLA 1VOTA 4DMCA 5ALEA 2XMQA 3QZUA 4UFPA 2WLSA 4QEKA 2CBGA 5A7FA 1CUSA 3AINA 1XQXA 3R41A 4OB6A 1XLVA 4N8EA 4Y2JA 4Y2YA 3CXUA 2RGUA 4G8BA 2OGSA 1WB4A 1XKLA 3FVRA 4E46A 1YA8A 2DFPA 1NU6A 5ALTA 2VJAA 2QKYA 4BBZA 4OPMA 1EB9A 4C4ZA 2PSHA 3PFCA 1QIKA 1WHTA 4I4CA 2CB9A 4OSEA 3TJMA 2HFJA 1NX9A 1L7QA 4UHBA 1ODSA 3NOXA 1W4LA 4AZ0A 4Y7DA 5AKEA 5AOBA 2GZRA 3STTA 1E8MA 4X7BA 3QITA 3FSGA 2RONA 1CRLA 3WL7A 5AOCA 4E14A 4HRXA 5ALQA 4G9EA 2C0PA 4GBGA 1H23A 1AURA 4KRXA 3F8SA 3U1TA 2LIPA 4X6UA 2G4LA 3X3HA 4J0JA 1OXMA 4WFKA 3BIXA 3FVTA 3HSSA 4UBNA 1YB6A 4H77A 4LXHA 3EQ7A 1MPXA 5FLKA 2DHDA 6YASA 1W52X 4P92A 4KAAA 4K6HA 1XKTA 3V9AA 2QTBA 2WUFA 3O4IA 1EXWA 5CH5A 1WB5A 1TCAA 4J0GA 4C4YA 2HU5A 1CPYA 2RAUA 1F6WA 2XUQA 2XB6A 4BB0A 5KREA 1XQYA 3G0GA 4H7KA 2DQYA 3WK8A 1BN7A 3TRDA 4CIAA 4ROTA 3STUA 4KJXA 1X2BA 5SYNA 2WILA 3GUUA 2C5FA 3WWPA 4B80A 4KE7A 3STXA 1EINA 4FDMA 3PI6A 1QO9A 5FDFA 3C8DA 3I6MA 1EI9A 1YAHA 1QIFA 5SYMA 3K2IA 2Z8ZA 3MUOA 5E4JA 4FLEA 4E15A 3DOHA 4Y2RA 2FUKA 5FP0A 3WK7A 2QMQA 4QE3A 4BCDA 5KWIA 5AKGA 2QR5A 1R88A 4Y2PA 3V1LA 4X95A 1QGED 1CUWA 5DWDA 1LPPA 2WKWA 1UK7A 2PSDA 2DHCA 4G8DA 4B83A 2VTVA 2XUIA 4LIPD 4CFSA 1QIHA 2OCIA 2RI6A 1BS9A 4CG2A 3G0BA 1VZ2A 3MUNA 3WK9A 3OC0A 3RARA 1TK3A 4FOLA 2OAGA 4N8DA 3Q0TA 5ALHA 3KD2A 2JGJA 3DLTA 1X2EA 1J1IA 1ZIXA 2HA5A 5BOVA 1BU8A 3E0XA 4UHCA 2PL5A 4W1SA 2BFNA 1CVLA 1R4ZA 1ETHA 4PNZA 4DNPA 2BAGA 4H35A 3A2MA 2XUAA 5JZSA 5AJHA 4QDTA 2WHPA 2YASA 4EZIA 1CUEA 4DNOA 2QUAA 1VE7A 2W6CX 3E4DA 4NZZA 5AIBA 4WFJA 4C4XA 5K3BA 2ZVDA 5AI6A 1VA5A 3QPCA 4M0EA 5JAHA 3RK4A 4AB1A 5A7GA 4FBLA 2HFKA 4F0JA 4ETWA 1MAAA 3BF7A 4GLBA 3FAKA 1UOOA 4EUSA 3UUEA 4ZREA 1ZI6A 1R9NA 3BDIA 3WLAA 4Y2QA 3AFIA 3IUMA 4J0DA 3DOIA 5HZGA 4FWBA 4Q3KA 2GZSA 4BP9A 1B41A 5JAOA 1LLFA 4DMHA 5F4ZA 3R3UA 4ARAA 1DQYA 3WKDA 1VXOA 4GDMA 4FLMA 5C8ZA 5K3CA 1U4NA 4FNMA 1XZIA 4DNFA 1LPMA 4B9AA 2ZYSA 4EHBA 5FKJA 4H18A 5IVHA 4MEBA 2X5XA 1Q84A 5DJ5A 5LKRA 1CUZA 5AKIA 1MN6A 3H2IA 4Y2UA 1CUUA 2VJCA 1QIEA 1U65A 1IUNA 4JYPA 4QDXA 3K9BA 1A8QA 1YS2X 2WM2A 3SX4A 3AZPA 3MVEA 2ZYRA 5CMLA 1XQVA 5HF8A 3A2LA 1TKRA 1CUJA 1XRLA 5EHZA 1LGYA 1TCCA 3H17A 4B7ZA 1BN6A 2WJ6A 4XJVA 5JAPA 4UFNA 5A6VA 4GHWA 5KWJA 1UOPA 3PUIA 4KAFA 5FPPA 4X97A 3B5EA 7YASA 4Q82A 2C5GA 4HTAA 3R3VA 4KE6A 4PW0A 1Y37A 3AIKA 1USWA 2IX9A 4QWMA 1R3DA 1WHSA 3G8YA 2FJPA 4BDSA 3MGAA 3VVMA 3OM8A 2PBLA 4W9RA 5ALNA 1MU0A 3FLEA 3WIBA 2XMZA 1E8DA 3O9MA 3DS8A 1E89A 4X91A 4UPDA 4IO0A 2DSNA 5ALMA 2VSQA 1MO2A 1PFQA 5DYTA 1K63A 4HS9A 1JJBA 5AH0A 3WA6A 4PV7A 5AI9A 4KRYA 4B0PA 2WHQA 1VA4A 3VKFA 4TGLA 3BL8A 1ZJ4A 3C6XA 4FFWA 5AO9A 2PU7A 3QMWA 2Z5GA 3WJ2A 1AMNA 1DINA 2OGZA 2WTMA 3FYUB 2ZYIA 5BWBA 3W9BA 5HFNA 5EHQA 1Y7IA 1AUOA 3FLAA 5T4EA 3W2TA 2J4FA 1O6GA 1QIJA 4OYLA 2ACEA 4XX1A 3G02A 3LLCA 5J3JA 5AI4A 1CUIA 5AKJA 3ZLUA 2C58A 2BCEA 4DLNA 4DSZA 2Z8XA 1CQZA 4HAIA 1PV1A 5JATA 1JKMA 3ESBA 1G66A 4UFOA 1K8QA 1H2WA 4J0HA 5JALA 2HA7A 2XUDA 4CCWA 5AKKA 5LP1A 1CQWA 2J3QA 3WYDA 2C7BA 4I19A 3IUNA 1XZCA 1QIDA 1UK6A 5BV7A 4ZV7A 1A7UA 4BAGA 1C4XA 2Y6VA 5K3DA 4E11A 1JU4A 5FPQA 1EK1A 4C01A 5ALKA 4UBOA 1JMKC 1SC9A 2CKMA 4U2DA 3WK6A 1HQDA 4JNCA 3IA2A 4Y2VA 3YASA 4RE5A 2QJWA 4CG1A 1BCSA 4J3JA 5AKZA 2Z3ZA 5HF9A 1OILA 5EHXA 4YASA 4C89A 5EHNA 1W75A 3I2IA 1L7AA 1QZ3A 2BKLA 3I1YA 1N8SA 4H7JA 3VXKA 4LYEA 4JH0A 2JGEA 4MYDA 2WIJA 1XLUA 4U2BA 2VA9A 4CCYB 2XMGA 4YK7A 1G42A 3IURA 5D7BA 1MX1A 4UHEA 4X93A 2Q0XA 2WFMA 1QTIA 1A88A 4U2EA 3STWA 1IZ7A 5C81A 2Y6UA 3F9CA 1TIBA 3NWOA 1XZAA 1U8EA 4KYVA 3T52A 1CIJA 2QM0A 5YASA 2JF0A 4MJ3A 3F96A 2OQIA 5DYYA 3BJRA 5C7YA 1E8NA 5AKLA 2EEPA 3G9ZA 1QIMA 4ARBA 2QXTA 2O2GA 2OLEA 3OPMA 4PSCA 5K3FA 4NVRA 4BAZA 4JEIA 3WL5A 1UFOA 2VATA 5ALDA 1QE3A 5JD4A 1GZ7A 4Y2TA 1KEZA 1GXSA 4X71A 3PDCA 1XQWA 1XZDA 4EBBA 4LXIA 4BE9A 4X94A 3SWWA 1EH5A 2QOEA 5AI5A 2WJ3A 2HRQA 3V1MA 3IULA 2O2IA 2XLBA 3I6ZA 4FNGA 3FYUA 1MJ5A 4B84A 4FTWA 4YX9A 3LS2A 3ANSA 3R0VA 2YH2A 4AXBA 4CG3A 3H04A 2DHEA 4HXEB 1C7IA 5ALZA 1AQLA 2XMSA 3RKSA 3ZWQA 2HIHA 3L1JA 1AC5A 5ISMA 3LP5A 3EIOA 3H19A 2XE4A 5ALOA 5LZ4A 3C87A 3A70A 3H2HA 1ZGCA 3WIOA 2HA2A 3DYVA 1QTRA 4FKBA 2QUBA 2RHTA 3TEJA 3C43A 2CMFA 1EDEA 1VLQA 2WIGA 2GYVA 4RE6A 2HADA 5ALPA 1Q0ZA 3BJMA 1Q83A 5AHXA 3D2CA 1W76A 5AM4A 1R50A 5JARA 4QA9A 4Z49A 3O4JA 3N0TA 3AIOA 1CV2A 3DKKA 4N8SA 2OCGA 3DCNA 3P2MA 4X3CA 1W6RA 3R3WA 2HA0A 1H2YA 3UUFA 1ACJA 1DWOA 2GBCA 2G5TA 2XMBA 4Q3LA 4DMKA 3HACA 1JFRA 3PE6A 5D6OA 1J07A 1D07A 3AIMA 4XIIA 2HDWA 2B9VA 4FFVA 4F60A 1N5MA 5LZ7A 3IDAA 5AI8A 3O95A 2ZJ6A 3ANTA 1L7RA 2XI4A 4EY8A 2AXEA 4KR0A 2X76A 4M0MA 4A23A 3I2FA 3A6ZA 1CUXA 3Q8WA 1FJ2A 1WM1A 1FFDA 2AJDA 2DQZA 2VT7A 2VJBA 1ZD2P 3PFBA 4ZWNA 3HRHA 3N2ZB 2Y2VA 1MAHA 5I7UA 3GFFA 4NMWA 1A8SA 5LZ2A 2ZSIA 1KU6A 4AN1A 4QZVA 1YB7A 5AI0A 