4LR9A

Phosphopentomutase s154a variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr9A01
1AJBA 3UO0A 5INHA 4UORA 1AJCA 3TWZA 4LRBA 1ELXA 2GSUA 2XR9A 1KHKA 4LQYA 4CXUA 5DLVA 1ALKA 3UN5A 3UN3A 3T02A 3WAYA 1N2LA 2W5TA 1EW9A 3NKPA 1SHQA 3T00A 4FDIA 4UOPA 2IUCA 5L0EA 1KH7A 1EW8A 3NKQA 3WAVA 3NKNA 4FDJA 3E2DA 2IUCB 4CYSA 4GTYA 4UPIA 4MIVA 1ZEDA 5EGEA 3OT9A 4B56A 4LR2A 4ZG7A 3KD8A 3WBHA 4LR9A 1AUKA 1B8JA 2W5XA 1AJDA 4LR8A 3ED4A 1P49A 2GSOA 1ED8A 3SZYA 1E1ZP 4NWXA 5L0BA 1KH9A 4KM4A 1ELYA 1KHLA 5IJSA 1Y6VA 4KAVA 5DLTA 4LRCA 4LRFA 1KHNA 1O98A 2W5SA 4GTWA 4GTZA 2G9YA 3BDGB 5EGHA 3CMRA 2IFYA 3NVLA 3NKMA 1ALJA 4LREA 2XRGA 5L0KA 3A52A 2W8SA 5TJ3A 1EJJA 1HDHA 3BDGA 1EW2A 4MHXA 2QZUA 1HJKA 2VQRA 4UPKA 2W8DA 2W5RA 3DYCA 1ZEFA 4KAYA 3IGYB 3MK1A 1K7HA 1KH5A 3TG0A 1KHJA 2GSNA 1ZEBA 1FSUA 1ED9A 1ALHA 5LRNA 3M7VA 3TX0A 5HRTA 2ZKTA 4KJDA 4UOOA 2ANHA 5KXAA 1ELZA 3LXQA 4LRDA 5AJ9A 2W5VA 3UN2A 3WAWA 3WAXA 1URAA 2W5QA 4CXSA 5GOVA 4ZG6A 5DLWA 4CYRA 5C66A 1HQAA 3DPCA 3M8WA 3MK0A 4UPLA 1EI6A 1KH4A 1O99A 2D1GA 5K4PA 1E2SP 3BDHA 3SZZA 3M8YA 3IGZB 3Q3QA 5IJQA 4N7TA 1AJAA 1EQJA 3NKRA 3B5QA 5LRMA 3M8ZA 4NWJA 1SHNA 4TN0A 1E3CP 3UNYA 5LQQA 4ZGAA 4LR7A 4MY4A 1E33P 4UPHA 2RH6A 3NKOA 4KJGA 1ANJA 1URBA 3IDDA 2GLQA 2X98A 4QAXA 4GTXA 1ALIA 3T01A 3MK2A 2GA3A 3BDFA 4LRAA 1N2KA 4CXKA 5GRRA 2W5WA 1ANIA 5LIAA 1Y7AA 4YR1A 4ZG9A
chains in the Genus database with same CATH superfamily
1AJBA 2C3YA 3UO0A 3ZTQA 3O44A 3I5AA 3PW2A 2QSWA 3GIJA 4U8VA 3SV4A 2V0NA 4Y2IA 2DRAA 4LF1A 3SBMA 2OPPA 3H90A 2OPPB 1HHTP 4ANEA 3BDEA 1NO8A 2VG5A 2NSBA 1LEOA 5GVQA 2H54B 1Q0NA 2BE2A 3T6JA 2F7VA 3OFGA 1FNMA 4PXDA 2R2TA 3KG4A 3N5BA 4IH6A 2NLWA 3HSJA 1HNZF 4B3RF 3MEGB 3IG1A 4JUZA 4JYAF 4KH0B 1O8BA 3SDEA 3UQSA 3TAMB 1OPIA 1RTHA 5IV4A 3QJJA 3V6HA 4YHHF 4DLEA 4CYSA 1KFSA 4QYZK 1RYSA 5GMKa 1TL5A 4YP3A 4J9UE 5HMYA 4B3SJ 4IQXA 4DV5F 4F50A 1S1TB 3DGPA 4OLPA 1MG7A 4JI6J 1YG0A 4IDKB 2MZQA 3NY0A 5D78A 4BDPA 2JVOA 2F4VJ 4HI2A 2HVIA 2DISA 3UCZP 3IC1A 3SXLA 1TMJA 