4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
4UPIA 5LQQA 4B56A 4NWXA 2GSUA 4LRDA 5INHA 3OT9A 5EGEA 2GA3A 2RH6A 1ANIA 1Y6VA 1P49A 1ED8A 1AJBA 1ELYA 3LXQA 3T00A 2VQRA 3WAXA 1EI6A 3KD8A 5GRRA 1AJDA 3Q3QA 1AJCA 4UPKA 4LRFA 4KAVA 1N2LA 5LRNA 3T01A 2GSOA 4GTXA 3BDFA 1AUKA 4CYSA 4ZG9A 1E2SP 3NKNA 1HDHA 4FDJA 3WAWA 3SZZA 5GOVA 2W8DA 2IUCB 5AJ9A 3NKQA 2W8SA 2W5QA 3BDGB 3UO0A 2GSNA 1KHJA 5L0KA 5DLTA 1E1ZP 5LRMA 1EQJA 3MK0A 4KM4A 2GLQA 4FDIA 4CXKA 3NKMA 4GTYA 1ZEBA 4CYRA 4YR1A 3M7VA 4LR9A 1HJKA 1ANJA 3A52A 3M8ZA 1SHQA 5DLVA 4ZG7A 1EW9A 3CMRA 1ZEFA 5KXAA 3MK1A 5C66A 3ED4A 4LQYA 3IGYB 3M8YA 2W5WA 3MK2A 1KHNA 3E2DA 4N7TA 5DLWA 1O98A 3TG0A 3IDDA 5L0EA 1KH7A 3B5QA 5LIAA 3UN3A 1URAA 1ZEDA 2W5XA 4KJDA 3BDGA 1EW2A 2ANHA 4LR7A 1K7HA 1URBA 5EGHA 3WAYA 4CXUA 1Y7AA 4LRAA 4KAYA 4LR8A 1E33P 4MIVA 1ALHA 3UN5A 3NKOA 1ALJA 1ELXA 3IGZB 1ALKA 1E3CP 4GTWA 4UPLA 3WAVA 2W5VA 1ALIA 4ZGAA 1EW8A 3DYCA 2IFYA 3TX0A 1HQAA 1KHLA 5K4PA 3TWZA 2W5RA 1ELZA 3UNYA 3UN2A 1KH4A 1KH9A 2W5TA 4MHXA 3T02A 4UPHA 2D1GA 2XRGA 1FSUA 3NKPA 3NVLA 4CXSA 2W5SA 1KHKA 4NWJA 2QZUA 4LRBA 4LR2A 1KH5A 2ZKTA 2G9YA 4QAXA 1SHNA 1AJAA 1N2KA 2X98A 3WBHA 1B8JA 5TJ3A 4ZG6A 3SZYA 2XR9A 5HRTA 3NKRA 3BDHA 1O99A 2IUCA 5IJQA 4UOPA 4MY4A 1ED9A 3M8WA 4GTZA 4KJGA 4TN0A 4LRCA 3DPCA 1EJJA 4LREA 5L0BA 4UORA 4UOOA 5IJSA
chains in the Genus database with same CATH superfamily
4BBRC 5HL8A 4UPIA 2R92A 3S16K 2JA6C 4LRDA 5C44K 1TWHA 5CHPA 1F9NA 1TWCK 1HI9A 4C3JK 1TWGK 2VUMC 3GTLC 4A3CK 1ZQ1C 1ELYA 1PJ7A 1TWHC 1Y1VC 3GTMK 4A3DC 5C4XK 2NVTK 3LPXA 3KD8A 5GRRA 1AJDA 2BE5A 4Y7NK 1AJCA 5M5WK 4UPKA 3HOZC 3JSTA 5LRNA 2GSOA 4BY7K 1AUKA 1SFOA 5GOVA 1TWGA 1ZYRA 2IUCB 4PABA 4A3JK 1WORA 2W5QA 2R92K 1KHJA 3S1NK 4KM4A 1AB4A 3HXAA 4GTYA 1WQGA 4YR1A 4AYBL 3CQZK 3M7VA 2JA5C 4KARA 2E2JK 1HJKA 4LR9A 1SHQA 5DLVA 1YNNA 4GTBA 3S1MC 4ZG7A 1EW9A 1I3QK 3V4GA 2XCRB 4G7OA 3GTJA 3S15C 2JA7K 2YU9C 5M5XK 5TMFA 1WQHA 1KH7A 3GTLA 1VRQC 3UN3A 4A93C 1ZEDA 4BXXK 4KJDA 3GTKA 3GTOK 3HOUC 1K7HA 1URBA 1BGWA 3NKOA 3GTPC 1R9TA 1ZVUA 4A3BC 4G0VA 3H0GC 5IYCC 4GTWA 2PHCB 3QX3A 2O5JA 1TWAC 3DYCA 2IFYA 1V5VA 4A3MK 2NVYA 5IP9K 5K4PA 3UNYA 1BDFA 3I4NC 4MHXA 2O5IA 2PMZL 2XRGA 4O2DA 3AD9C 3RZOK 2W5SA 1YX2A 4YFKA 1KHKA 1B4AA 2JH3A 3VA7A 1C0AA 2QZUA 4C2MK 5IORA 2JA5A 3S14K 2G9YA 2ZKTA 1N2KA 2X98A 1EFWA 3EQLA 4QIWL 1XXCA 1TWFA 5M5YK 1HQMA 4ZG6A 1WOPA 4LJZA 3GTJC 3GTGK 1I50C 4Y52C 1O99A 1XZPB 2IUCA 2P8TA 3GEIA 3GTGA 4OIPA 2WAQD 2GAHC 3M8WA 2CFAB 4KJGA 3BP3A 3AD8C 1I6HC 3HOWK 3K7AC 3DPCA 3AH5A 5L46A 1I50A 4LREA 2B63C 4A3EC 1IBAA 2WB1D 2NVXC 4UORA 5IJSA 5IP7K 3FOEA 2Y0SD 2PA8D 