4LQYA

Crystal structure of human enpp4 with amp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 127
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lqyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lqyA01
1SHQA 4KJDA 1E3CP 3BDGB 4UPKA 3A52A 3IGYB 2W5TA 4GTZA 3NKOA 1K7HA 1ALHA 4CXKA 2W5XA 3OT9A 4ZG6A 3NVLA 4LQYA 5C66A 4ZGAA 3MK2A 3M8WA 4LRCA 1EJJA 4KAVA 1O98A 3IDDA 1KHLA 3BDGA 3T02A 1E33P 1KH7A 3WAWA 1ZEBA 5IJSA 1ANJA 3UN2A 1EW2A 3T00A 1ANIA 1EW8A 4KM4A 3TG0A 1URBA 4LR9A 4MY4A 3NKQA 3UNYA 1E1ZP 1ALKA 5L0BA 2QZUA 1B8JA 3SZYA 1KH9A 3NKPA 5LRMA 4YR1A 5LIAA 1EQJA 5IJQA 4UPLA 1ALJA 4LR7A 3MK0A 3BDHA 2W8DA 3WAXA 5EGHA 4KAYA 3WAYA 3SZZA 3TX0A 3DYCA 3TWZA 3BDFA 5LRNA 4CYSA 1ZEFA 4LREA 2D1GA 4UORA 5HRTA 1AJAA 5K4PA 5LQQA 4NWXA 1KHJA 2ANHA 1KH4A 2W5WA 4TN0A 3M8ZA 2GSUA 2W5VA 2IFYA 3B5QA 4UPHA 1P49A 1ELYA 1AJCA 2GSNA 5DLWA 4GTWA 4UOPA 3ED4A 2ZKTA 4LR2A 2W5RA 3MK1A 4ZG7A 4FDIA 2X98A 5INHA 2IUCA 1ELXA 4FDJA 1ELZA 1HDHA 4LR8A 4UPIA 3WAVA 4N7TA 2RH6A 3CMRA 3T01A 3LXQA 1KH5A 5L0KA 2IUCB 3M8YA 1KHKA 3WBHA 5DLVA 1ALIA 1Y6VA 2XR9A 4LRAA 2GSOA 2VQRA 3E2DA 4GTYA 4MIVA 5KXAA 4B56A 1HQAA 5GRRA 1ED9A 4LRBA 1AJBA 3UO0A 1HJKA 2GLQA 3M7VA 4MHXA 4QAXA 5EGEA 2G9YA 3Q3QA 4LRDA 1AUKA 1URAA 3UN3A 5AJ9A 2XRGA 1E2SP 3KD8A 1O99A 2W8SA 4KJGA 2W5SA 1KHNA 3UN5A 4UOOA 1AJDA 3NKMA 1FSUA 5L0EA 1N2KA 4CXUA 3IGZB 4GTXA 2GA3A 1EI6A 3DPCA 5DLTA 4CXSA 1EW9A 1ED8A 3NKRA 1SHNA 2W5QA 4CYRA 4NWJA 1Y7AA 1N2LA 1ZEDA 5GOVA 4ZG9A 3NKNA 5TJ3A 4LRFA
chains in the Genus database with same CATH superfamily
1TWFK 5M3FK 5CJ9A 3QX3A 2A68A 4GTZA 4GTCA 4PABA 4GT9A 2XCOA 4FZBA 4A3GK 4GZYA 4A93C 2PA8L 3M8WA 4BLAA 4A3MC 1EJJA 4KAVA 3IDDA 3BDGA 1ANJA 4YFXA 1EW2A 3T00A 3TG0A 5L0BA 2B63A 2NVYC 2GAHC 1B8JA 4YR1A 1EQJA 2E2JK 2JA6C 3S2HC 4LR7A 3A8KA 3GIRA 3OEPA 4Y52C 4G7ZA 4P9SA 4KAYA 2PHCB 3GTLC 2R92A 3GTJC 3TWZA 3BDFA 1UV7A 1J6XA 2Y0SD 1F7UA 5LQQA 4NWXA 3S17K 5C44K 1TWAK 2W5WA 3GSIA 3JSTA 3TFHA 1YNJA 3S17C 4MEYA 4GTWA 4LR2A 2W5RA 4ZG7A 2E2HK 3S1MC 1C0AA 2X98A 3HOZC 4FDJA 4A3KC 1BS2A 4DDQA 4A3DK 4KM9A 4N7TA 2WAQL 4A3EC 4GTLA 2JA8C 1KH5A 1PJ5A 3M8YA 1TWFA 3S0XA 4G0UA 3S1NK 5DLVA 2A6HA 3FOEA 3HOVK 5HL8A 1BDFA 5GRRA 1J98A 3H0GK 3GTGC 3GTPA 2NVXK 1TWHK 4C2MK 3CQZK 2B63C 4KDDA 3FKIA 1I50A 2ZUFA 3I4MK 3DXJA 3H0GC 5IYDC 3GTGK 1IW7A 1XZQA 4KAWX 1AUKA 2JH3A 2NVQC 3HKZD 5FLMK 2KWAA 5C3EC 1RU0A 3KD8A 3A8IA 4YFNA 1O99A 1O2AA 5IOSA 4RMFA 1INNA 4UOOA 5TMFA 5TMCA 3IGZB 3N3YA 4A3FK 4A3BK 1O26A 3S1RC 1TWCK 4GTFA 5C4JC 4CYRA 1WORA 3AQPA 5GOVA 2A69A 4BBRC 1SHQA 3GDZA 2VUMC 3BDGB 4UPKA 3IGYB 4A3CC 2W5TA 4BBRK 3GEEA 4GFQA 1K7HA 5C4XC 