4CLZA 1CJVA 2ZUAA 4OYZA 1P9YA 2HHVA 1OIAA 1UJ6A 3N6NA 2XZDB 1P6TA 5KFLA 2RIJA 4CTAA 1KBRA 4ZDNA 2RF2B 3FMWA 3RTVA 4CM2A 5KG4A 3O8WA 5KT2A 1NK7A 3FKBA 2QYCA 3MAQA 2HFOA 3UR3C 2DGQA 3GILA 4NLUA 1ZA1B 3D5MA 1WDDA 3HVWA 4F0HA 1WKJA 1R6VA 1UL3A 1HR0J 1K44A 3M6WA 2A6MA 2FLOA 3R5AA 3GYXB 2ILZA 2BEFA 3LP2A 4KBIA 1RWXB 2F63A 5KFFA 1ZA2B 3AFGA 1GEHA 1QUVA 2FJBB 3CTRA 3TAPA 1U1LA 2DHGA 1ZYQA 4NOHA 1WF0A 1HBOB 3PACA 3P3DA 3CXCR 2J5AA 2DGTA 2BMBA 3F0NA 5E5NA 1X5OA 3UW1A 1HWJA 1PYSB 1Q79A 2I5JA 2QA2A 2HGNA 3QGIA 2PA8D 4UQTA 3JYTB 2FY1A 3KOAA 3MM7B 1U2RA 4WTYA 1PSDA 4JI4J 4ED2A 4IH5A 3DKDA 1V5IB 3AA8A 4HKQA 4RW6A 5IXUA 4YR2A 4F7VA 2ALZA 2HHHF 1VLOA 3D7SB 3W8GA 2RUSA 2J76E 3WIVA 5EHHA 3RB3A 2M7SA 2ZWPA 3KJNB 4LSLA 2D1CA 2EFQA 1UCNA 1FWKA 3M32A 1N36F 2ZITA 3OFHA 1H7WA 4NLWA 4HYKA 4AFFA 3VAMA 4DQIA 1U24A 3E01A 2QLXA 1UWBA 5KFDA 1RBAA 2IDLA 2W2MP 2BW2A 2GO8A 3EZUA 1A6LA 4USVA 1RTZA 1R27B 5KG0A 4DX5A 5C2GA 4RUAA 4X4VA 2Z58B 4IH7A 2F4FA 5FLXY 1IKWA 4QR1A 1YBTA 1R43A 1DY3A 1RHQB 1HYSB 3MM5A 4CLSA 3ILJA 2H9ZA 4GVLA 4USJC 4QPXA 1N33F 4FKYA 4NYPA 3T5LA 4USTA 1XTZA 2VUGA 3HM9A 2UVUA 2IFXA 5LMNF 2RRAA 5KAKA 2J6TA 4DSIA 1I5OB 2RHSB 3DM2B 4I68A 1ZS6A 3D28A 4ALZA 5HMZA 4ILLA 1C4CA 4DSLA 3W9HA 3HVTA 4ED3A 5A0YB 3CC4S 1QM9A 1SH0A 4ED1A 2H48B 3MEGA 1L3UA 2HAFA 5DDQC 2AX1A 1SQEA 2FB0A 4AL7A 3W2VA 2ZH8A 1RT7A 2F8EX 2DH7A 2B9EA 3SI8A 1HL6A 2DPJA 3OFEA 1U2CA 3TYTA 1KD1T 2V8GA 3OW2R 1M90T 1IKYA 4O0IA 2CWXA 1K1SA 4GKJJ 4ATNA 2ZOMA 3VF0B 1FE4A 4DUYJ 1NPPA 1QDUB 1S9EB 4RBTA 1Q53A 5C24A 4A8XA 1EIYB 1K9MT 3K5LA 3CUNA 2GVDA 4G1IA 1LW0A 1I1GA 1JLGB 2ZHOA 4KH1B 1U4BA 2DNYA 2PFFB 2YNFB 4MKYA 3DDNA 2O01C 4FDIA 1T8EA 5LMUJ 1U25A 4PCQA 4UOPA 3MAAA 3CDAA 3I9ZA 4DBQA 5IM0A 2BRKA 2GIFA 2MLYA 2PMZD 3BO4A 4K59A 2KB2A 2H4WB 1MWYA 3MR7A 4OYPA 4ZVGA 5L9XA 1HI0P 3TJ8A 3R27A 3KK3B 3HO1A 4B3OA 1HMVB 5D15A 3AB2B 3MMBA 4ECXA 1BD6A 1TVRB 2N7YA 5HVHA 1RBLA 2OPRA 2VG7A 1U0SA 5K5MA 1MU2B 4HT7A 4MH8A 3UCGA 3KJFB 4KAYA 1VISA 5A6WA 3NOGA 3PZPA 4QCLA 3G82A 