1PJ5A 4GTDA 5LQQA 4P9SA 1G51A 4C45A 4KMHA 5TMCA 2GA3A 2RH6A 1ANIA 1Y6VA 3AD7C 1ED8A 3LXQA 1GE9A 2VUMA 1KQ4A 4M1XA 4KN4A 3Q3QA 4KMUA 5IOQA 3A8IA 1R9TK 1TWFK 1ISEA 4KM8A 3T01A 3PO2K 3BDFA 3HOYC 4CYSA 1E2SP 3GEHA 3WAWA 5IYBK 3L4JA 3BUEA 3SZZA 3GTKK 3I4MC 5IYBC 4WILA 3N0CA 1WSVA 2R93C 2W8SA 3HOYK 3BDGB 5L0KA 1TWFC 5JFEA 4GT9A 1USMA 1R9TC 4G0WA 2GLQA 4FDIA 3GEEA 5C3EK 4CYRA 1UV7A 2A6HA 4X6AC 1ANJA 3A52A 1O27A 1ZBSA 4KDDA 4GTLA 3MK1A 3ED4A 5CJ9A 2PMZD 3M8YA 4RMFA 4ZH4A 4X6AK 3E2DA 4N7TA 2E2HA 2WB1L 3IDDA 5L0EA 3B5QA 2P5MA 4LLGA 5C3EC 4QJVA 3K7AK 2ANHA 1WIHA 2W7VA 5EGHA 4CXUA 1VH2A 4G0UA 2R93K 1I50K 4Y52K 3GTJK 4MIVA 1RU0A 3I4MK 3GTKC 1ELXA 4LOWA 1O29A 3H3VL 1XZQB 3S14C 3PO2C 3GDZA 1E3CP 4UPLA 2W5VA 3AQPA 3RZOC 3IPJA 4ZGAA 1J6WA 1O26A 4XLPA 3TWZA 1EH1A 3I4NK 1KH9A 4XSXA 1TWAA 5M3FK 1TWAK 3DXJA 4CXSA 3LAPA 4NWJA 3GIRA 1VGXA 2GAGC 4LR2A 1KH5A 2V6TA 4A3BK 5IOTA 3WBHA 1J6VA 3GTPK 1WOOA 4KB2A 1WCMA 5IP7C 2XR9A 5HRTA 2NVXK 3NKRA 4FZBA 1I6VA 4A3EK 2B63K 2A68A 4UOPA 1F7VA 1JQWA 3HOWC 1I6HK 4MY4A 3HOUK 4TN0A 4Q5SA 1DCHA 3TFJA 1IL2A 3AQOA 3GTGC 2ZUEA 1O24A 4UOOA 5E68A 1TWCA 1BJTA 1XZQA 2YU9K 4YFXA 4WJ3M 1IE0A 2JA7C 2GSUA 5INHA 3OT9A 4C2MC 1I3QC 3OEPA 1USOA 2JA7A 4KN7A 3T00A 3H0GA 2E2JC 2VQRA 4ILDA 3WAXA 3OREA 1EK8A 5IP9C 4FM9A 4OIRA 4A3MC 4YFNA 4KM9A 1PJ6A 5IYCK 4GTXA 4XLNA 3H0GK 4JK1A 3NKNA 3HKZD 2XCOA 3H3VD 1JVIA 3NKQA 2YU9A 3UO0A 4G7ZA 5DLTA 3GTOC 1E1ZP 5LRMA 3MK0A 3HOZK 2D6FC 4CXKA 4BXXC 3OPFA 4A93K 3NKMA 4WJ4A 4Y7NC 2NVTC 2ZFZA 1I3QA 1Y1VK 3GTMC 1O2BA 4A3DK 4KASA 3LAJA 2A6EA 4A3CC 4OIQA 2B63A 3S15K 2VUMK 2PPBA 1TWCC 4C3JC 3ERED 1Y1WA 4J3NA 5C44C 3S1MK 1IQ0A 4LQYA 4GTFA 1WOSA 2JA6K 3S16C 3MK2A 1KHNA 2JA5K 4P5AA 4BBRK 5DLWA 3CQZC 3TG0A 5LIAA 3N0BA 1URAA 3BDGA 1XZPA 3S1NC 3G4AA 4LR7A 2CFAA 2R92C 2NVYK 3TFIA 4A3JC 4LRAA 2JA6A 4LR8A 1E33P 4LK0A 1ALHA 1ALJA 3S17K 2EBBA 4A3IK 4KAWX 4BY7C 2E2IA 3PO3C 3S2DK 4GZYA 1ZXOA 1XXBA 1EW8A 2R93A 3TX0A 5M3MK 2CW0A 1HQAA 1KHLA 5C4XC 4Q4ZA 3GTOA 1YCLA 1KH4A 3T02A 2W5TA 1JOEA 1TWHK 4AYBD 3M4OC 5C4JC 4UPHA 3GTLK 3NVLA 3S2HC 2E2HK 1TWGC 3A8JA 4KB4A 4QAXA 4NOIA 1INNA 1AJAA 4MEYA 1K83C 4BLAA 3S0XA 3FKIA 1B8JA 2JA8K 1DCOA 3SZYA 1IW7A 2FQTA 4QJVB 1J6XA 4GTCA 3BDHA 3HOVC 3N3YA 4C3HC 3BP8C 3CAGA 3RZDC 1ED9A 4GTZA 3FKIK 1EJJA 5FJ8K 3L4KA 3M3YK 3S1QK 4GTAA 4A3FC 4P5BA 1O28A 4AH6A 3WODA 4B56A 4NWXA 5EGEA 2XCQA 3TTGA 1SFOK 3MMLB 3GTQK 4QIWD 1WQFA 1P49A 4YG2A 1AJBA 1WSRA 4C3IK 5FLMC 1X31C 4XCHA 1EI6A 3FOFA 1L0WA 4A3GK 2E2IK 4BY1C 5IYDK 4LRFA 2NVXA 2NVQK 4KAVA 3CQZA 1N2LA 1WCMK 1F93A 1IS1A 1VJEA 2FQOA 1SMYA 4ZG9A 1HDHA 4FDJA 3S1RC 2W8DA 