4ZG6A 3OT9A 4LQYA 5C66A 4KASA 3PO3C 5C4XK 4AH6A 3LAJA 2ZUEA 5M3MK 4BY7C 1IQ0A 3L4KA 2P5MA 3VA7A 1WCMC 2D6FC 2E2HC 1ZEBA 3WAWA 4OIRA 1WQHA 5JVOA 4M1XA 5IJSA 3AD7C 3I4NC 4KB4A 3AD8C 1EW8A 4LR9A 3UNYA 4MY4A 1ALKA 2PMZD 2WAQD 4C3HK 1K83K 5D4DA 4OINA 4A3DC 4WILA 5FLMC 3V4GA 3GTKC 1DCOA 1V5VA 4XCHA 2JA6K 3GTOK 1JOEA 1KQ4A 1SFOK 1B4AA 2PPBA 3HOXK 4KC6A 3EQLA 5EGHA 2R93A 4NOIA 4KMHA 4KMDA 1F7VA 1BGWA 1TWGC 2YU9A 3GTQK 4CYSA 1TWCC 4UORA 5K4PA 3GTQC 2JA5A 1KHJA 1WSRA 2ANHA 4TN0A 1Y1WA 1TWAC 2GSUA 2NVQK 4UPHA 1ZVUA 3FKIK 5CHPA 1P49A 4KN4A 4LK0A 3S14K 3LPXA 4UOPA 5IP9C 2ZKTA 3GTLK 3M3YK 3S16K 5INHA 2O5JA 1O25A 3S16C 1ELZA 4LR8A 4A3KK 1Y1VK 1GE9A 1JQWA 4G0WA 3CMRA 3L4JA 5M5XK 3ADAC 1K83C 4KARA 2IUCB 5L0KA 2E2JC 1ZQ1C 2Y3PA 3WBHA 4XSXA 1XZQB 2R92C 1O2FB 3GTLA 4LRAA 3E2DA 1EFWA 4B56A 3HOYC 2E2HA 4A3FC 4A3BC 1YX2A 1AJBA 1IE0A 3PO3K 4X6AC 4BY7K 2NVXC 2JA8K 4MHXA 3GTJA 2W7VA 4A3EK 2G9YA 2JA5K 4LRDA 1EQRA 5IP7C 3GTMK 3UN3A 2JA5C 3GTQA 2XRGA 3A8JA 1IL2A 4C3HC 3HOVC 1PJ7A 2R93K 3G4CA 2PA8D 1KHNA 3UN5A 1AJDA 2JA6A 1I6VA 1VGXA 4XLNA 1TWGA 2YU9C 4GTXA 3DPCA 4CXSA 1SFOC 1EW9A 4C45A 1K83A 3HXAA 3NKRA 4C3JC 1DD5A 1SHNA 4Q5SA 1Y7AA 1E3CP 3GTKK 3A52A 4GTDA 3CAGA 3NKOA 4CXKA 3GTOC 3ERED 3NVLA 3WODA 4BKWA 3S1NC 4ZGAA 3MK2A 3FKIC 4QJVA 3S1RK 4QJVB 1KHLA 1E33P 4OIOA 1KH7A 2Y0SL 3UN2A 1J6VA 3HOWC 4GTEA 2NVTK 3NKQA 1E1ZP 4A3CK 3I4NK 3SZYA 5LRMA 4KM8A 5LIAA 3AQOA 4UPLA 5C3EK 4KMAA 2JA7C 1ALJA 2R7ZC 3MK0A 3S1MK 3BDHA 4KB2A 4J3NA 2E2IK 1B4BA 4A3IK 4BXXK 3WAXA 1HI9A 4BY1C 1HQMA 4OIQA 3TX0A 3BP3A 3DYCA 5LRNA 5HRTA 1AJAA 3GTGA 4QIWL 1I50K 1KH4A 3CQZA 3M8ZA 2E2IA 5IOQA 3GTPK 2NVXA 3H0GA 2IFYA 3B5QA 4QIWD 4WJ4A 1ELYA 1AJCA 2GSNA 2FQOA 3K7AC 2GAGC 3S1QK 3ED4A 4FDIA 3GEIA 2IUCA 4Y52K 1ELXA 4X6AK 3NUHA 4MEXA 1IBAA 1O29A 4C3IC 1J6WA 1USOA 1VRQC 4G7HA 1AB4A 2RH6A 2VUMA 3T01A 1USMA 4AYBL 3S14C 1KHKA 1VH2A 1ZXOA 4KATA 5IOTA 1ALIA 1Y6VA 5IYBC 2WB1L 2XR9A 3S15K 3GTKA 3AD9C 2GSOA 4A3IC 1ED9A 4YG2A 3FHZA 4MQ9A 4LRBA 1XZPB 3HOUK 4LOWA 1TWGK 2PMZL 1HJKA 1TWAA 2V6SA 4Y7NK 3M7VA 5EGEA 3BP8C 3LAPA 2RGRA 5M5YK 2JA7A 3TFJA 4BBSK 2BE5A 2R92K 1E2SP 2ZFZA 1EK8A 1Y1WC 2W8SA 4KJGA 2W5SA 3GTMA 1R9TK 3S2DC 5IP9K 3K7AK 3NKMA 4PAAA 1FSUA 1N2KA 3G4AA 1R9TC 3S2DK 4A93K 2R7ZA 3PO2C 1EH1A 3GTJK 4BXXC 1XPPA 3IPJA 4OIPA 1O24A 1WQFA 5IORA 3N0CA 4BY1K 2NVTC 4LK1A 2W5QA 3CQZC 3MMLB 1ZYRA 2B63K 4NWJA 4ZG9A 1TWFC 3NKNA 4XSZA 1O2BA 4KJDA 2XCRB 1VLOA 3H3VL 1ALHA 3TFIA 2W5XA 3GTPC 2E2IC 2V6TA 4LRCA 1XZPA 4P5BA 4FM9A 1WSVA 4YFKA 1O98A 2XCQA 4C3JK 2CFAA 3T02A 1G51A 1XXCA 1Y1VA 4P5AA 1DCHA 1ANIA 4AYBD 4KM4A 4A3LK 1URBA 1I50C 3HOWK 2QZUA 5IP7K 3GTMC 