3AJAA 4INZA 4W1PA 4G4IA 1MNAA 4ZI5A 1SCIA 2R8BA 4DMFA 2I3DA 3O9VA 1MNQA 1H2ZA 3V1NA 4K5QA 4QWWA 1F8UA 1WPXA 3OG9A 1K5PA 1MX5A 3WWOA 3BIWA 1QFMA 4G4JA 4MXDA 5AIAA 2H7XA 3KWJA 5AK5A 1UKCA 2PSFA 3H1BA 5FOQA 4U2CA 2XUPA 4FMPA 2XUGA 2XQJA 5AKHA 2WUDA 3F67A 5DTIA 3EF3A 5IH7A 3KWFA 3EQ8A 1QONA 2DCMA 1ZI8A 1XZEA 4OB7A 5IVKA 3W06A 2ZSHA 4EY4A 1XROA 5CT5A 2YYSA 3W9UA 1IUPA 2VEOA 1Q0RA 3D5EA 3I2HA 1UK8A 1TQHA 2OCLA 2VQ6A 4H7EA 4CCYA 5DLPA 3FCXA 1P0QA 4IH9A 4QLAA 5T4FA 3M83A 1K6EA 5HK9A 2BUBA 4B6GA 3IBTA 3H2JA 4BRZA 3G9TA 1CR6A 1JMYA 4GECA 3C5VA 1CUCA 4QLOA 5ALUA 3JYHA 3VJKA 3M81A 1UZAA 3G0IA 3T4UA 1EK2A 5AK6A 1XZGA 4Q1VA 4AX4A 5K5EA 4C87A 2Y2UA 3FSGD 3WWCA 1QIIA 1JT2A 3ILSA 2PPLA 5JASA 3STVA 3HABA 3WKEA 5AM3A 4QNNA 1QOZA 2CJPA 5JADA 4HVTA 5LZ9A 3WKBA 1EB8A 5CT8A 2BJHA 5EIAA 4AN0A 3CN7A 3QVMA 2QVBA 5JD6A 1YA4A 5E4TA 5HCUA 5DNWA 1CUDA 3F97A 4GI1A 5LYYA 2I78A 3KOOA 2K2QB 1T4MA 5D3KA 1UKAA 4W1RA 2JGMA 5D3ZA 4DGQA 4BYMA 1IVYA 1DWPA 2HRRA 2BGNA 2D5LA 2XMDA 2VF2A 2AJ8A 2QJRA 3R3XA 3WKCA 2G5PA 1CUVA 4OB8A 5A71A 4W63A 3L1HA 1F0NA 5ALGA 1F0PA 1LZKA 2AJLI 4BZZA 4KE9A 3I2KA 3DJYA 1DX4A 3I2JA 3I28A 3I1IA 1NU8A 5CH8A 3ZPXA 3QPDA 4L3WA 1EX9A 3JWEA 4F21A 2BUAA 1DT3A 3I6YA 5ALIA 5ALWA 2H1IA 4PSUA 2HU8A 4UBKA 3FWHA 1BRTA 2O7RA 3H1AA 2GBFA 1KU0A 3FNBA 1H2XA 3AZOA 2W22A 4G9GA 2PVSA 2I3ZA 5AK3A 3KSRA 5A7HA 3QM1A 5HKAA 1ZD4A 5KBYA 1GPKA 1FSSA 4BCCA 1JU3A 4K6KA 4BZWA 4BDTA 3KDAA 2VJDA 5IVIA 3DEAA 2PM8A 1G5FA 2JEZA 4QDUA 3BF8A 3R3ZA 1P0PA 3B3QA 4WCVA 4BATA 1IMJA 1FFAA 4L0CA 4J0KA 5JIBA 1XRRA 2ZYHA 3VDXA 1IUOA 1BCRA 1GQSA 1TRHA 4UBIA 1LPSA 1QJ4A 4QDZA 4KAJA 2XQFA 5AM1A 4H0CA 1GQRA 5AM0A 4RGYA 1LPNA 3V1KA 2NW6A 4MQLA 1XZMA 4X6XA 4UHHA 2VAXA 1SCQA 4EB0A 2EDAA 3OURA 1HDEA 3ZV7A 5AK4A 3H2KA 5A62A 5CURA 3GA7A 2OCKA 4BVLA 3WA7A 2C4HA 1CUAA 2JGIA 3F98A 5JAUA 3WMRA 4PO3X 3DL7A 3JW8A 2ES4A 4F5ZA 3WJ1A 4N5HX 4GW3A 1BE0A 3H0CA 3STYA 1GKLA 1ORVA 4MEAA 4PF1A 1SFRA 5HF5A 5LLSA 4BAUA 4BVJA 3AZQA 4JYMA 1ZD3A 5CBKA 5ALRA 3C45A 3U0VA 2CEKA 5HFAA 4WY8A 2XQGA 2ONCA 3PUHA 1LBSA 1LPAB 3R40A 4IH1A 2WHPB 1YAJA 3FLBA 4IHAA 2BUCA 4O08A 3WZMA 1EHYA 4X00A 1E66A 3D3NA 1E5TA 2WIDA 3C8HA 4DM7A 2JIDA 2GBIA 5EI5A 3W04A 3I2GA 3HI4A 5LZ5A 4U2GA 5JD5A 4Q34A 5K3FB 4X90A 5ALJA 3FYTA 2AJBA 2BGRA 1VZ3A 5JYCA 2JGFA 3B12A 2XMRA 4GEGA 2G63A 3DL4A 5T4HA 2WG2A 2OPHA 4BE4A 3FBWA 4J03A 1WCYA 2QRUA 4CI9A 1GT6A 2OAEA 2VAVA 3HLKA 4TPKA 4W1QA 2JGKA 5K3EA 2WG0A 2B20A 2XLCA 1N1MA 3IIIA 4UBLA 1CUYA 1GGVA 1XLWA 4BCBA 2V96A 1ZOIA 4V2IA 4OD0A 4P08A 3FCYA 2OGTA 1XZBA 4AQDA 1EVEA 3IUJA 5IVDA 2O2HA 3DKRA 1H22A 3UMJA 1E3QA 1ACLA 3ZI7A 1XFDA 3VVLA 5FV4A 1THGA 3C6ZA 5AKXA 2FJ0A 1HKHA 5DNVA 3ICVA 1XZFA 2XQKA 4G8CA 4XWGA 5LZ8A 1EA5A 4OU4A 1Y7HA 3WL6A 2FX5A 3PF8A 2EDCA 3VISA 2JGLA 3ESDA 1W1IA 3ICWA 5ALXA 5CT4A 2GYUA 1FFCA 1I6WA 1XRNA 3S2ZA 4BC0A 4RPCA 4BVKA 3IB3A 1UKBA 3NGMA 5DNUA 3H2GA 1GKKA 2OXEA 5BWCA 4OYYA 2PX6A 3LIIA 4WY5A 3RM3A 4AMYA 2V9ZA 4K2AA 3EQ9A 1FFBA 4BTVA 2ORYA 1LBTA 1CUGA 5ALVA 4KEAA 2H7CA 3WK4A 3QBJA 3LCRA 1XZKA 3PICA 1HLGA 1ZD5A 1LPBB 1G4HA 2WUGA 2CUTA 3BWXA 1J06A 1YSCA 3KXPA 4L72A 2WIFA 3GZJA 4LXGA 4UHFA 4B82A 2HA4A 1ZJ5A 5AM5A 2ECFA 2GYWA 4J7AA 5AOAA 4G5XA 3HZOA 2HU7A 5HKBA 4H7DA 2H7YA 4ZV9A 3D0KA 1HBJA 1AGYA 1ISPA 4S0XA 4MQMA 4MYSA 2C0QA 2J3DA 5C8XA 3ESCA 2O7VA 4K6GA 5EGNA 4D9JA 1GPLA 3O4HA 4ZXFA 3HXKA 4L9AA 4AMZA 1BEZA 4B81A 4EY7A 2IITA 4J0CA 1XRMA 2QZPA 4ITVA 4CIBA 1WOMA 3WYNA 4DNQA 3LIPA 1N5RA 1UK9A 1IZ8A 3WWDA 4AO7A 3AILA 3ZLTA 1U2EA 5I8PA 3WK5A 3HEAA 5LIPA 1A8UA 5AP9A 5HF6A 4DTCA 1P0IA 2HA3A 5JANA 2ACKA 4PQEA 4FHZA
chains in the Genus database with same CATH superfamily
1RMTA 4TV9B 2ZWVA 4GWKA 2C5BA 2VJMB 1R0WA 4HRYA 2O5EA 3KYCB 1NT2A 1NJ8A 1XDBA 3FCUB 3L0OA 3QJYA 2HRDA 1C4WA 2PKQP 2AOTA 2X9GA 1CUHA 2ZUWA 3EISA 3OZDA 3NDPA 3DFZA 3LX4A 3PP8A 4P3KA 3G2KA 1JQJC 1P9WA 4DA7A 2Q4RA 1WEHA 5CNJA 3RODA 1S3SA 4H7HA 4KXWA 3BERA 3LPDA 3EPHA 3OJFA 3OTQA 3DMDA 4B3GA 3CPSA 4GPIB 3R0XA 5EJ5A 4YP0A 4MLPA 5EIEA 3ADCA 1NQAO 3NH9A 3V1UA 4BNDA 4H1WA 4KK4A 1PW7A 5JXWA 4Q3OA 1E3EA 3PX2A 1SVWA 2Q8QA 2IWHA 3SYMA 3CISA 3AUTA 3N6RA 4S05A 1CEXA 4A15A 4DR4B 1PK8A 1VP3A 1ZESA 2GD6A 3NASA 2ZWOA 4YUZA 4JJ6A 2YJ4A 2Y1KA 4RZXA 1RXIA 4PANA 3SFTA 1JR3E 4EPRA 1GPNA 2F9LA 1DQRA 1E63A 2PSJA 2XRZA 4B8WA 4US2R 3MBOA 1RYEA 3F74A 3HTXA 2X14A 2H4YA 3O92A 4LHWA 1U94A 2CW5A 2PTGA 4RY2A 4YBZA 1ZN2A 2HMVA 1KMHB 1CG6A 3GN2A 5ALYA 1BJRE 1DADA 1ZHOA 3C70A 3IEUA 5DXAA 4B47A 4DG9A 3D59A 4FGWA 1H4TA 2GJ4A 3F5FA 3NHBA 4MK4A 3TKAA 3M49A 4RHYA 4WINA 2F8LA 3BRQA 2XZOA 2VPTA 3RAFC 3DOJA 4CN9A 2QYHA 3HWSA 4HEA6 5DYWA 3V4LA 4B3BA 1WMSA 3EXIA 4R9NA 4AKEA 4H59A 2BH2A 1K92A 2XPCA 4O2BB 3UWPA 4FR5A 2GK7A 2WUEA 4XYGA 5C35A 5JNRA 4KOAA 5K7SA 4KXUA 