3C15B 3HHLC 2VASA 5DG9A 2GQCA 3DLEA 3ILIA 3JB9k 2J8SA 3OV7A 1RT3B 4JYAJ 1Y6VA 3HVAA 2C2KB 3MEEB 4ED7A 4TYAA 1I3OB 1H3DA 2J0QD 3MCOA 2CPIA 1M1GA 4NZ6A 3AH6A 4IR1A 3R2CJ 3RBZA 1NJYA 2DNKA 3SSSA 3U7JA 5BR8J 1G1XA 3S6EA 3K2YA 4X66J 2E5HA 3IGNA 4EO6A 4FBUA 3C2PA 3CULA 1T9WA 4P74A 5AJ3F 2BJ7A 3QGPA 4Y34A 1NK9A 4CZCA 1H7XA 1CJKB 2LA6A 2N4CA 1YDLA 5L9NA 3CO0P 3K89A 1T03B 2R8JA 3IP0A 2IPOB 1ICEB 2IM2A 2PA3A 2UUTA 1S1UB 3DRSB 3JSMB 3OSPA 1BQNB 2D9PA 3ZFVA 2DNGA 1ED9A 4GVBB 5E3PA 2BE7D 3J81U 2HHPA 2FHMA 2K3IA 3LANA 3NBPB 4UOOA 2FPHX 5J2PB 2KT3A 2O5DA 2QRRA 4NLVA 2C3PA 3UN2A 9ATCB 3PR4A 2D3OR 3GYNA 4EK2A 2B5JA 5KOWA 3AD7C 3C16A 3FCVA 2CQ4A 2J9EA 4NPOA 3KK1B 3IAS9 2V4RA 3QO9B 3CCVS 1J5OA 4ZG6A 5DLWA 2J9CA 1TKTA 3AJDA 1WG5A 3MK0A 2GJFA 2V4JB 3BH6B 3DOKB 5E41A 2CZVC 4C98A 2HVEA 2M2BA 4KPCA 3NS6A 3OVSA 4WP8A 1JJCB 1FX2A 3O3LA 1KHWA 4XPEA 4TQRA 3JYTA 3TI0A 5A2QY 1Y5LB 3FRZA 2CG8A 3SSRA 1FKPB 2ZD1B 2DO0A 4OHWA 4USUA 3H4DA 1VLYA 4JV5F 1REGX 2W4PA 3DNCA 4TN0A 3MZIA 3MFHA 1N48A 4G3IA 4ZVOB 2WBRA 2HLTA 5HI7A 5I3PA 4UOFA 3IG1B 5KFVA 4ZGAA 1DRZA 4X62F 2D9OA 4IFYB 3OXGA 4A48A 1MWQA 2ZBQA 3BGRB 4WFBQ 2GLQA 1HNIB 2X98A 1FVSA 2DNPA 1K47A 1RHKB 4HH0A 2QLFB 4ZHRA 3CCJS 2VG6A 5DGBA 4P52A 1FJCA 1Q7YT 2R7UA 2NZ4A 3M1VB 4I4BA 2XG8A 3Q8YA 2NUHA 1SJ3P 5CZXA 1ANIA 2KT2A 5D4OA 3UNGC 2DHSA 3HJVA 1A9NB 2WVBA 4UTGA 2HHQA 3R8YA 3Q24A 2AJQA 2IMWP 4NCAA 2FC9A 2X3GA 4C11B 2AD9A 4DWIA 4FNIA 4DR4J 5KG2A 2FLPA 3DYAB 3SYZA 5KFGA 1TK8A 3I0RB 2BVZA 3C14A 4TKTA 3HKWA 5GAEI 2XYPB 3OTEA 3M2RA 4XTTA 1X4CA 3VV2B 2HZVA 4MT1A 1D09B 4EZ6A 3LP0B 5HVFA 1WELA 3OD2A 4L73A 5DLVA 1UETA 2Z56B 1U1KA 2CNNB 1R89A 3GCXP 2V4QA 4OV6A 2BJEA 1JLQB 1NK5A 2PI4A 2UXCJ 2DGOA 4OFZA 4WIQA 2MKIA 3M8QB 1U1MA 4ZS6A 4KHPJ 4UOCA 3I0SB 3WAVA 4RL1A 1GQEA 3ULHA 3MTKA 3MGJA 2CJQA 2VFUA 2WOMA 1LWXA 1NH8A 1S48A 5K8NA 2UP1A 4MIVA 4UPIA 1XBWA 5I3UB 4DUZF 2WCXA 3ZTSA 5CYJA 1F9FA 2VBYA 3WC0A 3JQJA 4NCBA 3MPWA 2L9WA 1FRIA 2GHPA 4ECTA 4X64J 1M5KC 2B51A 4C8OA 3P5TL 4LR8A 3BGRA 