1I3QK 4A3JK 1KH9A 3NKPA 5IJQA 1O28A 4GTAA 4BBSC 1VJEA 1WOOA 1Y1WK 1I6HK 4ZH4A 2WB1D 1DCPA 4ILDA 2R7ZK 4Q4ZA 1I6HC 2W8DA 2YU9K 2A6EA 5IYCC 3TTGA 3WAYA 3SZZA 2CW0A 2EBBA 1R9TA 3FOFA 1F9NA 1TWHC 2P8TA 4C2MC 3HOZK 4LLGA 1WCMK 1ZEFA 4LREA 5IYDK 1SFOA 2D1GA 1WOPA 4BLBA 1X31C 3GTOA 2JA7K 3BUEA 4LJZA 1SMYA 4G7OA 4A3GC 2W5VA 4KN7A 5E68A 4JK1A 1PJ6A 3S15C 5DLWA 3S2HK 2V6UA 1ISEA 3MK1A 4KMUA 4GTBA 3HOXC 1F93A 2NVYK 1HDHA 4Y7NC 4UPIA 3WAVA 1JVIA 5C4JK 3PO2K 3AH5A 4C3IK 1YNNA 4A3LC 1IS1A 5C44C 1I3QC 4A3JC 2VUMK 2NVYA 1WOSA 3LXQA 2R93C 4O2DA 3M4OC 4A3MK 2VQRA 5FJ8K 4MIVA 4GTYA 5IYBK 5KXAA 4G0VA 3M4OK 1TWCA 1HQAA 3M3YC 3UO0A 5IYCK 3RZDC 2O5IA 3RZOK 3HOUC 2GLQA 1WQGA 3RZDK 4QAXA 3Q3QA 5JFEA 5M5WK 3RZOC 1Y1VC 1WCMA 1URAA 3GEHA 5AJ9A 3OPFA 1WIHA 3HKZL 2CFAB 1ZBSA 4XLPA 3S1QC 5L0EA 2FQTA 4CXUA 1TWHA 1YCLA 3OREA 2GA3A 1EI6A 5DLTA 3HOYK 1O27A 1XXAA 1BJTA 1I3QA 1ED8A 3N0BA 3I4MC 5L46A 1N2LA 1XXBA 1L0WA 4WJ3M 3H3VD 1ZEDA 5TJ3A 4LRFA
chains in the Genus database with same CATH topology
5CJ9A 3QX3A 4GTZA 4GTCA 4GT9A 2XCOA 4FZBA 3M8WA 4BLAA 1EJJA 4KAVA 3IDDA 3BDGA 1ANJA 1EW2A 3T00A 3TG0A 5L0BA 2B63A 1B8JA 4YR1A 1EQJA 4LR7A 3OEPA 4KAYA 2PHCB 2R92A 3TWZA 3BDFA 5LQQA 4NWXA 2W5WA 4GTWA 4LR2A 2W5RA 4ZG7A 2X98A 4FDJA 4DDQA 4KM9A 4N7TA 4GTLA 1KH5A 3M8YA 1TWFA 3S0XA 4G0UA 5DLVA 3FOEA 5GRRA 3GTPA 4KDDA 3FKIA 1I50A 4KAWX 1AUKA 2JH3A 2KWAA 3KD8A 1O99A 1O2AA 5IOSA 4UOOA 3IGZB 3N3YA 1O26A 4GTFA 4CYRA 3AQPA 5GOVA 1SHQA 3BDGB 4UPKA 3IGYB 2W5TA 1K7HA 4GFQA 4ZG6A 3OT9A 4LQYA 5C66A 4KASA 3LAJA 3L4KA 2P5MA 3VA7A 3WAWA 1ZEBA 5IJSA 1WQHA 5JVOA 4M1XA 1EW8A 4KB4A 4LR9A 3UNYA 4MY4A 1ALKA 3V4GA 1KQ4A 1B4AA 2R93A 4KC6A 5EGHA 4KMHA 4KMDA 1BGWA 2YU9A 4CYSA 4UORA 5K4PA 2JA5A 1KHJA 2ANHA 4TN0A 1Y1WA 2GSUA 4UPHA 1ZVUA 5CHPA 1P49A 3LPXA 4UOPA 2ZKTA 5INHA 1O25A 1ELZA 4LR8A 1GE9A 4G0WA 3CMRA 3L4JA 4KARA 2IUCB 5L0KA 2Y3PA 3WBHA 3GTLA 4LRAA 3E2DA 4B56A 2E2HA 1AJBA 4MHXA 3GTJA 2G9YA 4LRDA 3UN3A 3GTQA 2XRGA 4C3HC 3G4CA 1KHNA 3UN5A 1AJDA 2JA6A 1TWGA 4GTXA 3DPCA 4CXSA 1EW9A 3NKRA 1K83A 4C3JC 1DD5A 1SHNA 1Y7AA 1E3CP 3A52A 4GTDA 3CAGA 3NKOA 4CXKA 3ERED 3NVLA 4BKWA 4ZGAA 3MK2A 1KHLA 1E33P 1KH7A 3UN2A 4GTEA 3NKQA 1E1ZP 3SZYA 5LRMA 4KM8A 5LIAA 3AQOA 4UPLA 4KMAA 1ALJA 3MK0A 3BDHA 4KB2A 4J3NA 1B4BA 3WAXA 3TX0A 3DYCA 5LRNA 5HRTA 1AJAA 3GTGA 1KH4A 3CQZA 3M8ZA 2E2IA 5IOQA 2NVXA 3H0GA 2IFYA 3B5QA 1ELYA 1AJCA 2GSNA 3ED4A 4FDIA 2IUCA 1ELXA 3NUHA 1O29A 4C3IC 1AB4A 2RH6A 2VUMA 3T01A 1KHKA 4KATA 1ZXOA 5IOTA 1ALIA 1Y6VA 2XR9A 3GTKA 2GSOA 1ED9A 3FHZA 4LRBA 1HJKA 1TWAA 3M7VA 5EGEA 3LAPA 2RGRA 2JA7A 1E2SP 2ZFZA 1EK8A 2W8SA 4KJGA 2W5SA 3GTMA 3NKMA 