4HDNB 3HC7A 2R6AA 5D3QA 2LBPA 2PEZA 3ONVA 3PCXA 4PFSA 4BMCA 4OL0A 3TSOA 2BHTA 3TG8A 1M33A 3B2NA 3LGAA 3PUKA 3ABQB 5FNVB 3SYTA 4LS3A 4GWGA 3VNBA 2R9VA 1N6LA 2VOJA 5BNIA 3UPUA 4LHEA 1RFLA 2JBWA 3ABOB 1Z22A 1GUDA 3PJEA 2D6FA 4QQKA 3V46A 1U11A 2DY0A 2V97A 2YXEA 2ZR7A 4BWYA 3OKCA 2BMWA 2YV5A 3OHMA 9LDTA 3AY6A 2AR9A 2Z5VA 3CX4A 5IASA 1OYOA 3B48A 2NVUB 2IGTA 3S8YA 2QE6A 3L1IA 2P9GA 4YUVA 3RR2A 4O3MA 4NCXA 1K27A 3M89A 2Q41A 3D2AA 4TRJA 1C3OA 4BKPA 3BKWA 4ZYVA 2FSVC 1ESNA 1M1NA 1F5SA 2F48A 3C2QA 3WYBA 4YAWA 5FEUA 4IOMA 5BV0A 2ZIGA 3UFBA 3G82C 3QHAA 4INJA 2GHIA 2PT5A 4Y9UA 4ZRNA 3K92A 1OV4A 1R0ZA 2CXHA 3RSFA 3O2NA 3RS0A 1Q5PA 1SOMA 3OSZA 3WYCA 3M82A 3TMYA 4BYGA 4QTYA 1YDMA 1Y6QA 2J5BA 3ER6A 1Z2AA 5BP7A 3QVXA 4RIFA 2D1RA 5FOUA 1PGNA 3UHFA 1UJ6A 1VBFA 4HWOA 4XPZA 4F1WA 1M5UA 3A6JA 5DEOA 4RHCA 2ONYA 3FGPA 4MPRA 1SIWA 3PQ6A 1ECBA 2Z4SA 5CAEA 1I2BA 2F1JA 3CGWA 4FQ7A 4JOQA 4RA9B 3UIEA 1OBFO 3AEUB 5L4SA 1CJSA 1LZLA 3NIFB 3UENA 4DR7B 1G2OA 3A6HA 1RYZA 2EGHA 4D2IA 2XUJA 4YI3A 4H7FA 3DOOA 1M2JA 2UVPB 4J94A 4KLRA 4MVYA 4F4JA 3QY9A 3HG7A 3JZDA 2HKIA 1M6VA 3T4PA 3AHHA 3PQEA 3KYCA 4I1IA 2JPDA 2M1ZA 3VI3B 3GLVA 1AV7A 4JL8A 3ASZA 4MR9A 3UH1A 1ZVJA 3RAGA 3RASA 1II8B 1PKEA 2PS1A 2Q4TA 3C39A 1BROA 4FVTA 3L7OA 4MUAA 3VTAA 2R1TA 3EIWA 2FUEA 3L7DA 1SCBA 4H31A 1SBHA 4EGFA 1E2HA 3TEMA 3OEED 4ZAGA 4C0BA 1HT0A 4F8YA 3EC7A 2VH1A 2GEVA 5A4FS 4M1SA 2XIJA 2A1UB 1PFUA 3I30X 5AVUA 1XVLA 2W2VA 3BS4A 1AKNA 1TVCA 1ZM2A 1ZN8A 4WXMA 1VMIA 1LI5A 4QUEA 3L8EA 5AW8A 3GDGA 1XDUA 1XVUA 4JOSA 1O97C 4P83A 4RGVA 3TLCA 2R47A 3WKAA 1OV6A 2ZTVA 4AL4A 2K87A 1NF8A 5BQXA 3FTEA 1E4VA 4GPEA 2XDQB 1T4BA 4ENVA 5KZMB 3EDMA 5J2UB 3WBFA 3U56A 3A4IA 3CEMA 2ZTUA 2FSPA 1CQIA 3NGLA 1QH9A 4CLEA 5K99A 4KI7A 3DYIA 3JQBC 3OFSA 2ZUVA 4LZWA 1HOTA 1WY7A 1LDBA 1LDMA 1N0IA 4QJIA 1PTJC 4KPUA 3SC2A 2B4YA 1KP2A 1S4MA 1TGVA 1WKVA 2XT6A 5CTAA 1P62B 2R97A 1DHTA 2NIPA 2OXTA 1QR6A 2GJKA 2G04A 4MCIA 2JDIA 4KW7A 5E2IA 4FZRA 2RGEA 1W5AA 4DIEA 1W8IA 2V55B 3BZWA 2LD4A 2DT8A 3NTVA 1UFRA 3WGNA 2PANA 4CR7A 2V98A 1SBQA 1UM9A 5K6TA 4PGHA 1ST3A 3LPLA 1BX0A 2FETA 3A1DA 4WZAA 2GEJA 4Q19A 3IBYA 1Z37A 4MKRA 1UPXA 4IQ8A 1XCMA 2OYSA 3AONB 5CG2A 4BQFA 2YY5A 1PD0A 1ND6A 1DUVG 1KMCA 4K46A 4D97A 1IHYA 2IDMA 4KQGA 4M0KA 1NUTA 2ZATA 4D3XA 5JAQA 3G2OA 1UBKS 1YRAA 1XZLA 2PJZA 2BVNA 3AR3A 4REMA 2RHWA 3U7JA 1KHTA 1KC3A 1YULA 3QK7A 4S3MA 1CZOA 5C5EA 5DO9A 2VFAA 4GI2A 3GROA 4TSRA 3ECSA 1MTZA 3KEMA 4WOCA 3EGOA 3ZWVA 4GPTA 4B3DA 2GHRA 2LCIA 5HQ3B 2NXNA 3IT2A 2JLUA 5DTJA 1S8FA 1U99A 1VL5A 1NPTO 3FHOA 3NB0A 2JFFA 1CRQA 3DMPA 1STOA 1LRLA 1PT8A 1JEEA 1VCIA 3I64A 3C97A 1QUEA 2CXXA 2EYUA 3HZHA 3T0IA 4WK2B 2C82A 3QUAA 1DCMA 4NG5A 2J67A 4TXMA 4ZRDA 3H9BA 3PL1A 5FUMA 1BEUB 1CLEA 1QO7A 5ALLA 3AR9A 3TE6A 2CDRA 2W2TA 3HYSA 4PGAA 1UH5A 3T0FA 1LDEA 1DHRA 5C37A 2VT3A 5JMOA 1CNEA 2QU7A 4IHJA 4K6OA 5JYEA 4D26A 4M60A 5CUQA 1XD9A 1ZOLA 2KLBA 1UM9B 1T2AA 2O8VA 4FFLA 2DWOA 3Q7IA 1Y4DE 2GZ2A 3EYAA 4XIFA 2O57A 2ZG6A 1JX6A 2JLQA 1XN1A 2F59A 2JFBA 3LZCA 2WSLA 3L6CA 4GOJA 4DYHA 1YI8A 2ZYGA 3GJSA 5E3IA 3G0HA 2CJWB 2BSAA 2YWCA 1SG9A 3AXTA 3B7PA 3LUHA 4W7IA 1DTWA 1VMDA 2IOFK 1T6NA 4LK3A 1BZYA 5FTMA 4C43A 1ESEA 2I76A 4LVOA 5T4BA 4BP9A 3VTFA 5JS1A 2R0QC 1SVMA 2C2KA 2Q3BA 3TI9A 1Z0UA 2F43B 2IZ5A 2GRUA 5I3CA 3VJRA 2H4JA 2VDJA 2PRIA 3I23A 5KNBA 2PGIA 2ZJOA 3H8JA 4UDXX 5DCUA 3LT4A 5TXGA 2J8ZA 3A3PA 3L04A 1YHZA 4C07A 2AJCA 2J6BA 3HLYA 3MM4A 5JHGB 5KPDA 5J43A 3KVOA 3OU7A 1MCZA 1WB6A 3D8SA 4HZGA 4XARA 5KAPA 2D4AA 3HU5A 2ZCVA 4IDPA 5BNTA 2BFWA 2ZZKA 3D7RA 4B48A 3D8NA 2VHEA 1L7EA 3RQSA 4YRIA 4GX1A 2C4WA 4EL0A 5BW8A 5CW2A 4Q5IA 3DO5A 5JJKA 3CEHA 3IH5A 2CDCA 2P9QA 2XT0A 3LFUA 4OAPA 2WWWA 1XP5A 4WDRA 5DOVA 3SQDA 3ZQ6A 5K8UA 1B8PA 1QP4A 1NV8A 1MT3A 1JJAA 2ECQA 5LYJA 1II8A 2B3TA 4ZT3A 2O3RA 3QF4B 4FOSA 3FKSA 3ABIA 2AIRA 4X6YA 4B74A 3C3AA 2CUNA 2UZ3A 4ENTA 4DSAA 4IGEA 4KV7A 4MGYR 1P4HA 1R0LA 4PHFA 3C3BA 3ZHQA 4I50B 3I9MA 1TJPB 4HDKB 3Q4GA 1R8JA 4QBIA 4CM8A 1TUGA 3F0TA 2XMCA 4NMXB 2AYYA 4LHZA 2WT9A 1BDMA 1CERA 3TW0A 1ECLA 2GJ9A 1JG2A 2PHZA 1FVXA 3N1UA 4FQ8A 4HDRB 4JBYA 4I4IA 4JP3A 4AF7A 4AO6A 3C3EA 1ZICA 1PGOA 1NP7A 3DBHB 4KACA 4MUJA 5CAEB 2VK8A 4OJMX 2LVBA 4M7RA 1BDHA 1QRRA 4UAVA 3ZQKA 1XRSB 3IRUA 3D2BA 1R64A 4XOUA 4Y9SA 2AT1A 5DM0A 2QM3A 4BVBA 4M9XA 1U0TA 1YBVA 4GO1A 4QTZA 5DXJA 3VZDA 4ARCA 4DIKA 3TN7A 4ZICA 5AM2A 1XVTA 4L8WB 4DF3A 5BUQA 1DJMA 2A94A 1T3LA 2Z3WA 3BE8A 4EYEA 4WKGA 2QQ5A 2ZBDA 2YV3A 3R44A 1H5UA 1ZNZA 4OI2A 4M4SA 2H5LA 2GZAA 3QX9A 2PX3A 1DS6A 3QH4A 2FK8A 1Y5LA 2IRWA 1Y89A 1GSIA 3JAWB 3T7DA 1LC3A 1A1SA 3CRVA 3PVCA 4JBGA 4XVCA 2HM7A 2J3KA 3OPQA 1L5SA 2ZSAA 5FFMA 1TZMA 1NOIA 2DR0A 2RHBA 3LQQA 1SPBS 2D1QA 3G0DA 3D2LA 4FB4A 1DG9A 1O96A 4GX2A 3JXEA 3C8MA 2CZCA 4K8RB 