4BKWA 5AJ9A 3G4CA 2R7ZA 5D4DA 2GSNA 4A3KC 1WCMC 1EQJA 1EQRA 4BBSK 3HOXC 2R7ZC 4A3LC 2E2IC 1ZEBA 1YNJA 1Y1WK 5FLMK 5IOSA 4C3IC 3M8ZA 4MQ9A 3GSIA 1Y1VA 1SFOC 3CMRA 1ZEFA 3GTMA 5KXAA 1BS2A 3A8KA 4KC6A 1O2AA 2Y3PA 3IGYB 5C66A 2W5WA 1O98A 1Y1WC 3NUHA 4BLBA 5JVOA 3HOXK 2R7ZK 4A3LK 4DDQA 4BBSC 2W5XA 1EW2A 2ZUFA 4G7HA 2A69A 4A3KK 3RZDK 1XXAA 4C3HK 3WAYA 4MEXA 3HOVK 1Y7AA 4KAYA 3UN5A 4GFQA 3S1RK 1B4BA 4PAAA 1K83K 1ALKA 3IGZB 4KMAA 2E2HC 2Y0SL 3S2HK 3WAVA 2NVQC 1ALIA 5IYDC 1J98A 4BY1K 5C4JK 3M4OK 4OIOA 3TFHA 1DCPA 4A3GC 3GTQA 1ELZA 2W5RA 3UN2A 2WAQL 4KMDA 4KATA 2D1GA 1FSUA 1XPPA 4LK1A 3NKPA 2V6SA 3GTQC 4LRBA 1O25A 4GTEA 3PO3K 3S2DC 1SHNA 1O2FB 4XSZA 4A3IC 5TJ3A 3S17C 2RGRA 1VLOA 2KWAA 3HKZL 4A3FK 5IJQA 2NVYC 1K83A 3M3YC 3S1QC 1DD5A 3FKIC 3FHZA 2PA8L 3GTPA 3ADAC 4LRCA 2V6UA 5L0BA 4OINA 1F7UA 2JA8C
chains in the Genus database with same CATH topology
4UPIA 2R92A 4LRDA 1TWHA 5CHPA 1F9NA 1ELYA 3KD8A 3LPXA 5GRRA 1AJDA 1AJCA 4UPKA 5LRNA 2GSOA 1AUKA 1SFOA 5GOVA 1TWGA 2IUCB 2W5QA 1KHJA 4KM4A 1AB4A 4GTYA 1WQGA 4YR1A 3M7VA 4LR9A 4KARA 1HJKA 1SHQA 5DLVA 4GTBA 4ZG7A 1EW9A 3V4GA 2XCRB 3GTJA 1WQHA 1KH7A 3GTLA 3UN3A 1ZEDA 4KJDA 3GTKA 1K7HA 1URBA 1BGWA 3NKOA 1R9TA 1ZVUA 4G0VA 4GTWA 2PHCB 3QX3A 3DYCA 2IFYA 2NVYA 5K4PA 3UNYA 4MHXA 2XRGA 2W5SA 1KHKA 1B4AA 2JH3A 3VA7A 2QZUA 5IORA 2JA5A 2G9YA 2ZKTA 1N2KA 2X98A 1XXCA 1TWFA 4ZG6A 1O99A 2IUCA 3GTGA 4KJGA 3M8WA 2CFAB 3DPCA 3AH5A 1I50A 4LREA 4UORA 5IJSA 3FOEA 4GTDA 5LQQA 4KMHA 2GA3A 2RH6A 1ANIA 1Y6VA 1ED8A 3LXQA 1GE9A 2VUMA 1KQ4A 4M1XA 3Q3QA 5IOQA 1ISEA 4KM8A 3T01A 3BDFA 4CYSA 1E2SP 3WAWA 3L4JA 3BUEA 3SZZA 3N0CA 2W8SA 3BDGB 5L0KA 5JFEA 4GT9A 4G0WA 2GLQA 4FDIA 4CYRA 1ANJA 3A52A 1O27A 1ZBSA 4KDDA 4GTLA 3MK1A 3ED4A 5CJ9A 3M8YA 3E2DA 4N7TA 2E2HA 3IDDA 5L0EA 3B5QA 2P5MA 2ANHA 1WIHA 5EGHA 4CXUA 4G0UA 4MIVA 1ELXA 1O29A 1E3CP 4UPLA 2W5VA 3AQPA 4ZGAA 1O26A 3TWZA 1EH1A 1KH9A 1TWAA 4CXSA 4NWJA 3LAPA 4LR2A 1KH5A 5IOTA 3WBHA 4KB2A 1WCMA 5HRTA 2XR9A 3NKRA 4FZBA 4UOPA 4MY4A 4TN0A 3AQOA 1O24A 4UOOA 1BJTA 1TWCA 2GSUA 5INHA 3OT9A 4C2MC 3OEPA 2JA7A 3T00A 3H0GA 2VQRA 4ILDA 3WAXA 3OREA 1EK8A 4FM9A 4KM9A 4GTXA 3NKNA 2XCOA 3NKQA 2YU9A 3UO0A 5DLTA 1E1ZP 5LRMA 3MK0A 4CXKA 3OPFA 3NKMA 2ZFZA 1I3QA 1O2BA 4KASA 3LAJA 2B63A 4C3JC 3ERED 1Y1WA 4J3NA 4LQYA 4GTFA 3MK2A 1KHNA 4P5AA 5DLWA 3TG0A 5LIAA 3N0BA 1URAA 3BDGA 3G4AA 4LR7A 2CFAA 4LRAA 2JA6A 4LR8A 1E33P 1ALHA 1ALJA 4KAWX 2E2IA 1ZXOA 1XXBA 1EW8A 2R93A 3TX0A 1HQAA 1KHLA 3GTOA 1KH4A 2W5TA 3T02A 4UPHA 3NVLA 4KB4A 4QAXA 1AJAA 4BLAA 3S0XA 3FKIA 1B8JA 3SZYA 4GTCA 3BDHA 3N3YA 4C3HC 3CAGA 1ED9A 4GTZA 1EJJA 3L4KA 4GTAA 