1FSUA 1N2KA 3G4AA 2R7ZA 1EH1A 1O24A 1WQFA 3N0CA 5IORA 2W5QA 3MMLB 4NWJA 4ZG9A 3NKNA 1O2BA 4KJDA 2XCRB 1ALHA 2W5XA 4LRCA 4P5BA 4FM9A 1O98A 2XCQA 2CFAA 3T02A 1XXCA 1Y1VA 4P5AA 1ANIA 4KM4A 1URBA 2QZUA 1KH9A 3NKPA 5IJQA 1O28A 4GTAA 4ILDA 2W8DA 3WAYA 3SZZA 1R9TA 3FOFA 1F9NA 4C2MC 1ZEFA 4LREA 1SFOA 2D1GA 4BLBA 3GTOA 3BUEA 2W5VA 5DLWA 1ISEA 3MK1A 4GTBA 1HDHA 4UPIA 3WAVA 3AH5A 1IS1A 3LXQA 2NVYA 2VQRA 4MIVA 4GTYA 5KXAA 4G0VA 1TWCA 1HQAA 3UO0A 2GLQA 4QAXA 1WQGA 3Q3QA 5JFEA 1WCMA 1URAA 5AJ9A 3OPFA 1WIHA 2CFAB 1ZBSA 5L0EA 4CXUA 1TWHA 3OREA 2GA3A 1EI6A 5DLTA 1O27A 1XXAA 1BJTA 1ED8A 1I3QA 3N0BA 1N2LA 1ZEDA 1XXBA 5TJ3A 4LRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHQ A;  4KJD A;  1E3C P;  3BDG B;  4UPK A;  3A52 A;  3IGY B;  2W5T A;  4GTZ A;  3NKO A;  1K7H A;  1ALH A;  4CXK A;  2W5X A;  3OT9 A;  4ZG6 A;  3NVL A;  4LQY A;  5C66 A;  4ZGA A;  3MK2 A;  3M8W A;  4LRC A;  1EJJ A;  4KAV A;  1O98 A;  3IDD A;  1KHL A;  3BDG A;  3T02 A;  1E33 P;  1KH7 A;  3WAW A;  1ZEB A;  5IJS A;  1ANJ A;  3UN2 A;  1EW2 A;  3T00 A;  1ANI A;  1EW8 A;  4KM4 A;  3TG0 A;  1URB A;  4LR9 A;  4MY4 A;  3NKQ A;  3UNY A;  1E1Z P;  1ALK A;  5L0B A;  2QZU A;  1B8J A;  3SZY A;  1KH9 A;  3NKP A;  5LRM A;  4YR1 A;  5LIA A;  1EQJ A;  5IJQ A;  4UPL A;  1ALJ A;  4LR7 A;  3MK0 A;  3BDH A;  2W8D A;  3WAX A;  5EGH A;  4KAY A;  3WAY A;  3SZZ A;  3TX0 A;  3DYC A;  3TWZ A;  3BDF A;  5LRN A;  4CYS A;  1ZEF A;  4LRE A;  2D1G A;  4UOR A;  5HRT A;  1AJA A;  5K4P A;  5LQQ A;  4NWX A;  1KHJ A;  2ANH A;  1KH4 A;  2W5W A;  4TN0 A;  3M8Z A;  2GSU A;  2W5V A;  2IFY A;  3B5Q A;  4UPH A;  1P49 A;  1ELY A;  1AJC A;  2GSN A;  5DLW A;  4GTW A;  4UOP A;  3ED4 A;  2ZKT A;  4LR2 A;  2W5R A;  3MK1 A;  4ZG7 A;  4FDI A;  2X98 A;  5INH A;  2IUC A;  1ELX A;  4FDJ A;  1ELZ A;  1HDH A;  4LR8 A;  4UPI A;  3WAV A;  4N7T A;  2RH6 A;  3CMR A;  3T01 A;  3LXQ A;  1KH5 A;  5L0K A;  2IUC B;  3M8Y A;  1KHK A;  3WBH A;  5DLV A;  1ALI A;  1Y6V A;  2XR9 A;  4LRA A;  2GSO A;  2VQR A;  3E2D A;  4GTY A;  4MIV A;  5KXA A;  4B56 A;  1HQA A;  5GRR A;  1ED9 A;  4LRB A;  1AJB A;  3UO0 A;  1HJK A;  2GLQ A;  3M7V A;  4MHX A;  4QAX A;  5EGE A;  2G9Y A;  3Q3Q A;  4LRD A;  1AUK A;  1URA A;  3UN3 A;  5AJ9 A;  2XRG A;  1E2S P;  3KD8 A;  1O99 A;  2W8S A;  4KJG A;  2W5S A;  1KHN A;  3UN5 A;  4UOO A;  1AJD A;  3NKM A;  1FSU A;  5L0E A;  1N2K A;  4CXU A;  3IGZ B;  4GTX A;  2GA3 A;  1EI6 A;  3DPC A;  5DLT A;  4CXS A;  1EW9 A;  1ED8 A;  3NKR A;  1SHN A;  2W5Q A;  4CYR A;  4NWJ A;  1Y7A A;  1N2L A;  1ZED A;  5GOV A;  4ZG9 A;  3NKN A;  5TJ3 A;  4LRF A; 