2Y66A 3AR7A 1Y81A 3GCXA 3HXLA 2GTIA 3PHGA 4HC4A 3DT6A 2UZ1B 2XXJA 4P4GA 2AWOA 4RTMA 3IBSA 1JQ3A 3R0ZA 2DHRA 3HJFA 3HWX1 4OGWA 1DC6A 3S1LA 1AKTA 1GL3A 3IXQA 5BQPA 1PL7A 4AIIA 3PRJA 4C78A 4RVCA 4FK8A 1PL6A 4G4GA 4DIOA 1E3TA 2G83A 3IDZA 3E0QA 3DV2A 3HUTA 2BH9A 2G9ZA 2HUNA 1EDBA 1R6BX 2VDKB 4JLUA 5DM4A 5KTRA 3OKFA 5CG1A 1TADA 2IFTA 4TTIA 4N18A 5LUBA 1DG1G 1V95A 1ZAKA 4YV7A 5B4VA 4GMGA 3ZE8A 2XXAB 2OBNA 1T5SA 3C3KA 3G5MA 1MZPA 1C81A 3A9WA 3PQ3A 4NIMA 4O4JB 4D81A 5TQ2A 3I5XA 4UTPA 2O0JA 4GZ5A 1L8LA 3WLHA 4ZOAA 3ZWPA 1HDXA 3PUZA 5T7BA 2AOXA 5I8ZA 2QTMA 3QPVA 4TLLB 3E22B 4E2FA 4EY6A 3AVTA 2YFQA 2ENWA 2GN8A 3HVUA 5HE9A 1HV8A 1MHTA 1X3SA 4CDRA 4HNQA 1XEWY 4ALMA 5KMGA 3D3WB 3VKGA 3KQQA 4RJIA 2JIPA 3SK0A 3PC2A 4BRSA 4JJ7A 4HQKA 3KPUA 1LRKA 3VVBA 1AQYA 3E15A 1XBTA 5EZ5A 5A2GA 4UUQA 3L6BA 3G0CA 3WYEA 3JR3A 4PLTA 4DLKA 2W0SA 2IT1A 4LC0A 1VOTA 2B8JA 1OW3B 3AP2A 1DKRA 3OZTA 3WYGA 3PQDA 5B1EA 1S2IA 3BHNA 1LVGA 1FP4A 2HN9A 1HE2A 3BQMB 1G3QA 5CNMA 2Q5OA 2WLSA 5EIFA 1VYUA 4UFPA 4DDUA 2P90A 3VHXA 1KVQA 3ZOZA 3NALA 1WP4A 1RWWA 4H0NA 3A7DA 3CUUA 2GPNA 4R7TA 5DCWA 2PMWB 1LJLA 3CNQS 3RHSA 4CGYA 5GONF 3RHTA 5EUQB 2HMYB 1EZZA 4JVMA 1XQXA 4EY3A 4CR8A 4EHKA 2QG6A 3GLHE 3TTWA 3FTQA 4R51A 5J1SB 3FTFA 5FNVA 2YNMA 3DAGA 4YRRA 3NV9A 4B87A 4N8EA 2GWHA 3CRW1 3TXXA 4DSTA 2XITA 2JJ2D 4G8BA 4N1AA 4W8GA 2OGSA 2J5KA 1YACA 4B7AA 1MXHA 1HSZA 4J2TA 2BHNA 5HKKD 4XQGA 1UINA 1Y5IA 3U7EB 4E12A 1XKLA 4FFMA 3R7WB 4JAVC 3ASYA 1PIWA 5KX5B 1FTNA 1VI2A 4LYYA 3GRFA 1VP9A 1Y6JA 2AD1A 4FJ0A 5ALTA 1GPAA 3JQBA 4YWJA 5HVNA 2DUJA 1TJNA 1DAGA 1CTQA 3F73A 1EB9A 4LJYA 3NOVA 1NBIA 5H70A 4INOA 5BO5A 4HAWA 2QT1A 1VSTA 2PG3A 5BYAA 1E3DA 4W5JA 4DC9A 3LQ2A 5GVSA 1R15A 1C9DB 2ISCA 3OQMA 3SEZA 5JC8A 2OV1A 2ZTSA 2VYVA 5JJ5A 4IOKA 3HB5X 4DDWA 4EAAA 2D7CA 2K7ZA 2X8JA 4CMEA 1EQAA 1ADCA 2ODBA 4MS4A 4CEHB 4GVLA 4O1IA 1Y9DA 1TEHA 3V34A 5AKEA 5H9WA 5LQKA 3HMKA 3LUCA 2Y0DA 3VR5H 1NVXQ 3STTA 1PVDA 1JDJA 2WYVA 4QPZA 3WDMA 8ATCA 2RONA 4MV6A 3HDGA 4YXWA 3WL7A 1RI3A 1EWTA 1A9ZA 1CHDA 2WHXA 1GGMA 1OJ7A 5H3LA 1USGA 2UXCB 1H23A 4IDEA 1UJNA 3ND7A 5JT1A 3M1YA 2RHMA 3KS9A 2PLRA 4ZT6A 5ELMA 2JLCA 4FGSA 3LOQA 4GRAA 5G3YA 4IGAA 1QHIA 2HIMA 2VNSA 1W88B 1YDEA 2VJMA 3GXBA 4UD2A 4ZQHA 3TPCA 3NV7A 2LIPA 4X6UA 3TRJA 4HDNA 4QGSA 3WNBA 3N2IA 3TLKA 4LJ7A 1VIMA 5CEFA 5LWHA 4BQSA 1I5OA 2GAAA 3ZHTA 1QQ6A 1V7CA 2G4LA 3X3HA 5JRJA 4B5LA 3DT9A 5IANA 2AMYA 3B7GA 4PZPA 1OXMA 1TQ6A 4RPKA 1SCAA 2QX6A 2IYWA 1TCVA 1LEHA 4RSHA 3W8DA 1GSOA 5D84A 3L43A 2OHXA 2EJUA 2QRVA 4IYRA 1K1EA 4LXHA 2CBZA 3WOVA 1DJPA 3N2GA 5FLKA 1UBOS 2VO1A 3CV3A 1KYIA 2AE1A 4J3FA 1JKFA 2DHDA 3PGXA 4KXLA 4RA6B 3E2MA 2X0EA 4KLCA 3NG1A 3NWPA 6YASA 2CJYA 4XFJA 5H3CA 5BV2P 4YCMA 3RTBA 4M8SA 4CMKA 3EEIA 4KAAA 4FDUA 4EH1A 1NE7A 5DWVA 2JC3A 3HSKA 2R7KA 5ANRB 3AF0A 3MLAA 2WM9B 5F98A 4AQYB 4ZCQA 1D1QA 4UASA 1BMDA 3G7SA 3F47A 1IZ0A 5CH5A 1WB5A 3UPDA 1A2BA 1KI9A 1TCAA 4J0GA 3TXAA 4C4YA 4DT1B 1M0EA 2QBYA 9MHTA 3I1FA 1Z39A 1XQYA 4DUGA 3WK8A 5BVHA 4F11A 1ZLXA 1P3Y1 4RZ2A 4ETNA 4YT2A 5IU6A 3R9IA 1B15A 3TRDA 1LS6A 2JASA 1VKJA 1E92A 1H1LA 1UXIA 4I55F 5B64A 4CIAA 1EBUA 1CVIA 2RHDA 4ROTA 4HNGA 4QSMA 4LXYA 4TTPA 3RYHA 2IDKA 1X2BA 4IW3B 4H60A 4WOBA 2NVWA 4LOLA 2C5FA 3THWA 3PCRB 2QDXA 4JS0A 2Q1YA 3ROZA 1ILEA 1OXXK 3BMCA 2NADA 1T34A 3OX2A 3PUXA 4HOYA 3B1FA 3FTPA 5DYGA 4IIJF 5CP8A 5AW9A 3P0HA 4XIJA 3QVWA 3NZEA 2HCFA 3EEYA 1P2TA 4YO7A 2YHUA 5FOWA 4IWXA 3N5CA 2JFOA 1XPOA 3OX4A 2R1VA 2XKJE 3PSHA 4W8HA 4JNKA 2V8BA 4IIEA 4F3RA 5LMZA 1EI9A 2QVZX 4FOTA 3EIQA 1X14A 4O33A 5E7QA 3H11B 3VPCA 1IL0A 2ZU0C 5K3OA 4DLLA 2BFEB 3K2IA 2XD4A 1AF4A 3PYLA 1G8FA 3IUEA 1XZNA 4NECA 3ORRA 2SKCA 4MUXA 1D9XA 1QUFA 4Y6PA 1G6HA 1SXQA 2M6LA 1KEPA 2NXEA 1MC8A 1XTUA 1TC1A 1IONA 1OH7A 4WXYB 5KNCH 4HO1X 5DYIA 3VKWA 1Y6FA 3RJ9A 1KQNA 4X7PA 5KWIA 5AKGA 1GT91 4EK9A 3VR2D 3GH3A 4Y2PA 3V1LA 3QYPA 3MNFA 1OC2A 3Q85A 4N6GA 4K9DA 2IU4A 4PWYA 3I05A 2PZMA 2MU1A 1Y7LA 4UAGA 1L5LA 4B76A 4BJ1A 4YCCA 5J4VA 5I9LA 2ZIZA 2GETA 2D3TA 1AUQA 2HJHA 4YMHA 5KJ1A 4B79A 5L95A 1YKSA 3OT1A 5AW7A 2OFFA 5CA1B 2UKDA 1QZUA 2VAWA 3JQAA 1LPPA 4CUJA 4ER5A 4GYJA 2D8AA 3O73A 3R0JA 5F64A 4NV1A 2VJNA 3F1KA 2PSDA 4L5AA 1OAKA 2FN3A 2GQ0A 2OSVA 3H9JA 2VXCA 3IP1A 2E1PA 4Z0HO 4P31A 3FSRA 4H9GA 1RLMA 5DBOA 1RFGE 2DX7A 2QI9F 4JYBA 4V2UA 3TS1A 5HYVA 2CXTA 3Q8XB 5ADWA 2DWQA 4NR0A 3TD9A 1E5VA 1Z8FA 1N7GA 4OKNA 2GF0A 3L7IA 3PFWO 2PFGA 4IIFA 5CJJA 3RFFA 1T9KA 1JHOA 1XU7A 4X6LA 2PZEA 4XQ9A 1UP6A 3N6XA 4DLUA 3NDIA 4IKPA 4XX0B 1M72A 4BQIA 1PGQA 4GYKA 2TMDA 1SG0A 4WNYA 3E27A 3GGJA 3E2IA 1M5TA 2ADMA 2ANCA 1TK3A 3P8ZA 4FS8A 3D6MA 3A1SA 1QF9A 4YDSA 2F00A 1L7BA 4KQKA 3DPUA 1GSHA 2IUTA 3Q0TA 4OGFA 3KD2A 2JGJA 4MKIA 1X2EA 2OVBA 2OBFA 4QPNA 1XMVA 2JAQA 1ZIXA 2HA5A 5JNWA 