4P5BA 1O28A 4B56A 4NWXA 5EGEA 2XCQA 3MMLB 1WQFA 1P49A 1AJBA 1EI6A 3FOFA 4LRFA 2NVXA 4KAVA 3CQZA 1N2LA 1IS1A 4ZG9A 1HDHA 4FDJA 2W8DA 4BKWA 5AJ9A 3G4CA 2R7ZA 2GSNA 1EQJA 1ZEBA 5IOSA 4C3IC 3M8ZA 1Y1VA 3CMRA 1ZEFA 3GTMA 5KXAA 5C66A 4KC6A 1O2AA 2Y3PA 3IGYB 2W5WA 1O98A 3NUHA 4BLBA 5JVOA 2W5XA 4DDQA 1EW2A 1XXAA 3WAYA 1Y7AA 4KAYA 3UN5A 4GFQA 1B4BA 3IGZB 1ALKA 4KMAA 3WAVA 1ALIA 3GTQA 1ELZA 2W5RA 3UN2A 4KMDA 4KATA 2D1GA 1FSUA 3NKPA 4LRBA 1O25A 4GTEA 1SHNA 5TJ3A 2RGRA 2KWAA 5IJQA 1K83A 1DD5A 3FHZA 3GTPA 4LRCA 5L0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPI A;  5LQQ A;  4B56 A;  4NWX A;  2GSU A;  4LRD A;  5INH A;  3OT9 A;  5EGE A;  2GA3 A;  2RH6 A;  1ANI A;  1Y6V A;  1P49 A;  1ED8 A;  1AJB A;  1ELY A;  3LXQ A;  3T00 A;  2VQR A;  3WAX A;  1EI6 A;  3KD8 A;  5GRR A;  1AJD A;  3Q3Q A;  1AJC A;  4UPK A;  4LRF A;  4KAV A;  1N2L A;  5LRN A;  3T01 A;  2GSO A;  4GTX A;  3BDF A;  1AUK A;  4CYS A;  4ZG9 A;  1E2S P;  3NKN A;  1HDH A;  4FDJ A;  3WAW A;  3SZZ A;  5GOV A;  2W8D A;  2IUC B;  5AJ9 A;  3NKQ A;  2W8S A;  2W5Q A;  3BDG B;  3UO0 A;  2GSN A;  1KHJ A;  5L0K A;  5DLT A;  1E1Z P;  5LRM A;  1EQJ A;  3MK0 A;  4KM4 A;  2GLQ A;  4FDI A;  4CXK A;  3NKM A;  4GTY A;  1ZEB A;  4CYR A;  4YR1 A;  3M7V A;  4LR9 A;  1HJK A;  1ANJ A;  3A52 A;  3M8Z A;  1SHQ A;  5DLV A;  4ZG7 A;  1EW9 A;  3CMR A;  1ZEF A;  5KXA A;  3MK1 A;  5C66 A;  3ED4 A;  4LQY A;  3IGY B;  3M8Y A;  2W5W A;  3MK2 A;  1KHN A;  3E2D A;  4N7T A;  5DLW A;  1O98 A;  3TG0 A;  3IDD A;  5L0E A;  1KH7 A;  3B5Q A;  5LIA A;  3UN3 A;  1URA A;  1ZED A;  2W5X A;  4KJD A;  3BDG A;  1EW2 A;  2ANH A;  4LR7 A;  1K7H A;  1URB A;  5EGH A;  3WAY A;  4CXU A;  1Y7A A;  4LRA A;  4KAY A;  4LR8 A;  1E33 P;  4MIV A;  1ALH A;  3UN5 A;  3NKO A;  1ALJ A;  1ELX A;  3IGZ B;  1ALK A;  1E3C P;  4GTW A;  4UPL A;  3WAV A;  2W5V A;  1ALI A;  4ZGA A;  1EW8 A;  3DYC A;  2IFY A;  3TX0 A;  1HQA A;  1KHL A;  5K4P A;  3TWZ A;  2W5R A;  1ELZ A;  3UNY A;  3UN2 A;  1KH4 A;  1KH9 A;  2W5T A;  4MHX A;  3T02 A;  4UPH A;  2D1G A;  2XRG A;  1FSU A;  3NKP A;  3NVL A;  4CXS A;  2W5S A;  1KHK A;  4NWJ A;  2QZU A;  4LRB A;  4LR2 A;  1KH5 A;  2ZKT A;  2G9Y A;  4QAX A;  1SHN A;  1AJA A;  1N2K A;  2X98 A;  3WBH A;  1B8J A;  5TJ3 A;  4ZG6 A;  3SZY A;  2XR9 A;  5HRT A;  3NKR A;  3BDH A;  1O99 A;  2IUC A;  5IJQ A;  4UOP A;  4MY4 A;  1ED9 A;  3M8W A;  4GTZ A;  4KJG A;  4TN0 A;  4LRC A;  3DPC A;  1EJJ A;  4LRE A;  5L0B A;  4UOR A;  4UOO A;  5IJS A; 
#chains in the Genus database with same CATH topology