#chains in the Genus database with same CATH topology
 1TWF K;  5M3F K;  5CJ9 A;  3QX3 A;  2A68 A;  4GTZ A;  4GTC A;  4PAB A;  4GT9 A;  2XCO A;  4FZB A;  4A3G K;  4GZY A;  4A93 C;  2PA8 L;  3M8W A;  4BLA A;  4A3M C;  1EJJ A;  4KAV A;  3IDD A;  3BDG A;  1ANJ A;  4YFX A;  1EW2 A;  3T00 A;  3TG0 A;  5L0B A;  2B63 A;  2NVY C;  2GAH C;  1B8J A;  4YR1 A;  1EQJ A;  2E2J K;  2JA6 C;  3S2H C;  4LR7 A;  3A8K A;  3GIR A;  3OEP A;  4Y52 C;  4G7Z A;  4P9S A;  4KAY A;  2PHC B;  3GTL C;  2R92 A;  3GTJ C;  3TWZ A;  3BDF A;  1UV7 A;  1J6X A;  2Y0S D;  1F7U A;  5LQQ A;  4NWX A;  3S17 K;  5C44 K;  1TWA K;  2W5W A;  3GSI A;  3JST A;  3TFH A;  1YNJ A;  3S17 C;  4MEY A;  4GTW A;  4LR2 A;  2W5R A;  4ZG7 A;  2E2H K;  3S1M C;  1C0A A;  2X98 A;  3HOZ C;  4FDJ A;  4A3K C;  1BS2 A;  4DDQ A;  4A3D K;  4KM9 A;  4N7T A;  2WAQ L;  4A3E C;  4GTL A;  2JA8 C;  1KH5 A;  1PJ5 A;  3M8Y A;  1TWF A;  3S0X A;  4G0U A;  3S1N K;  5DLV A;  2A6H A;  3FOE A;  3HOV K;  5HL8 A;  1BDF A;  5GRR A;  1J98 A;  3H0G K;  3GTG C;  3GTP A;  2NVX K;  1TWH K;  4C2M K;  3CQZ K;  2B63 C;  4KDD A;  3FKI A;  1I50 A;  2ZUF A;  3I4M K;  3DXJ A;  3H0G C;  5IYD C;  3GTG K;  1IW7 A;  1XZQ A;  4KAW X;  1AUK A;  2JH3 A;  2NVQ C;  3HKZ D;  5FLM K;  2KWA A;  5C3E C;  1RU0 A;  3KD8 A;  3A8I A;  4YFN A;  1O99 A;  1O2A A;  5IOS A;  4RMF A;  1INN A;  4UOO A;  5TMF A;  5TMC A;  3IGZ B;  3N3Y A;  4A3F K;  4A3B K;  1O26 A;  3S1R C;  1TWC K;  4GTF A;  5C4J C;  4CYR A;  1WOR A;  3AQP A;  5GOV A;  2A69 A;  4BBR C;  1SHQ A;  3GDZ A;  2VUM C;  3BDG B;  4UPK A;  3IGY B;  4A3C C;  2W5T A;  4BBR K;  3GEE A;  4GFQ A;  1K7H A;  5C4X C;  4ZG6 A;  3OT9 A;  4LQY A;  5C66 A;  4KAS A;  3PO3 C;  5C4X K;  4AH6 A;  3LAJ A;  2ZUE A;  5M3M K;  4BY7 C;  1IQ0 A;  3L4K A;  2P5M A;  3VA7 A;  1WCM C;  2D6F C;  2E2H C;  1ZEB A;  3WAW A;  4OIR A;  1WQH A;  5JVO A;  4M1X A;  5IJS A;  3AD7 C;  3I4N C;  4KB4 A;  3AD8 C;  1EW8 A;  4LR9 A;  3UNY A;  4MY4 A;  1ALK A;  2PMZ D;  2WAQ D;  4C3H K;  1K83 K;  5D4D A;  4OIN A;  4A3D C;  4WIL A;  5FLM C;  3V4G A;  3GTK C;  1DCO A;  1V5V A;  4XCH A;  2JA6 K;  3GTO K;  1JOE A;  1KQ4 A;  1SFO K;  1B4A A;  2PPB A;  3HOX K;  4KC6 A;  3EQL A;  5EGH A;  2R93 A;  4NOI A;  4KMH A;  4KMD A;  1F7V A;  1BGW A;  1TWG C;  2YU9 A;  3GTQ K;  4CYS A;  1TWC C;  4UOR A;  5K4P A;  3GTQ C;  2JA5 A;  1KHJ A;  1WSR A;  2ANH A;  4TN0 A;  1Y1W A;  1TWA C;  2GSU A;  2NVQ K;  4UPH A;  1ZVU A;  3FKI K;  5CHP A;  1P49 A;  4KN4 A;  4LK0 A;  3S14 K;  3LPX A;  4UOP A;  5IP9 C;  2ZKT A;  3GTL K;  3M3Y K;  3S16 K;  5INH A;  2O5J A;  1O25 A;  3S16 C;  1ELZ A;  4LR8 A;  4A3K K;  1Y1V K;  