1P39A 1Z9BA 4P54A 3OE7D 4QRHA 1G63A 5BOVA 1DAIA 2WPNA 4TTJA 2NAFA 1JQEA 1ORIA 1QGOA 2YHBA 1PHRA 2OMEA 4UHCA 2PL5A 3KUKA 1LX7A 2VQDA 2BFNA 4BNZA 1L5HB 1R4ZA 2CWDA 5H80A 1VDZA 3S81A 4OQDA 2PH3A 3TRHA 3ZYCA 1ZD9A 4DJEC 3IIJA 1Y63A 3A2MA 2XUAA 1M83A 3COSA 4HDMA 4I46A 1A5AB 4K9MA 3SGLA 5MGNA 1OTXA 3CPJB 1GGNA 1KAQA 3QJ5A 4UEKA 2WHPA 3LE8A 2YASA 4KQ6A 1HETA 2WJGA 5JWOA 2A9QA 1SXIA 1I3KA 4RX1A 1VE7A 4Q16A 2F1IA 5FBRB 3OIGA 4ZT7A 1LW7A 5C46F 4WFJA 4C4XA 2BP7A 5DN6D 3GK3A 5K0CA 5I7AA 4BLVA 5KJCA 1Y9EA 2XA2A 2XF8A 3OA0A 1GNRA 4N41A 3H5NA 3VV2A 2GN0A 4FEGA 3CMMA 3M2TA 4H27A 5LP6F 1VA5A 5T8KC 4YJ3B 1JPVA 3UJHA 2EYQA 3DEZA 5JI2E 3RK4A 4RZUA 1WXDA 4AB1A 3DKVA 3UBTA 2A35A 2VF7A 3IAEA 3L05A 1TKCA 4K05A 4HN2A 4HTFA 5BXYA 3DE0X 2BF7A 1I2AA 5B2ZA 3U3MA 4Z3KA 4WCFC 3ETHA 1R9GA 1MAAA 1LUAA 3MJFA 4NCJA 2DBQA 4CF4A 4E7PA 3WBJA 3F9RA 4KDCA 2UAGA 3F7TA 3M9XA 4PXYA 2Q07A 2A5FA 1R9NA 4G37A 1A3CA 1GCIA 4AM8A 3N8HA 3OJXA 2EX0A 1DMSA 4Y2QA 3WLAA 4PZEA 3U7FB 3ZWWA 4NQZA 2FMTA 3IAXA 4B4KA 2RJOA 3VU9B 1S2LA 3IUMA 4J0DA 1ONOA 1BVUA 3DOIA 4YMVA 2HCTA 1JMVA 1CB7A 3M1IA 1T6ZA 5J1TB 4QLBA 4NH0A 3EZ6A 4RIEA 5KHLB 1Q7EA 4R05A 1GG9A 1PZGA 4G5QA 1Y8ZA 3CZPA 3FZEA 1DUIA 1T4GA 3DEKA 4QOGA 4A26A 4CMEC 4X9XA 5JAOA 2VDMB 4DMHA 1BE1A 1CDOA 3IEIA 1UEJA 2JFGA 3GRPA 4GMFA 3BRCA 3EFHA 1KIAA 2VHWA 3NC0C 4XGRA 5F7OA 5IFLA 3G7UA 3QFSA 3SSMA 1HX7A 3GLGA 2RK6A 3PDUA 1IBKB 3CC8A 3RABA 4JT2A 4GDMA 4N12A 4NU6A 4JI6B 1JAYA 1NONA 2V7BA 3S2GA 4RTPA 1SGWA 4EPXA 2BKEA 1DKLA 4TL6A 1MB0A 5K3CA 5CA0B 5SY6A 1OKKA 4G1CA 3RU2A 1XZIA 5F7JA 3LU1A 1LPMA 1DBQA 1EYZA 3K1AA 2EQ5A 5G1OA 3U6BA 1M2GA 4KUGA 1QSGA 1OWNA 3TIFA 1P73A 2OUKA 4F2DA 5L3QB 3HCBA 3KLNA 3UMSA 1J70A 2OD2A 3BOSA 4RESA 5IVHA 1SCNE 5IN4A 2XNHA 1Q0QA 5KWVA 2YV1A 5C32A 5LKRA 1YI0A 2GEFA 2ZJAA 2OXRA 3DM5A 5T41A 2ZWMA 1MXFA 4PQGA 3OJEA 5A9SA 3FUVA 4ZQEA 2Q49A 1HF3A 3DB2A 3EIEA 3GN1A 4UXJA 3U3XA 3EFOB 2J9XB 1Y3BE 3TD6A 4Y2UA 1TTPB 2WZBA 1CUUA 3NEYA 2DM6A 4Q3EA 4WZBB 2AN9A 5TGZA 5JDCC 4ZOQI 1A9XA 3O8RA 3IE0A 4I66A 2Y0BA 2BONA 1OWPA 1PR3A 4JYPA 4LMAA 2B37A 3K9BA 4QDXA 4ZT5A 4ERXA 4F84A 1ECCA 2Z3VA 4UE3S 1UIMA 3WAKA 1MOQA 4HYTA 4DLVA 2C4UA 4OA8A 1JQDA 1SVKA 1Z12A 2W58A 3AM3A 4UTOA 1ZNWA 5E1BA 1C3JA 2ZYRA 5CMLA 3N87A 1ECFA 2FPPA 5BVGB 5HF8A 3WHPA 2Y1OA 2X0NA 2ZYAA 3NANA 1SELA 1V7ZA 3I9KA 5LQSA 2C9YA 5JLAA 1W2HA 1TCCA 3OIYA 3SJBA 5ICCA 4JLWA 1SKQA 4R2KA 4BIMA 1BN6A 4LE0A 2G9NA 4C0LA 4JCOA 4QOIA 3U48A 4E6EA 3QG5A 2H11A 3E9QA 5IK2A 1A5ZA 2QE7A 3KNZA 4TXHA 5A6VA 4GHWA 2B30A 2FPWA 2PKRA 4PFKA 1UMDA 3ZS8A 2ZTMA 2G40A 1NXOA 5CK4A 3FCAA 4J1QA 5F5LA 2X8LA 1HZZC 1C1HA 4KAFA 3NHLA 4WASA 5FPPA 3SXUA 2D2IA 1FX0B 1KI3A 3B5EA 3C3MA 3QXHA 4G2NA 2PMDA 5CNIA 1BXGA 1GCAA 2O1EA 4BEWA 4L76A 2HWKA 3KL4A 3JCZA 5KB3A 4J7CA 3VNUA 4IUYA 1NF9A 2VPXA 3GX1A 3I3OA 4HH4A 1Y3AA 2O7SA 5DM70 2PKXA 3BKXA 5GAJA 4JJGA 4C20A 3DXYA 2FJPA 1EJ2A 4PG7A 5ADUS 1NI4A 4ZZIA 1D2RA 2FI1A 3H4IA 3O1JC 3WIEA 1T1SA 4MA5A 2BR4A 3T34A 5ES4B 4U7TB 5HKLA 1Z5ZA 3L46A 4LDZA 1W5FA 3CLTC 4CU2A 3PC8A 4BUCA 2XWQA 5LQAA 1OC4A 1T26A 2WWTA 4FI3F 3PNLA 2ENUA 4EL5A 3DPIA 5EPEA 3LSTA 2R5NA 1WDWB 3ZKWB 1NC1A 4TYPA 3KE8A 3W90A 2VP9A 4YMSA 1AK1A 1L3CA 1MU0A 5LBIA 2E55A 1FLAA 3GUVA 1E1LA 1XNQB 2W6PA 2OESA 3UK1A 4XIYA 2P2SA 3U4DA 5DI9A 2VL7A 3O9MA 1W34A 1IUKA 1O9HA 1UXJA 1O87A 1XJ5A 3DS8A 1R7RA 3G0OA 5DX0A 4AICA 2VWQA 4C3UA 5LSAA 1R74A 2H65A 1IN1A 5A0TA 5EJMA 3MJVA 3PR1A 4ZHQA 1YU6A 5E38A 1D5CA 1ZRNA 3LLSA 1NBMA 1P19A 1ICEA 3AF4A 4RSMA 3OEYA 3W6UA 3ZTYA 4Q47A 3ZVRA 1FFWA 1VKRA 2QLJA 1TC2A 4YROA 1AMUA 3DFKA 1BJKA 1XC7A 1ZMXA 4W7HA 5DBHX 4M6WA 3CYFA 3QU5A 3RYFA 5JBIA 4KRYA 3DWEX 1B6TA 4BNWA 5I7WA 2O1WA 2CNLA 3MJDA 2MINA 4J0EA 4Z9XA 4GL4A 4UPVA 3P7MA 5I7EA 1A2KC 3CIFA 4A0RA 3TZLA 3FPEA 3W7BA 1H69A 1ZJ4A 3C6XA 4I99A 4FFWA 4CQLA 4J2HA 5DI3A 3K1JA 2ATEA 2JGDB 3K0EA 1EUCA 3W2EA 5EY5B 4WA7A 3EFOA 4L78A 1FF9A 3ET4A 2VC2B 4PE5B 2Z5GA 3EIXA 4CM4B 2Z2IA 1QM5A 1DINA 3N0VA 2RGYA 2LDXA 2ORED 1NMXA 2ZYIA 5BWBA 3QIVA 3H0KA 2BMFA 2V7UA 3FUXA 2D7JA 3O1IC 5TMEA 2CXOA 4OJTA 3TDKA 3ZNNA 4CQJA 5IUJC 5JH7B 2D54A 5IK2D 3F49S 4FBGA 5EHQA 2GA8A 1A8IA 3KP1A 2ST1A 4CF5A 1CNFA 4V0KA 1NX6A 2E1RA 3M6AA 2QW0X 3MMSA 4EG7A 4FMCF 1M2WA 2AQHA 3LD9A 1XCLA 3W2HA 1JBEA 1D1SA 4LGVA 3FM9A 3H3JA 1P31A 4KG7A 1C9MA 1CHNA 4NCKA 1AQIA 3NTXA 3PK0A 2KLHA 2I2XB 3U39A 3A6FA 5J3JA 4AJPA 1M34B 1V16A 3ZU5A 5K8VA 4NAUA 5AKJA 3P4YA 4GZLA 3C74A 4GOOD 3ZLUA 1P44A 1RJ9A 4A9AA 2PR2A 1G59A 1NAHA 1MB2A 3ENWA 3DV0B 4G63A 4PSAA 2Z8XA 2XWBF 4HAIA 4MOWA 4NG4A 5JATA 3UGQA 1JG6A 5CYOA 2HNKA 5CVDA 2GN2A 3UV6A 3D4OA 2XQVA 3SYLA 2QTNA 3VPSA 2PNFA 2Q6TA 1Z7YA 2QW1A 5CVVA 3PQ2A 1NUPA 1B3BA 5D5QA 5DYNA 3ZXXA 3OIUA 4KXVA 4B6EA 9ATCA 4KU4A 3PTZA 2NQ8A 5K8LA 3VSDA 2C2MA 