 4BBR C;  5HL8 A;  4UPI A;  2R92 A;  3S16 K;  2JA6 C;  4LRD A;  5C44 K;  1TWH A;  5CHP A;  1F9N A;  1TWC K;  1HI9 A;  4C3J K;  1TWG K;  2VUM C;  3GTL C;  4A3C K;  1ZQ1 C;  1ELY A;  1PJ7 A;  1TWH C;  1Y1V C;  3GTM K;  4A3D C;  5C4X K;  2NVT K;  3LPX A;  3KD8 A;  5GRR A;  1AJD A;  2BE5 A;  4Y7N K;  1AJC A;  5M5W K;  4UPK A;  3HOZ C;  3JST A;  5LRN A;  2GSO A;  4BY7 K;  1AUK A;  1SFO A;  5GOV A;  1TWG A;  1ZYR A;  2IUC B;  4PAB A;  4A3J K;  1WOR A;  2W5Q A;  2R92 K;  1KHJ A;  3S1N K;  4KM4 A;  1AB4 A;  3HXA A;  4GTY A;  1WQG A;  4YR1 A;  4AYB L;  3CQZ K;  3M7V A;  2JA5 C;  4KAR A;  2E2J K;  1HJK A;  4LR9 A;  1SHQ A;  5DLV A;  1YNN A;  4GTB A;  3S1M C;  4ZG7 A;  1EW9 A;  1I3Q K;  3V4G A;  2XCR B;  4G7O A;  3GTJ A;  3S15 C;  2JA7 K;  2YU9 C;  5M5X K;  5TMF A;  1WQH A;  1KH7 A;  3GTL A;  1VRQ C;  3UN3 A;  4A93 C;  1ZED A;  4BXX K;  4KJD A;  3GTK A;  3GTO K;  3HOU C;  1K7H A;  1URB A;  1BGW A;  3NKO A;  3GTP C;  1R9T A;  1ZVU A;  4A3B C;  4G0V A;  3H0G C;  5IYC C;  4GTW A;  2PHC B;  3QX3 A;  2O5J A;  1TWA C;  3DYC A;  2IFY A;  1V5V A;  4A3M K;  2NVY A;  5IP9 K;  5K4P A;  3UNY A;  1BDF A;  3I4N C;  4MHX A;  2O5I A;  2PMZ L;  2XRG A;  4O2D A;  3AD9 C;  3RZO K;  2W5S A;  1YX2 A;  4YFK A;  1KHK A;  1B4A A;  2JH3 A;  3VA7 A;  1C0A A;  2QZU A;  4C2M K;  5IOR A;  2JA5 A;  3S14 K;  2G9Y A;  2ZKT A;  1N2K A;  2X98 A;  1EFW A;  3EQL A;  4QIW L;  1XXC A;  1TWF A;  5M5Y K;  1HQM A;  4ZG6 A;  1WOP A;  4LJZ A;  3GTJ C;  3GTG K;  1I50 C;  4Y52 C;  1O99 A;  1XZP B;  2IUC A;  2P8T A;  3GEI A;  3GTG A;  4OIP A;  2WAQ D;  2GAH C;  3M8W A;  2CFA B;  4KJG A;  3BP3 A;  3AD8 C;  1I6H C;  3HOW K;  3K7A C;  3DPC A;  3AH5 A;  5L46 A;  1I50 A;  4LRE A;  2B63 C;  4A3E C;  1IBA A;  2WB1 D;  2NVX C;  4UOR A;  5IJS A;  5IP7 K;  3FOE A;  2Y0S D;  2PA8 D;  1PJ5 A;  4GTD A;  5LQQ A;  4P9S A;  1G51 A;  4C45 A;  4KMH A;  5TMC A;  2GA3 A;  2RH6 A;  1ANI A;  1Y6V A;  3AD7 C;  1ED8 A;  3LXQ A;  1GE9 A;  2VUM A;  1KQ4 A;  4M1X A;  4KN4 A;  3Q3Q A;  4KMU A;  5IOQ A;  3A8I A;  1R9T K;  1TWF K;  1ISE A;  4KM8 A;  3T01 A;  3PO2 K;  3BDF A;  3HOY C;  4CYS A;  1E2S P;  3GEH A;  3WAW A;  5IYB K;  3L4J A;  3BUE A;  3SZZ A;  3GTK K;  3I4M C;  5IYB C;  4WIL A;  3N0C A;  1WSV A;  2R93 C;  2W8S A;  3HOY K;  3BDG B;  5L0K A;  1TWF C;  5JFE A;  4GT9 A;  1USM A;  1R9T C;  4G0W A;  2GLQ A;  4FDI A;  3GEE A;  5C3E K;  4CYR A;  1UV7 A;  2A6H A;  4X6A C;  1ANJ A;  3A52 A;  1O27 A;  1ZBS A;  4KDD A;  4GTL A;  3MK1 A;  3ED4 A;  5CJ9 A;  2PMZ D;  3M8Y A;  4RMF A;  4ZH4 A;  4X6A K;  3E2D A;  4N7T A;  2E2H A;  2WB1 L;  3IDD A;  5L0E A;  3B5Q A;  2P5M A;  4LLG A;  