1GE9 A;  1JQW A;  4G0W A;  3CMR A;  3L4J A;  5M5X K;  3ADA C;  1K83 C;  4KAR A;  2IUC B;  5L0K A;  2E2J C;  1ZQ1 C;  2Y3P A;  3WBH A;  4XSX A;  1XZQ B;  2R92 C;  1O2F B;  3GTL A;  4LRA A;  3E2D A;  1EFW A;  4B56 A;  3HOY C;  2E2H A;  4A3F C;  4A3B C;  1YX2 A;  1AJB A;  1IE0 A;  3PO3 K;  4X6A C;  4BY7 K;  2NVX C;  2JA8 K;  4MHX A;  3GTJ A;  2W7V A;  4A3E K;  2G9Y A;  2JA5 K;  4LRD A;  1EQR A;  5IP7 C;  3GTM K;  3UN3 A;  2JA5 C;  3GTQ A;  2XRG A;  3A8J A;  1IL2 A;  4C3H C;  3HOV C;  1PJ7 A;  2R93 K;  3G4C A;  2PA8 D;  1KHN A;  3UN5 A;  1AJD A;  2JA6 A;  1I6V A;  1VGX A;  4XLN A;  1TWG A;  2YU9 C;  4GTX A;  3DPC A;  4CXS A;  1SFO C;  1EW9 A;  4C45 A;  1K83 A;  3HXA A;  3NKR A;  4C3J C;  1DD5 A;  1SHN A;  4Q5S A;  1Y7A A;  1E3C P;  3GTK K;  3A52 A;  4GTD A;  3CAG A;  3NKO A;  4CXK A;  3GTO C;  3ERE D;  3NVL A;  3WOD A;  4BKW A;  3S1N C;  4ZGA A;  3MK2 A;  3FKI C;  4QJV A;  3S1R K;  4QJV B;  1KHL A;  1E33 P;  4OIO A;  1KH7 A;  2Y0S L;  3UN2 A;  1J6V A;  3HOW C;  4GTE A;  2NVT K;  3NKQ A;  1E1Z P;  4A3C K;  3I4N K;  3SZY A;  5LRM A;  4KM8 A;  5LIA A;  3AQO A;  4UPL A;  5C3E K;  4KMA A;  2JA7 C;  1ALJ A;  2R7Z C;  3MK0 A;  3S1M K;  3BDH A;  4KB2 A;  4J3N A;  2E2I K;  1B4B A;  4A3I K;  4BXX K;  3WAX A;  1HI9 A;  4BY1 C;  1HQM A;  4OIQ A;  3TX0 A;  3BP3 A;  3DYC A;  5LRN A;  5HRT A;  1AJA A;  3GTG A;  4QIW L;  1I50 K;  1KH4 A;  3CQZ A;  3M8Z A;  2E2I A;  5IOQ A;  3GTP K;  2NVX A;  3H0G A;  2IFY A;  3B5Q A;  4QIW D;  4WJ4 A;  1ELY A;  1AJC A;  2GSN A;  2FQO A;  3K7A C;  2GAG C;  3S1Q K;  3ED4 A;  4FDI A;  3GEI A;  2IUC A;  4Y52 K;  1ELX A;  4X6A K;  3NUH A;  4MEX A;  1IBA A;  1O29 A;  4C3I C;  1J6W A;  1USO A;  1VRQ C;  4G7H A;  1AB4 A;  2RH6 A;  2VUM A;  3T01 A;  1USM A;  4AYB L;  3S14 C;  1KHK A;  1VH2 A;  1ZXO A;  4KAT A;  5IOT A;  1ALI A;  1Y6V A;  5IYB C;  2WB1 L;  2XR9 A;  3S15 K;  3GTK A;  3AD9 C;  2GSO A;  4A3I C;  1ED9 A;  4YG2 A;  3FHZ A;  4MQ9 A;  4LRB A;  1XZP B;  3HOU K;  4LOW A;  1TWG K;  2PMZ L;  1HJK A;  1TWA A;  2V6S A;  4Y7N K;  3M7V A;  5EGE A;  3BP8 C;  3LAP A;  2RGR A;  5M5Y K;  2JA7 A;  3TFJ A;  4BBS K;  2BE5 A;  2R92 K;  1E2S P;  2ZFZ A;  1EK8 A;  1Y1W C;  2W8S A;  4KJG A;  2W5S A;  3GTM A;  1R9T K;  3S2D C;  5IP9 K;  3K7A K;  3NKM A;  4PAA A;  1FSU A;  1N2K A;  3G4A A;  1R9T C;  3S2D K;  4A93 K;  2R7Z A;  3PO2 C;  1EH1 A;  3GTJ K;  4BXX C;  1XPP A;  3IPJ A;  4OIP A;  1O24 A;  1WQF A;  5IOR A;  3N0C A;  4BY1 K;  2NVT C;  4LK1 A;  2W5Q A;  3CQZ C;  3MML B;  1ZYR A;  2B63 K;  4NWJ A;  4ZG9 A;  1TWF C;  3NKN A;  4XSZ A;  1O2B A;  4KJD A;  2XCR B;  1VLO