1IHPA 4TMKA 4PR0A 2QDKA 1PTKA 1B0PA 4ZPXA 1OYYA 2MWMA 4KFRA 3WGKA 3V8BA 1KE1A 4CCWA 4P3XA 5FPKA 3RVSA 3DONA 4QATA 2VNIA 3RE1A 1G8GA 2H5EA 3WR5A 4NV0A 1RCTE 2RHOA 4KO3S 2JFHA 4XCQA 1K86A 2C84A 5KTKA 3ADDA 2QI9C 1Y8AA 5BW4A 1KYVA 4NCAA 2FWRA 3E8SA 1J8DA 1J09A 1NVKA 1V45E 2C5EA 2Y76A 2ZR9A 2XZTA 1XZCA 2JGAA 1L4UA 3GRAA 4KR7A 1D4FA 4R5MA 2RSLA 1F6BA 1YZHA 3REQA 3NJ4A 5TEWA 3HR4A 3C98A 3MQ4A 1W73A 3PL5A 4DEVA 3KALA 4TV8A 4EA8A 5IEJA 4BAGA 2OAP1 4Q3DA 3EY9A 4IKOA 3CWQA 1KZ4A 4R9RA 4YJ3A 1T9GS 2IPAB 1UBLS 3G8BA 1AU9A 3ABSB 5EP4A 3VKHA 4UU7A 2P4SA 1H4VB 2BCJQ 4GUDA 5FO0A 3A1TA 3ZU4A 1UBTS 4LECA 1VPLA 2EZ4A 3D0OA 2WJPA 4P98A 1B6SA 2CKMA 3FAZA 1QYWA 2BFAA 1JI0A 3IGFA 2B34A 3N8NA 2WPDD 2O4CA 4MIYA 4LPSA 4M21A 1JIQA 5CB6A 3GJ7A 4JBWA 4C29A 1W9HA 5F5NA 4L3VA 5TPWA 4IJQA 5AESA 3ND5A 3VDQA 2VWGA 1HQDA 4JNCA 4EQ6A 1YVRA 1DI0A 3QX7A 4RE5A 3ZD8A 1BCSA 3IFSA 2RGGA 3O47A 2Z3ZA 4J3JA 5AKZA 2H31A 2PZLA 3T4XA 4CT0A 3WLEA 5GM2A 3OZFA 3EIHA 1K3FA 4YRJA 1QVRA 2FN7A 4I1VA 2EG9A 4XVQA 1Y8RB 4BJ5A 4ZYZA 2BFCA 2QLBA 5IJZA 1F2DA 1X1RA 1JHRA 2ZB4A 5LB4A 3I2IA 3E1KA 4PO9A 3VR6H 1L7AA 3AUFA 4P36A 3UMGA 2BKLA 1GNPA 2W2KA 2R7MA 4H7JA 1N8SA 1NN5A 5IN5A 2JGEA 1KA9H 1Y33E 3QWFA 2BSQA 1XDZA 4U2BA 1XTJA 3H97A 6LDHA 4LSGA 3LUPA 1WX1A 4X63A 4V0SA 1U0GA 5D7BA 5FO1A 4LNAA 2B92A 4MULA 5FTKA 4LF4B 2C5AA 3AP1A 4EYOA 1L4FA 1PR9A 5KJEA 3GLIA 2Q0XA 3T99A 3EMVA 2DLDA 3WDLA 1MAVA 1PS8A 1QTIA 4HLQB 3V7YA 3Q6NA 3B6JA 5JSZB 2IE0A 4IDOA 3K09C 4L4ZA 4PZAA 5EGSA 1SIUA 4MW6A 2N9UA 3ACBA 2JCYA 1JEJA 2DERA 4BZQA 4C06A 3STWA 1IZ7A 2YWEA 5TVKA 3FJ1A 1S3GA 4BNUA 1IY2A 3EQZA 4MV3A 4C4TA 1FU4A 3VPHA 1N78A 3Q3GE 2HPZA 2PUEA 4EYSA 5F33A 1KH1A 3L77A 5K03A 1NDHA 4KYTA 1U8EA 2GOYA 3CKMA 3T52A 4OXKA 1K2VN 1T8YA 2I6GA 4LMRA 1N5DA 1YDHA 2GNOA 1GR0A 2K2WA 1D4AA 5FV7A 1NXTA 4ZCRA 3FPGA 1M8KA 3IAFA 4DG5A 5JDCA 1YB2A 4YNBA 4P6VF 2P65A 5UKDA 5JROA 3OQJA 1E2JA 3BJRA 3ITEA 1E8NA 2ZEJA 4TTAA 4JOCA 1WU8A 2DZDA 4Q7LA 4Y7CA 1CDDA 5AMXA 3MQFA 4KOEC 4BRUA 2FZEA 4D6YA 4PFJA 2PQ2A 3I09A 2IHUA 2OLEA 3OPMA 3WLKX 1JPUA 1DCFA 2IP1A 3HVHA 1JHDA 1RRGA 2QQ0A 3BD9A 1U0FA 2P69A 5K3FA 3UH0A 3PA6A 3ZGYA 2RGRA 1M74A 2ZDGA 3IMGA 2B4AA 2AWNA 2BRUC 2HJVA 2I5PO 2VATA 3N75A 4RM3A 5ALDA 5EZYB 5EMMA 5KQLA 2B5VA 5C31A 2FMHA 4PSKA 2IA5A 1ZGGA 2J46A 4KK3A 5FI3A 3GQBB 2BBTA 4YRDA 4R71A 4NFYA 4Y2TA 4TZ6A 3MBKA 4X71A 5E6SB 1NATA 1U8TA 5DTMA 4EJSA 1HDIA 2YUIA 1XQWA 3B36A 4WCDA 3HYRA 4XYLA 4A1FA 4GKVA 1RBQA 1Z17A 2DPMA 4H4DA 1JSLA 5TQ0B 1W44A 2HJSA 3WADA 1JJ7A 3VX3A 5CCXA 3K70D 3L4KA 4Q4AB 3MERA 3FUWA 2ZTHA 4TMXA 3TRIA 3UV7A 1LNQA 2B1IA 2QIOA 3T8YA 4YXFA 1V3QE 5AW6A 4JI2B 2PQ0A 1ZIOA 2AG0A 1L5QA 2F64A 5AI5A 1P2VA 4FT4A 4ZYUA 2WJ3A 1D09A 3DV9A 3KYDA 4JOBA 4X3OA 5IHPA 3TQFA 5EIBD 2CN1A 4WKOA 2ZULA 1KDZA 4PRKA 4OQEA 4I4TF 2QAGC 4JUBA 1JR6A 3D3KA 5DHQA 1D6NA 1JHYA 3FYUA 1YFLA 3RANA 3CLSC 3DE7X 4XCXA 3RSLA 1PT5A 4JYAB 1A4UA 4M0PA 3QPUA 3A58B 3O8CA 3K0FB 5CLQA 1R0KA 4XLZA 4I55A 3HKEA 2UVQA 5FPYA 3R0VA 2F1RA 1L4KA 1KYQA 4Q24A 3N2LA 4EABA 3WYFA 1YS9A 3H04A 3N2KB 5ETJA 2R6R1 1K68A 3AUJB 1GU0A 2O3QA 4W5RA 5CFQA 2GTPA 1AUVA 2HX1A 2QQFA 4O59O 3Q5DA 2XRMA 3F4LA 4KIFA 4ZCTA 1AQLA 1MA3A 4DM3A 1AS3A 1OHHA 4YV2A 3ZWQA 1A9TA 3AQIA 1EUYA 2XCOA 4JA2A 5ISMA 3AUSA 1EX1A 1JZQA 3UANA 2V0GA 3PIIA 3DO6A 1N5IA 3O8QB 4FDAA 4ZQCB 2DUUA 5CLGA 1ZH8A 3U1VA 1JSXA 5BMVB 3HA7A 5D85A 4YN3A 1WZEA 4XVRA 4RXUA 5IKEA 4I1YA 4YALA 2ZJYA 1B8NA 2GCGA 3TJZA 5FAKA 4OXIA 4LF7B 2HA2A 4QJBA 2DBZA 2HMWA 3JAMA 1VECA 3TXYA 2C61A 4H1UA 4RSGA 3DNFA 1HFKA 1S7CA 5LA6F 2RHTA 3L7JA 4JSYA 3WL3A 5JSYA 3FRHA 4Q4JA 4PCLA 5JY1A 1EDEA 4CUKA 3AVQA 3L8MA 4PHCA 2IKQA 3VAZA 3CVJA 2C78A 1NVWQ 3H3FA 1U63A 2AA3A 3DGFC 2F3TA 5DFAA 3ZI4A 2CL0X 3W3AH 4B5KA 4KMRA 4QGBA 2DFLA 5KNBD 2R48A 5HXAA 5G3ZA 3ZLBA 2ZRGA 3QLEA 3NFRA 2YZGA 2CLKB 3PYXA 3DE6X 2PUWA 2BEJA 1V4BA 2AYXA 1QGZA 2CLSA 1R50A 4GE0A 4HHEA 1NOKA 4QA9A 1DBVO 2P91A 1GPBA 3B13B 2ZE5A 2FGKA 5CJ2A 1Q7CA 3HCEA 2NUPB 3QENA 4FHFA 5B6JA 4QAQA 5ER9A 4IJ5A 4LRYA 5LNK1 4P7KA 3ACDA 5GIPE 3G17A 1EX6A 2GB4A 2XVYA 5CB4B 3GEEA 3FZNA 4HWPA 1KSFX 2P6PA 4G86A 2J6IA 4LVUA 4ZTBA 2OSBA 1R37A 3P2MA 1GUBA 1ZL0A 4MQUA 2QTHA 4GF5A 4AZVA 1ZUNA 4CMIB 4MX8A 3RAEC 3R3WA 1H2YA 1BFUA 4GLFA 2K6GA 1AN0A 3DP9A 4U4AA 4BEJA 5EJFA 1FW6A 2VHQA 4IJ6A 1ACJA 5B3AA 2ZPTX 3DVLA 1R6DA 1USVA 4Z9FA 4RDIA 1NVVQ 3OZVA 5IMBA 1E1CB 2O8EA 2EBUA 3ITKA 1K8XB 1B0AA 1F2VA 1WMEA 3AG6A 4I08A 4FFNA 5IDYA 1FRFS 1Z3IX 1JUDA 4GNRA 3W5VA 4CMBA 3KLPX 2Q9BA 4NBUA 2YVAA 5EPUA 3ZDBA 2BGLA 4Z8XA 5KNLA 1FE8A 4HL6A 4FYPA 5LYYA 2P27A 3H83A 3JQ7B 5LZ7A 4BGUA 3SN6A 3L01A 2COEA 4CHGA 2ODEA 1R4MA 4GG1A 3KXKA 3DP7A 2NO7A 4J90A 2VEDA 3KR2A 3SDZA 3VQTA 4R3UC 1IBRA 1EXDA 1EWRA 2AXEA 4KJZA 4KR0A 4XPIB 5GPBA 1H8EA 4B71A 