5C3E C;  4QJV A;  3K7A K;  2ANH A;  1WIH A;  2W7V A;  5EGH A;  4CXU A;  1VH2 A;  4G0U A;  2R93 K;  1I50 K;  4Y52 K;  3GTJ K;  4MIV A;  1RU0 A;  3I4M K;  3GTK C;  1ELX A;  4LOW A;  1O29 A;  3H3V L;  1XZQ B;  3S14 C;  3PO2 C;  3GDZ A;  1E3C P;  4UPL A;  2W5V A;  3AQP A;  3RZO C;  3IPJ A;  4ZGA A;  1J6W A;  1O26 A;  4XLP A;  3TWZ A;  1EH1 A;  3I4N K;  1KH9 A;  4XSX A;  1TWA A;  5M3F K;  1TWA K;  3DXJ A;  4CXS A;  3LAP A;  4NWJ A;  3GIR A;  1VGX A;  2GAG C;  4LR2 A;  1KH5 A;  2V6T A;  4A3B K;  5IOT A;  3WBH A;  1J6V A;  3GTP K;  1WOO A;  4KB2 A;  1WCM A;  5IP7 C;  2XR9 A;  5HRT A;  2NVX K;  3NKR A;  4FZB A;  1I6V A;  4A3E K;  2B63 K;  2A68 A;  4UOP A;  1F7V A;  1JQW A;  3HOW C;  1I6H K;  4MY4 A;  3HOU K;  4TN0 A;  4Q5S A;  1DCH A;  3TFJ A;  1IL2 A;  3AQO A;  3GTG C;  2ZUE A;  1O24 A;  4UOO A;  5E68 A;  1TWC A;  1BJT A;  1XZQ A;  2YU9 K;  4YFX A;  4WJ3 M;  1IE0 A;  2JA7 C;  2GSU A;  5INH A;  3OT9 A;  4C2M C;  1I3Q C;  3OEP A;  1USO A;  2JA7 A;  4KN7 A;  3T00 A;  3H0G A;  2E2J C;  2VQR A;  4ILD A;  3WAX A;  3ORE A;  1EK8 A;  5IP9 C;  4FM9 A;  4OIR A;  4A3M C;  4YFN A;  4KM9 A;  1PJ6 A;  5IYC K;  4GTX A;  4XLN A;  3H0G K;  4JK1 A;  3NKN A;  3HKZ D;  2XCO A;  3H3V D;  1JVI A;  3NKQ A;  2YU9 A;  3UO0 A;  4G7Z A;  5DLT A;  3GTO C;  1E1Z P;  5LRM A;  3MK0 A;  3HOZ K;  2D6F C;  4CXK A;  4BXX C;  3OPF A;  4A93 K;  3NKM A;  4WJ4 A;  4Y7N C;  2NVT C;  2ZFZ A;  1I3Q A;  1Y1V K;  3GTM C;  1O2B A;  4A3D K;  4KAS A;  3LAJ A;  2A6E A;  4A3C C;  4OIQ A;  2B63 A;  3S15 K;  2VUM K;  2PPB A;  1TWC C;  4C3J C;  3ERE D;  1Y1W A;  4J3N A;  5C44 C;  3S1M K;  1IQ0 A;  4LQY A;  4GTF A;  1WOS A;  2JA6 K;  3S16 C;  3MK2 A;  1KHN A;  2JA5 K;  4P5A A;  4BBR K;  5DLW A;  3CQZ C;  3TG0 A;  5LIA A;  3N0B A;  1URA A;  3BDG A;  1XZP A;  3S1N C;  3G4A A;  4LR7 A;  2CFA A;  2R92 C;  2NVY K;  3TFI A;  4A3J C;  4LRA A;  2JA6 A;  4LR8 A;  1E33 P;  4LK0 A;  1ALH A;  1ALJ A;  3S17 K;  2EBB A;  4A3I K;  4KAW X;  4BY7 C;  2E2I A;  3PO3 C;  3S2D K;  4GZY A;  1ZXO A;  1XXB A;  1EW8 A;  2R93 A;  3TX0 A;  5M3M K;  2CW0 A;  1HQA A;  1KHL A;  5C4X C;  4Q4Z A;  3GTO A;  1YCL A;  1KH4 A;  3T02 A;  2W5T A;  1JOE A;  1TWH K;  4AYB D;  3M4O C;  5C4J C;  4UPH A;  3GTL K;  3NVL A;  3S2H C;  2E2H K;  1TWG C;  3A8J A;  4KB4 A;  4QAX A;  4NOI A;  1INN A;  1AJA A;  4MEY A;  1K83 C;  4BLA A;  3S0X A;  3FKI A;  1B8J A;  2JA8 K;  1DCO A;  3SZY A;  1IW7 A;  2FQT A;  4QJV B;  1J6X A;  4GTC A;  3BDH A;  3HOV C;  3N3Y A;  4C3H C;  3BP8 C;  3CAG A;  3RZD C;  1ED9 A;  4GTZ A;  3FKI K;  1EJJ A;  5FJ8 K;  3L4K A;  