A;  3H3V L;  1ALH A;  3TFI A;  2W5X A;  3GTP C;  2E2I C;  2V6T A;  4LRC A;  1XZP A;  4P5B A;  4FM9 A;  1WSV A;  4YFK A;  1O98 A;  2XCQ A;  4C3J K;  2CFA A;  3T02 A;  1G51 A;  1XXC A;  1Y1V A;  4P5A A;  1DCH A;  1ANI A;  4AYB D;  4KM4 A;  4A3L K;  1URB A;  1I50 C;  3HOW K;  2QZU A;  5IP7 K;  3GTM C;  1I3Q K;  4A3J K;  1KH9 A;  3NKP A;  5IJQ A;  1O28 A;  4GTA A;  4BBS C;  1VJE A;  1WOO A;  1Y1W K;  1I6H K;  4ZH4 A;  2WB1 D;  1DCP A;  4ILD A;  2R7Z K;  4Q4Z A;  1I6H C;  2W8D A;  2YU9 K;  2A6E A;  5IYC C;  3TTG A;  3WAY A;  3SZZ A;  2CW0 A;  2EBB A;  1R9T A;  3FOF A;  1F9N A;  1TWH C;  2P8T A;  4C2M C;  3HOZ K;  4LLG A;  1WCM K;  1ZEF A;  4LRE A;  5IYD K;  1SFO A;  2D1G A;  1WOP A;  4BLB A;  1X31 C;  3GTO A;  2JA7 K;  3BUE A;  4LJZ A;  1SMY A;  4G7O A;  4A3G C;  2W5V A;  4KN7 A;  5E68 A;  4JK1 A;  1PJ6 A;  3S15 C;  5DLW A;  3S2H K;  2V6U A;  1ISE A;  3MK1 A;  4KMU A;  4GTB A;  3HOX C;  1F93 A;  2NVY K;  1HDH A;  4Y7N C;  4UPI A;  3WAV A;  1JVI A;  5C4J K;  3PO2 K;  3AH5 A;  4C3I K;  1YNN A;  4A3L C;  1IS1 A;  5C44 C;  1I3Q C;  4A3J C;  2VUM K;  2NVY A;  1WOS A;  3LXQ A;  2R93 C;  4O2D A;  3M4O C;  4A3M K;  2VQR A;  5FJ8 K;  4MIV A;  4GTY A;  5IYB K;  5KXA A;  4G0V A;  3M4O K;  1TWC A;  1HQA A;  3M3Y C;  3UO0 A;  5IYC K;  3RZD C;  2O5I A;  3RZO K;  3HOU C;  2GLQ A;  1WQG A;  3RZD K;  4QAX A;  3Q3Q A;  5JFE A;  5M5W K;  3RZO C;  1Y1V C;  1WCM A;  1URA A;  3GEH A;  5AJ9 A;  3OPF A;  1WIH A;  3HKZ L;  2CFA B;  1ZBS A;  4XLP A;  3S1Q C;  5L0E A;  2FQT A;  4CXU A;  1TWH A;  1YCL A;  3ORE A;  2GA3 A;  1EI6 A;  5DLT A;  3HOY K;  1O27 A;  1XXA A;  1BJT A;  1I3Q A;  1ED8 A;  3N0B A;  3I4M C;  5L46 A;  1N2L A;  1XXB A;  1L0W A;  4WJ3 M;  3H3V D;  1ZED A;  5TJ3 A;  4LRF A; 
#chains in the Genus database with same CATH homology
 5CJ9 A;  3QX3 A;  4GTZ A;  4GTC A;  4GT9 A;  2XCO A;  4FZB A;  3M8W A;  4BLA A;  1EJJ A;  4KAV A;  3IDD A;  3BDG A;  1ANJ A;  1EW2 A;  3T00 A;  3TG0 A;  5L0B A;  2B63 A;  1B8J A;  4YR1 A;  1EQJ A;  4LR7 A;  3OEP A;  4KAY A;  2PHC B;  2R92 A;  3TWZ A;  3BDF A;  5LQQ A;  4NWX A;  2W5W A;  4GTW A;  4LR2 A;  2W5R A;  4ZG7 A;  2X98 A;  4FDJ A;  4DDQ A;  4KM9 A;  4N7T A;  4GTL A;  1KH5 A;  3M8Y A;  1TWF A;  3S0X A;  4G0U A;  5DLV A;  3FOE A;  5GRR A;  3GTP A;  4KDD A;  3FKI A;  1I50 A;  4KAW X;  1AUK A;  2JH3 A;  2KWA A;  3KD8 A;  1O99 A;  1O2A A;  5IOS A;  4UOO A;  3IGZ B;  3N3Y A;  1O26 A;  4GTF A;  4CYR A;  3AQP A;  5GOV A;  1SHQ A;  3BDG B;  4UPK A;  3IGY B;  2W5T A;  1K7H A;  4GFQ A;  4ZG6 A;  3OT9 A;  4LQY A;  5C66 A;  4KAS A;  3LAJ A;  3L4K A;  2P5M A;  