821PA 3UYKA 4DR3B 1HEYA 1AIPA 1IAVA 5B1SA 4FFDA 4K9SA 3F7NA 3KQLA 4E33A 3MIZA 1FJ2A 3H87A 1WUTA 4J0FA 1FFDA 3NWEA 3HGTA 4AFNA 1JXMA 3I5AA 3QBEA 3QRWA 2GTHA 1CF4A 4ZZ1A 2I2WA 3ZE7A 2UYOA 3WGOA 1G8KA 2DQZA 2VT7A 4R7GA 5K6RA 3WGLA 1Z6TA 5HSGA 2BZSA 4C6TB 3IELA 1FDOA 1AGNA 2EHJA 2XYHA 1IIRA 1E99A 3EWAA 3LTEA 4IBOA 4BTEA 2GEKA 3H9QA 4IGIA 3UKJA 1MQ9A 3V8QA 2XCUA 4GOKA 4RDXA 2CVFA 3RB8A 3Q1KA 1ISMA 4DA6A 5ER6A 3PC6A 4JQOA 1JQBA 4Q4JB 4WUVA 4BNJA 2LV8A 2NU6A 1Z4MA 1PN3A 2F9MA 3GAFA 3QA3E 4FYMA 4HNTA 5LZ2A 1G2IA 1UODA 2XGGA 5B37A 2ZXEA 3MAJA 2OL4A 3GVHA 4L8FA 3E9ZA 4OSOA 2CF6A 4J16C 4U8GA 2XX3A 1KJYA 4INZA 2R25B 2IYTA 4JENA 3BT7A 3F9IA 5GVRA 4MP6A 1ZUIA 5BMVA 1UIRA 1Z33A 1MNAA 2PXAA 3JR7A 4NXMB 4LEIA 4TL7A 5BMOA 1SKMA 3EVCA 3KEQA 3O8QA 1H65A 1M2HA 3TZQA 4F5WA 2HUPA 5JCZA 2AXNA 2ZRNA 3EGDB 3GEBA 4KL8S 2I2CA 3M6VA 1Y8RA 5JD3A 2I3DA 4FE3A 4Z9YA 1PG5A 3O9VA 4M0CA 1LQUA 4BGDA 4V3CA 1PZXA 1POXA 2F7SA 1GZDA 4YLEA 1W7AA 3ERCA 4L50A 1K5PA 2RE8A 1JLRA 1XK6A 4MS1A 3O3NB 5M3BA 4KFTA 5ITWA 4GKJB 2CVHA 4F2GA 4DBZA 2B82A 3NYIA 4B34A 5NLLA 1YR3A 4LYFA 1I32A 3FOFC 4RZQA 3QGMA 3CEPB 2DFNA 1NV9A 2E4VA 5AQ1A 2JFZA 3KWJA 2HGZA 1PQYA 4A36A 2OV4A 1T9HA 2H1VA 1OFUX 2X86A 3AVOA 4J6EA 5FOQA 5KOHA 4RULA 1OXKB 4U2CA 1RXVA 3KR9A 2WW8A 3DF7A 1K3TA 3ZE1B 1BG6A 2IUYA 3F67A 4YMUA 4Z53A 2A0FA 2BELA 3EMDA 3ORFA 4J1TA 3OPYI 3TBKA 3M7IA 4TYNA 1F9EA 1QB8A 4AJOA 3PFHA 3TX6A 3R9WA 1BWSA 1EKXA 2GF9A 1HYBA 1V1MA 3DHNA 3KWFA 3MW8A 2QUKA 4EHHA 2IYSA 3AY0A 2YFYA 2FLWA 2CC2A 2A5GA 2Q46A 2BI7A 3MILA 1Z4NA 4D4IA 4EEZA 3W06A 3OD1A 4C4RA 2NXWA 3EMKA 3JQFC 5BWLA 1NF2A 2ISSD 5IYZA 3EXFA 5KSYA 1T4CB 1NFQA 3R9XB 2ZETA 4Z51A 2VEOA 1M8JA 1Q0RA 2L42A 3I2HA 3S1AA 3T3NA 4HNSA 5IARA 1UK8A 1TQHA 3VYVA 5L45A 2RG7A 2OZEA 3QLVA 4KFSA 3I83A 1MUUA 4RPHA 4Z1MA 2ZBRA 3FWKA 4B40A 2QAJA 4R2HA 2YS7A 3TK1A 1P0QA 4N0QA 3H5OA 3NM5A 4P1ZA 3H2BA 4LKRA 1RI5A 3VPFA 3DLBA 4QYXA 1K6EA 1L4BA 1F3LA 4GPBA 3UT0A 5HK9A 3VNQA 2VP6A 4ETMA 4KSYA 4BXOB 1NW9B 1Q3TA 3C7AA 1PRYA 4DAOA 2FFBA 4EGCB 4Z7QB 5IM4F 5H59A 3A9SA 3JVUA 3BXEA 1I6MA 4YJHA 2C7VA 2I4RA 1RXEA 3C5VA 1ZK4A 3E2PA 2QSUA 3I52A 4A8JA 3S40A 3N76A 4QBTA 1ZM7A 3S2IA 4DQVA 5IC4A 5CDHA 1IN8A 1PG2A 2QZ9A 3NATA 5ALUA 4CVNA 1U0SY 3CX8A 1GA6A 3M81A 7REQA 1FFXA 1P4GA 2CMHA 1Y1KE 4NCNA 2JD1A 4K7JA 1ZA1A 4CFYA 1DB3A 5JCJD 1QF6A 2CCJA 4RIHA 1L4MA 3M0EA 4X24A 1V1MB 2WYUA 1RPAA 2W43A 4MGIR 2X6RA 5GONA 4M76B 3LT1A 1B0ZA 1TOAA 1UAGA 2PD4A 4JLVA 5DGCA 5TPZD 4GBJA 5FWNA 2RH8A 4GMHA 5K5EA 4EJFA 2D1FA 2C77A 3C15C 4TTQA 4Z0NA 4C21A 4ZI2A 3WWCA 1J2UA 5TRTA 3SM3A 4CM4A 4PY2A 4O2AA 3SZ3A 3FFBA 3IILA 3WKEA 5DI3B 1G19A 1VJ0A 2WKQA 1JA1A 4LISA 4R01A 3SSOA 1CIPA 1X77A 2YIJA 5AM3A 1V6AA 2F67A 3C6MA 5E9JA 1TYBE 3FWYA 5JADA 3SF0A 4A8TA 4C76A 3FYCA 4J76A 2UUBB 4IIJB 2GM3A 3JZAA 3ZK7A 5LP6B 5IKPA 1B2RA 1BKYA 2QZJA 1Z0DA 1Z83A 4ACAA 5JNLA 2B5OA 5GJWC 2HXGA 2RAPA 5KC9A 1Q6ZA 1EB8A 1JWBB 5CT8A 2X6TA 4B2PA 3DXFA 4MRAA 2W2KB 3RTEA 3AB3A 3OICA 4E88A 1CZRA 1P77A 1M2VA 3JQGA 5B12A 1Q2UA 1XSEA 4NYJR 5DGDA 4WPGA 4XJXA 2B99A 3BMQB 1KPGA 2VN8A 4IDGA 2IJGX 3MJ4A 2CMKA 5JD6A 3P52A 3DCIA 3TB6A 1XR3A 4BU1A 1PJTA 1MORA 5E4TA 1T8RA 1Y9JA 2WWFA 5AQEA 4DPMA 1MH1A 2R00C 4F5DA 3OUUA 4OMDA 3TOSA 4YXWD 1CUDA 4X44A 3U44B 4G0YA 3T1VA 2DWCA 3V6LA 1VIAA 2B36A 1ZRHA 1QANA 1C0IA 1K6XA 1Y6ZA 2G72A 2I78A 1ORHA 3KOOA 3PITA 5KVAA 1JDNA 1T9DA 1T4MA 4YCDA 5HMLA 1Y8QA 1KYZA 2MSWA 3KFXA 2F3QA 4OI0A 1O5IA 2JI4A 2FQQA 2G25A 2QT0A 2XNKA 3K72B 4U5XA 2Z9CA 3DL0A 3D43A 4OV6B 4W1RA 3ZIUA 2KM1A 1B1CA 2IHZA 2JIBA 3ZLJA 1DWPA 1CQXA 2RMKA 2VF2A 1Z6ZA 1EZ4A 2XVAA 3P4UA 4ZOCA 2W70A 1SRRA 1USUA 3RIYA 1EEHA 1QWOA 5FOTA 2G5PA 5TVGA 4W6QA 4YS6A 1ZINA 4OHZA 1XDWA 2O06A 1PWXA 1Z06A 2REQA 1H1TA 3DAPA 3FKJA 4H16A 4Q39A 3ICCA 4UUAA 1HE1C 3TUZC 4WZAB 4KPYA 4MI1A 3L1HA 2GR9A 1F0NA 1LVHA 2OK8A 1YQWA 2VHZA 1K8RA 3FNEA 3PEUA 2IS1A 1EFCA 5L3VA 1LZKA 1FYFA 2B25A 2CKDA 2ZI6A 4KE9A 3T9FA 3T7EA 3I2KA 4OH7A 1JB9A 1QQ5A 1PU2A 3DJYA 3LXXA 1DX4A 3IBCA 4GPD1 4L27A 1S2OA 4YR9A 4MVJM 4ZODA 5B4TA 1G7CA 1NTOA 1UBCA 2AOWA 2KI5A 3DMYA 3FWPA 3DBLB 5TMDA 5CH8A 5LCXA 3AF2A 2J85A 3WLLA 4TS3A 3QPDA 1GNQA 4WNAA 4XE5A 1JECA 4F21A 4BMOB 2NTJA 1HM5A 1NM5C 2ZKLA 3MJSA 3CLHA 2L2QA 2BDEA 1HC7A 3LCCA 4DC0A 4QXRA 2XDQA 5ALWA 3PX7A 5TE9A 4ZYLA 3GW8A 1T9BA 4JKIA 2O7QA 3A1UA 1JIVA 4CQMD 4CG2A 1T2FA 4XI9A 4G1BA 1ZXLA 3ZHCA 4HB4A 3K5PA 4W9MC 2O7RA 3LA6A 1V8PA 3SI7A 3QE2A 1ARZA 1E3SA 2OZPA 5CDFA 4V1CA 2OK7A 4G9GA 4UVIA 3NO4A 2FPPB 2PVSA 5BVGA 3A27A 3NYRA 5AK3A 2IV3A 5C1BA 3KU4A 3OEWA 3UOWA 3LUJA 1GGKA 1W93A 5KSPA 2OZLB 5C7LO 1KPHA 4EARA 3GRRA 3UXEA 1IEWA 2HK8A 3IUSA 5C5CA 3DLHA 3AEQB 4LFAB 4F92B 2E4YA 3DFFA 5DDIP 4D4GA 1CY2A 1U3GA 4CUZA 2AKYA 4WK0B 3DEAA 4ZARA 2Y68A 1AGXA 