3M3Y K;  3S1Q K;  4GTA A;  4A3F C;  4P5B A;  1O28 A;  4AH6 A;  3WOD A;  4B56 A;  4NWX A;  5EGE A;  2XCQ A;  3TTG A;  1SFO K;  3MML B;  3GTQ K;  4QIW D;  1WQF A;  1P49 A;  4YG2 A;  1AJB A;  1WSR A;  4C3I K;  5FLM C;  1X31 C;  4XCH A;  1EI6 A;  3FOF A;  1L0W A;  4A3G K;  2E2I K;  4BY1 C;  5IYD K;  4LRF A;  2NVX A;  2NVQ K;  4KAV A;  3CQZ A;  1N2L A;  1WCM K;  1F93 A;  1IS1 A;  1VJE A;  2FQO A;  1SMY A;  4ZG9 A;  1HDH A;  4FDJ A;  3S1R C;  2W8D A;  4BKW A;  5AJ9 A;  3G4C A;  2R7Z A;  5D4D A;  2GSN A;  4A3K C;  1WCM C;  1EQJ A;  1EQR A;  4BBS K;  3HOX C;  2R7Z C;  4A3L C;  2E2I C;  1ZEB A;  1YNJ A;  1Y1W K;  5FLM K;  5IOS A;  4C3I C;  3M8Z A;  4MQ9 A;  3GSI A;  1Y1V A;  1SFO C;  3CMR A;  1ZEF A;  3GTM A;  5KXA A;  1BS2 A;  3A8K A;  4KC6 A;  1O2A A;  2Y3P A;  3IGY B;  5C66 A;  2W5W A;  1O98 A;  1Y1W C;  3NUH A;  4BLB A;  5JVO A;  3HOX K;  2R7Z K;  4A3L K;  4DDQ A;  4BBS C;  2W5X A;  1EW2 A;  2ZUF A;  4G7H A;  2A69 A;  4A3K K;  3RZD K;  1XXA A;  4C3H K;  3WAY A;  4MEX A;  3HOV K;  1Y7A A;  4KAY A;  3UN5 A;  4GFQ A;  3S1R K;  1B4B A;  4PAA A;  1K83 K;  1ALK A;  3IGZ B;  4KMA A;  2E2H C;  2Y0S L;  3S2H K;  3WAV A;  2NVQ C;  1ALI A;  5IYD C;  1J98 A;  4BY1 K;  5C4J K;  3M4O K;  4OIO A;  3TFH A;  1DCP A;  4A3G C;  3GTQ A;  1ELZ A;  2W5R A;  3UN2 A;  2WAQ L;  4KMD A;  4KAT A;  2D1G A;  1FSU A;  1XPP A;  4LK1 A;  3NKP A;  2V6S A;  3GTQ C;  4LRB A;  1O25 A;  4GTE A;  3PO3 K;  3S2D C;  1SHN A;  1O2F B;  4XSZ A;  4A3I C;  5TJ3 A;  3S17 C;  2RGR A;  1VLO A;  2KWA A;  3HKZ L;  4A3F K;  5IJQ A;  2NVY C;  1K83 A;  3M3Y C;  3S1Q C;  1DD5 A;  3FKI C;  3FHZ A;  2PA8 L;  3GTP A;  3ADA C;  4LRC A;  2V6U A;  5L0B A;  4OIN A;  1F7U A;  2JA8 C; 
#chains in the Genus database with same CATH homology
 4UPI A;  2R92 A;  4LRD A;  1TWH A;  5CHP A;  1F9N A;  1ELY A;  3KD8 A;  3LPX A;  5GRR A;  1AJD A;  1AJC A;  4UPK A;  5LRN A;  2GSO A;  1AUK A;  1SFO A;  5GOV A;  1TWG A;  2IUC B;  2W5Q A;  1KHJ A;  4KM4 A;  1AB4 A;  4GTY A;  1WQG A;  4YR1 A;  3M7V A;  4LR9 A;  4KAR A;  1HJK A;  1SHQ A;  5DLV A;  4GTB A;  4ZG7 A;  1EW9 A;  3V4G A;  2XCR B;  3GTJ A;  1WQH A;  1KH7 A;  3GTL A;  3UN3 A;  1ZED A;  4KJD A;  3GTK A;  1K7H A;  1URB A;  1BGW A;  3NKO A;  1R9T A;  1ZVU A;  4G0V A;  4GTW A;  2PHC B;  3QX3 A;  3DYC A;  2IFY A;  2NVY A;  5K4P A;  3UNY A;  4MHX A;  2XRG A;  2W5S A;  1KHK A;  1B4A A;  2JH3 A;  3VA7 A;  2QZU A;  5IOR A;  2JA5 A;  2G9Y A;  2ZKT A;  1N2K A;  2X98 A;  1XXC A;  1TWF A;  4ZG6 A;  1O99 A;  2IUC A;  3GTG A;  4KJG A;  3M8W A;  2CFA B;  3DPC A;  3AH5 A;  1I50 A;  4LRE