3VA7 A;  3WAW A;  1ZEB A;  5IJS A;  1WQH A;  5JVO A;  4M1X A;  1EW8 A;  4KB4 A;  4LR9 A;  3UNY A;  4MY4 A;  1ALK A;  3V4G A;  1KQ4 A;  1B4A A;  2R93 A;  4KC6 A;  5EGH A;  4KMH A;  4KMD A;  1BGW A;  2YU9 A;  4CYS A;  4UOR A;  5K4P A;  2JA5 A;  1KHJ A;  2ANH A;  4TN0 A;  1Y1W A;  2GSU A;  4UPH A;  1ZVU A;  5CHP A;  1P49 A;  3LPX A;  4UOP A;  2ZKT A;  5INH A;  1O25 A;  1ELZ A;  4LR8 A;  1GE9 A;  4G0W A;  3CMR A;  3L4J A;  4KAR A;  2IUC B;  5L0K A;  2Y3P A;  3WBH A;  3GTL A;  4LRA A;  3E2D A;  4B56 A;  2E2H A;  1AJB A;  4MHX A;  3GTJ A;  2G9Y A;  4LRD A;  3UN3 A;  3GTQ A;  2XRG A;  4C3H C;  3G4C A;  1KHN A;  3UN5 A;  1AJD A;  2JA6 A;  1TWG A;  4GTX A;  3DPC A;  4CXS A;  1EW9 A;  3NKR A;  1K83 A;  4C3J C;  1DD5 A;  1SHN A;  1Y7A A;  1E3C P;  3A52 A;  4GTD A;  3CAG A;  3NKO A;  4CXK A;  3ERE D;  3NVL A;  4BKW A;  4ZGA A;  3MK2 A;  1KHL A;  1E33 P;  1KH7 A;  3UN2 A;  4GTE A;  3NKQ A;  1E1Z P;  3SZY A;  5LRM A;  4KM8 A;  5LIA A;  3AQO A;  4UPL A;  4KMA A;  1ALJ A;  3MK0 A;  3BDH A;  4KB2 A;  4J3N A;  1B4B A;  3WAX A;  3TX0 A;  3DYC A;  5LRN A;  5HRT A;  1AJA A;  3GTG A;  1KH4 A;  3CQZ A;  3M8Z A;  2E2I A;  5IOQ A;  2NVX A;  3H0G A;  2IFY A;  3B5Q A;  1ELY A;  1AJC A;  2GSN A;  3ED4 A;  4FDI A;  2IUC A;  1ELX A;  3NUH A;  1O29 A;  4C3I C;  1AB4 A;  2RH6 A;  2VUM A;  3T01 A;  1KHK A;  4KAT A;  1ZXO A;  5IOT A;  1ALI A;  1Y6V A;  2XR9 A;  3GTK A;  2GSO A;  1ED9 A;  3FHZ A;  4LRB A;  1HJK A;  1TWA A;  3M7V A;  5EGE A;  3LAP A;  2RGR A;  2JA7 A;  1E2S P;  2ZFZ A;  1EK8 A;  2W8S A;  4KJG A;  2W5S A;  3GTM A;  3NKM A;  1FSU A;  1N2K A;  3G4A A;  2R7Z A;  1EH1 A;  1O24 A;  1WQF A;  3N0C A;  5IOR A;  2W5Q A;  3MML B;  4NWJ A;  4ZG9 A;  3NKN A;  1O2B A;  4KJD A;  2XCR B;  1ALH A;  2W5X A;  4LRC A;  4P5B A;  4FM9 A;  1O98 A;  2XCQ A;  2CFA A;  3T02 A;  1XXC A;  1Y1V A;  4P5A A;  1ANI A;  4KM4 A;  1URB A;  2QZU A;  1KH9 A;  3NKP A;  5IJQ A;  1O28 A;  4GTA A;  4ILD A;  2W8D A;  3WAY A;  3SZZ A;  1R9T A;  3FOF A;  1F9N A;  4C2M C;  1ZEF A;  4LRE A;  1SFO A;  2D1G A;  4BLB A;  3GTO A;  3BUE A;  2W5V A;  5DLW A;  1ISE A;  3MK1 A;  4GTB A;  1HDH A;  4UPI A;  3WAV A;  3AH5 A;  1IS1 A;  3LXQ A;  2NVY A;  2VQR A;  4MIV A;  4GTY A;  5KXA A;  4G0V A;  1TWC A;  1HQA A;  3UO0 A;  2GLQ A;  4QAX A;  1WQG A;  3Q3Q A;  5JFE A;  1WCM A;  1URA A;  5AJ9 A;  3OPF A;  1WIH A;  2CFA B;  1ZBS A;  5L0E A;  4CXU A;  1TWH A;  3ORE A;  2GA3 A;  1EI6 A;  5DLT A;  1O27 A;  1XXA A;  1BJT A;  1ED8 A;  1I3Q A;  3N0B A;  1N2L A;  1ZED A;  1XXB A;  5TJ3 A;  4LRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...