2BJVA 4MO9A 2BGKA 1T3GA 1ZBQA 4TLBA 2B4TO 2NUPA 1SXJC 2VSYA 4UEQA 5ILQA 5EJ2A 2JH8A 5A9SB 1G8HA 4F9FA 4WCVA 4ASUA 2EBFX 3QF7A 2O2CA 1L7NA 3HYCA 5DK6A 5G0UA 3UXMA 4J0QA 3GHYA 4CDGA 5B55A 1DSSG 1YXMA 5C9ZA 3AU9A 2Q6VA 2FN9A 3TSAA 2EP5A 3F78A 2AQIA 3FPCA 3VDXA 1BCRA 1OT5A 3E48A 4LSMA 3UCFA 3X43A 1GN8A 3GUZA 3I92A 2MSKA 3GV0A 3BSWA 4KAJA 3VDRA 1KJWA 5EKDA 2IVZA 2VS1A 3EOAI 3KU1A 1LY1A 5AM1A 4EPYA 5AXBA 1GQRA 4IF6A 5AM0A 1Q95A 4RGYA 4B33A 2Q0QA 3FWZA 2X9VA 3I6IA 2NW6A 4XCVA 5KWSA 3P2JA 1DKQA 3GJYA 5BN5B 4FU0A 3LTNC 2YRXA 1OSNA 4V38A 1PVVA 2FYTA 3NX4A 5JVDF 2O2EA 3SR3A 2JD2A 2OFPA 2Z9DA 2YWFA 3CF0A 3D81A 3EA0A 1AUPA 3H2KA 3D6AA 2ZREA 3H5LA 3KZCA 2HXSA 4R9UC 4YA6A 4ZQGA 2C7OA 1SOVA 3MMZA 3TLYA 3ZOKA 4EP1A 2YMMA 5E6UB 2DKFA 3QVVA 3AJEA 1UOEA 3VTZA 1R0XA 1ZH6A 3ILYA 3WMRA 3PXXA 2H0QA 3FKSD 4OXNA 3A3KA 5DP2A 3V3TA 1L7OA 4NYMR 2A4KA 4LJ8A 4B6SA 1EP2B 1J4AA 2BTOA 1WU7A 2R6ZA 3AJ8A 3G79A 3HL4A 3GYBA 3D3EA 4DMMA 1ORVA 5IHXA 2H1LA 3CRQA 1VHLA 2C3MA 3EPRA 5A6SB 3VYRB 4RKRA 1SXJB 2C3PA 1QKJA 5MDHA 4DB4A 1AKMA 2D13A 2QN9A 3CW9A 4BAUA 4BVJA 1LWNA 3AZQA 2J07A 3SOZA 4X5OA 5A4MS 1EA7A 4Q66C 1IY1A 2WJWA 4ALJA 3DVRX 3EVZA 2ZRJA 3K9NA 2P7HA 3LL7A 3ZTTA 3U0VA 4N03A 1O94A 1KMHA 4YV0A 2ZJBA 2PT6A 4IXNA 1U98A 3HPRA 3AFHA 1E5QA 2PY6A 5HFAA 3TZBA 4YYEA 5KNDD 2X4DA 4OHYA 3S7TA 3U16A 5IT0A 4FHGA 3R40A 1LPAB 1GRQA 4KYIB 5DN9A 1N2GA 2QTTA 4AWAA 5KHOC 3OQVA 4WXRA 2G4VA 2WHPB 1YO6A 1YAJA 1HZZA 3WXBA 1SCDA 4IHAA 1ODLA 4G5SA 1QGDA 2BUCA 2VK2A 4O08A 4DIBA 3IB6A 5BSEA 1M8GA 4YRLA 4YUWA 1RZVA 3RUFA 1ZW6A 1EHYA 4JDPA 5MF6A 4C2AA 3I58A 4IQ0A 4X00A 4B7XA 1XMSA 5G0WA 1F4VA 1PK7A 2QN7A 3KKEA 3FDZA 1RPNA 1B8UA 2XGSA 3WRWA 3RG8A 2OP0A 2VPPA 4TL9A 3TSYA 3WSWA 1PX2A 3M1AA 5KHAA 3I2GA 3VZQA 3P9YA 3MD0A 3NBYC 5CVEA 1ZAYA 1C9EA 1PDVA 1K8YB 1W6UA 3I01A 5LZ5A 3B6ZA 1Z7EA 3DE5X 1QBKC 3C24A 3IHLA 3MN1A 1W19A 5EE0A 3FIJA 4MUNA 4D5GA 4UM9D 2V0NA 5K3FB 4X90A 1UT5A 1QS0A 4PQYA 3ZGLA 3OOHA 1B16A 2CF5A 2JFVA 4PIPA 3VR5A 4N3GA 1TUBA 1P9RA 3ACCA 1PJQA 1E3JA 5J5AA 2JGFA 2CLOB 2IYZA 2R8EA 4KYUA 3B12A 5F73A 1S8AA 1L4HA 2HHLA 3IV6A 2WG2A 1BXZA 1JEQB 1R2QA 1KFKB 4C3VA 4ENQA 1S9HA 2D74A 2BSXA 4AIRA 1N6OA 1T1JA 4P22A 4PG5A 3ZGNA 2B3DA 1CY7A 1YDWA 4OM7A 3U4AA 1QGUA 3F6YA 4K3VA 1E2LA 1SC6A 3JQAB 1EVYA 2VNHA 1O0BA 3HLKA 3FMVA 1IOZA 2AHOA 2B0JA 2HREA 4R8SA 2XLCA 4DLZA 5CA0A 1N1MA 2CLMB 2OY0A 3D8BA 4MCAA 1PV2A 3RS5A 1CUYA 5LQCA 1YU9A 1GJRA 3BWDD 2W2XA 4HX5A 3EH1A 1U02A 3LRPA 4QXQA 1WZIA 5A9RA 1S3IA 1VKOA 2HIGA 2ATXA 4OUDA 2VYVD 4V2IA 3Q3JB 4Y1GA 5HE8A 3U49A 3TGWA 4BEBA 1HQKA 1Z5UA 1D8TA 1WMAA 2OGTA 2AS0A 4GVPA 5K4GA 3MWDA 1T6BY 3HJGA 2WDPA 3AI7A 4M7OA 2FEXA 5ABPA 3NRCA 2O2HA 1FNBA 3DKRA 3KHUA 5T6MA 4BFZA 4L22A 2G1PA 4G0MA 2DCUA 2EFDB 1NW8A 1E3QA 1RXUA 2CNOA 2OD7A 2HWWA 2ZYVX 2FB9A 3KD3A 4L4RA 3CUKA 5DF1A 1F1JA 3MG9A 1N0UA 4NJMA 2YWGA 3W5CA 5AKXA 1ZGAA 1QRDA 4XB6B 3P9IA 3KZMA 4IF4A 1X38A 2PIAA 3OE1A 5FUYA 3R20A 4G8CA 1E2GA 1WTCA 1TT5A 1C8LA 1E6LA 1TE2A 1UDWA 2B83A 2J5RA 5LA6A 3W4IA 2IZ0A 4I6EA 4LDAA 2P1DA 2NT4A 2YNMD 3BXOA 4MNTA 1Y3DE 5KSOA 4XRRA 1D0VA 1FDUA 1ZK2A 3M3PA 1X8XA 4GBED 4KXNA 2KB0A 5CM9C 5FUWA 4PAGA 3R7AA 4BKRA 3B2EA 5B53A 3C4VA 4KLNA 5D1HA 3SNHA 2DH5A 5JYDA 4RTKA 4MRPA 3MUFA 1L5VA 1VCOA 2EF1A 3PFIA 5BW5A 3ESDA 1W1IA 3UHAA 5AD1A 2Q62A 4ITUA 1I4DD 5CT4A 1F60A 1P17A 4FC6A 3PBKA 5IW8A 3S5JA 1I6WA 4ZT4A 2C96A 2O5CA 3T15A 3EIUA 3NGMA 5FEMA 2H63A 2Y1CA 4HDSB 1GIAA 3QY0A 3H2GA 2GKOA 3GJ0A 4TV8B 5M7EA 5LYJF 2C1ZA 3PXAA 1M1XB 4HLUA 1FSGA 1PZMA 1ZU5A 4U39A 3VGPA 4BQEA 4OYYA 4ZCIA 1W4CA 3ANYB 4YVFA 3QX3A 3LCUA 3L84A 2PX6A 3VRHA 1R4NA 3EZLA 4JVLA 2QM7A 4HNVA 1ID8A 4J43A 4IIHA 2JAXA 3M4JA 3GGDA 1LF5A 1ZOOA 1II9A 2RGWA 3FLMA 1ZNYA 3IQEA 1INLA 3LOUA 3OY7A 3SHWA 1AQUA 3UJ3X 1ZK3A 2ORYA 2W8ZA 2YZKA 3AUXA 1IOVA 1SUAA 4CE6A 1LBTA 2AX3A 3KJEA 3FYHA 3ST7A 3TIGA 5ALVA 3RRYA 4MV4A 1TU0A 5LQDA 3CZCA 3KRTA 1CCWA 3LM8A 4QPDA 5I9SA 5HR5A 2HDNB 3G2JA 4I4TA 4DY6A 3WK4A 1TD9A 4EUFA 4LNUA 4BVFA 2QRVB 3UN1A 1MO3A 4UW9A 4MWEA 1X80A 1ZHFA 3QNUA 4QHTA 3T0GA 1XZKA 2WHEA 4KZPA 3PTLA 4KLAA 1EZ1A 4MITA 3CPEA 3Q9SA 2QVYX 2IZ1A 4BP1A 2Q9UA 3ZWNA 2BISA 2EJTA 3B9RA 4JBNA 1X8KA 2B2XA 4O4IB 3O2JA 1G4HA 1JAIA 4XLTA 3SX2A 5BSHA 1LTKA 2I9PA 1K98A 1RXYA 2DECA 3SKVA 1DBWA 1ZWLA 2XBLA 3MRVA 1J06A 3ZDYB 2GCEA 4GGMX 1MIOA 4L72A 5JLJA 4ZVUA 3IT1A 4BKMA 2V7WA 3D31A 3AK4A 3K8OE 4W5TA 3LUAA 4UM5A 1E9AA 4MUIA 4AVYA 3UATA 4B82A 2AEMA 1VI6A 4QT0A 3KB8A 3A0UA 4XA8A 1EQUA 2HOQA 2A0WA 4TVBA 4JHXA 1KWKA 3HM2A 5AM5A 5CYFA 1V3UA 3OEHA 3CH7A 3DL2A 3LF1A 4G5XA 2ZFUA 3HZOA 4OBEA 3EARA 2P78A 1VHQA 2W2OA 4XXHA 3A1WA 3BC1A 3CZRA 4ZV9A 3DE2X 1QFZA 2QENA 2IOHA 2IE8A 3E1SA 3N8DA 5KTOA 4Y6QA 3MTIA 4DR6B 4KNVA 3BTOA 4P4LA 1O5OA 3VSEA 3JQ9C 4RACA 4F85A