A;  4UOR A;  5IJS A;  3FOE A;  4GTD A;  5LQQ A;  4KMH A;  2GA3 A;  2RH6 A;  1ANI A;  1Y6V A;  1ED8 A;  3LXQ A;  1GE9 A;  2VUM A;  1KQ4 A;  4M1X A;  3Q3Q A;  5IOQ A;  1ISE A;  4KM8 A;  3T01 A;  3BDF A;  4CYS A;  1E2S P;  3WAW A;  3L4J A;  3BUE A;  3SZZ A;  3N0C A;  2W8S A;  3BDG B;  5L0K A;  5JFE A;  4GT9 A;  4G0W A;  2GLQ A;  4FDI A;  4CYR A;  1ANJ A;  3A52 A;  1O27 A;  1ZBS A;  4KDD A;  4GTL A;  3MK1 A;  3ED4 A;  5CJ9 A;  3M8Y A;  3E2D A;  4N7T A;  2E2H A;  3IDD A;  5L0E A;  3B5Q A;  2P5M A;  2ANH A;  1WIH A;  5EGH A;  4CXU A;  4G0U A;  4MIV A;  1ELX A;  1O29 A;  1E3C P;  4UPL A;  2W5V A;  3AQP A;  4ZGA A;  1O26 A;  3TWZ A;  1EH1 A;  1KH9 A;  1TWA A;  4CXS A;  4NWJ A;  3LAP A;  4LR2 A;  1KH5 A;  5IOT A;  3WBH A;  4KB2 A;  1WCM A;  5HRT A;  2XR9 A;  3NKR A;  4FZB A;  4UOP A;  4MY4 A;  4TN0 A;  3AQO A;  1O24 A;  4UOO A;  1BJT A;  1TWC A;  2GSU A;  5INH A;  3OT9 A;  4C2M C;  3OEP A;  2JA7 A;  3T00 A;  3H0G A;  2VQR A;  4ILD A;  3WAX A;  3ORE A;  1EK8 A;  4FM9 A;  4KM9 A;  4GTX A;  3NKN A;  2XCO A;  3NKQ A;  2YU9 A;  3UO0 A;  5DLT A;  1E1Z P;  5LRM A;  3MK0 A;  4CXK A;  3OPF A;  3NKM A;  2ZFZ A;  1I3Q A;  1O2B A;  4KAS A;  3LAJ A;  2B63 A;  4C3J C;  3ERE D;  1Y1W A;  4J3N A;  4LQY A;  4GTF A;  3MK2 A;  1KHN A;  4P5A A;  5DLW A;  3TG0 A;  5LIA A;  3N0B A;  1URA A;  3BDG A;  3G4A A;  4LR7 A;  2CFA A;  4LRA A;  2JA6 A;  4LR8 A;  1E33 P;  1ALH A;  1ALJ A;  4KAW X;  2E2I A;  1ZXO A;  1XXB A;  1EW8 A;  2R93 A;  3TX0 A;  1HQA A;  1KHL A;  3GTO A;  1KH4 A;  2W5T A;  3T02 A;  4UPH A;  3NVL A;  4KB4 A;  4QAX A;  1AJA A;  4BLA A;  3S0X A;  3FKI A;  1B8J A;  3SZY A;  4GTC A;  3BDH A;  3N3Y A;  4C3H C;  3CAG A;  1ED9 A;  4GTZ A;  1EJJ A;  3L4K A;  4GTA A;  4P5B A;  1O28 A;  4B56 A;  4NWX A;  5EGE A;  2XCQ A;  3MML B;  1WQF A;  1P49 A;  1AJB A;  1EI6 A;  3FOF A;  4LRF A;  2NVX A;  4KAV A;  3CQZ A;  1N2L A;  1IS1 A;  4ZG9 A;  1HDH A;  4FDJ A;  2W8D A;  4BKW A;  5AJ9 A;  3G4C A;  2R7Z A;  2GSN A;  1EQJ A;  1ZEB A;  5IOS A;  4C3I C;  3M8Z A;  1Y1V A;  3CMR A;  1ZEF A;  3GTM A;  5KXA A;  5C66 A;  4KC6 A;  1O2A A;  2Y3P A;  3IGY B;  2W5W A;  1O98 A;  3NUH A;  4BLB A;  5JVO A;  2W5X A;  4DDQ A;  1EW2 A;  1XXA A;  3WAY A;  1Y7A A;  4KAY A;  3UN5 A;  4GFQ A;  1B4B A;  3IGZ B;  1ALK A;  4KMA A;  3WAV A;  1ALI A;  3GTQ A;  1ELZ A;  2W5R A;  3UN2 A;  4KMD A;  4KAT A;  2D1G A;  1FSU A;  3NKP A;  4LRB A;  1O25 A;  4GTE A;  1SHN A;  5TJ3 A;  2RGR A;  2KWA A;  5IJQ A;  1K83 A;  1DD5 A;  3FHZ A;  3GTP A;  4LRC A;  5L0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...