4IUFA 2GSOA 1PAUB 1VR6A 2Q66A 1JKHA 3MPUB 5B0GA 1T9UA 1IR0A 2E5IA 5IJSA 5FDLB 1KFDA 2IRUA 4OX8A 5FLXU 1KHNA 4GTWA 4P2MA 2HYIB 3RZAA 3CVKA 3CT9A 4KO0A 5L1KA 1WG1A 3C16B 2EKNA 5D0RA 2XI3A 2OEMA 3GPAA 4XO0A 1S9GB 2QMUB 5L0KA 1U0HA 3NMRA 1S1WA 1TMMA 2V4JA 1DHMA 3LGMA 2JC0A 3LQVA 3HZEA 3R7NB 5DLFA 3BDGA 1RSCA 2M3DA 4UF4A 2Q1LA 2V8HA 2ZH3A 1HJKA 4HH1A 1GTEA 1VS3A 1ZEFA 2BQRA 2DEIA 1YIJS 1Q1KA 1IUJA 4KKOB 3QMQA 2HBZB 4DS4A 1ZEBA 3M7VA 3PYDA 4TVAB 1OY8A 3HHEA 3ET6B 4ZVTB 1CULB 2GC8A 3VWSA 1LWEA 2QFIA 3NRBA 5BJRA 1YTYA 1NB7A 2WW4A 1FVQA 4IKAA 3V6DA 1Q81T 3AOBA 3QT7A 4DFJA 4OJ1A 2YVSA 1SH2A 5DG7A 5HAOA 3I5CA 1IN0A 1CJKA 4I1TA 1RAOA 3R7BB 4OHZA 2DR9A 4O3SA 1T11A 1WUUA 3I96A 2V2VA 4P6QA 3KMQA 1NMEB 1H2UX 2Q6BA 1TL1B 1NUEA 5KT4A 1RT4A 2YNHA 2BJ1A 2GQQA 3FVYA 1HARA 4F67A 2XC9A 4IRDA 2GAHC 2DRBA 4OYIA 3BQ0A 2JDJA 4ZVPB 2VB6A 2YQ0A 4ZK7M 3NNHA 2C2NA 2P2CB 4RBVA 2JC1A 5LQQA 2VDIA 3HDSA 3CB4A 2CPDA 4OYMA 2QEXS 3GCWP 4DPTA 1UVNA 4Z2XA 5KFHA 4R25A 1UTAA 2EG2A 5ETTA 3SCKE 2KH9A 3THPA 4RWWA 1S10A 1EX8A 1UP1A 2EFVA 4FZVA 2L3MA 4LMZA 1B7YB 1R31A 4P2FA 3H5XA 4KGVB 2MGZA 5CCLA 1RLCL 3MMAB 4CLPA 2FZKB 1KLMA 3UDVA 2CQBA 2DNLA 2AIRB 4KSEB 1VC0A 1IBLF 5FD1A 4CLKA 3L9ZA 2FQQB 3M6UA 4LSZB 3B78A 3I4PA 2RDDA 1VQSA 5C24B 4CLTA 2FZGB 3RW7A 3KMSA 3LAKA 2RS2A 4NYZA 3NGRA 1XMQF 1F3FA 4MYTA 4F4YA 4WPAA 2DNQA 3IR7B 3NGSA 4AYBD 1Q86T 2FVRA 3TAMA 2COLA 3M2VA 2IYIA 2AEMA 2K2PA 1JKHB 4IQMA 3CE8A 4NA2A 4ECZA 2NUUG 3OL8A 3G86A 1RHUB 4OX9F 2IBKA 5E3RA 2V50A 5IOLA 4C0OC 1NJXA 2WK4A 4G1QA 3CCMS 2EC0A 1RZMA 4I2QA 1PC5A 3DRRB 1TKDA 2E5GA 3E2DA 4W4MA 1YJ7A 3TA1A 4WFNQ 1XNQJ 3AD8C 3AJ1A 2MKYA 3AHPA 5HMXA 2ZH5A 4AQYF 2NYHA 1NK4A 2G4BA 5BYQA 1YJ9S 1RTIA 1X9MA 3CDBA 3ZZUA 4ZG7A 3HSZA 3BYPA 4O44B 5KG3A 2VIHA 2YWEA 3WC2A 5B0CA 1L5UA 3CJ2A 2BA9A 3NCQA 1LXNA 1QE1B 2B8PA 3NEKA 1LFPA 4K2JA 3TZYA 2HPUA 2HZAA 3KK1A 1HNWF 2E9TA 4CH1A 2XSFA 3AA9A 4ZP8A 4Y0FA 4K50A 3HULA 3R1HA 1ULRA 2V9WA 2B4UA 5CXTA 3ED4A 5KFRA 2JHEA 3NS5A 2BUNA 2HZCA 3OHBA 2JZ5A 1YJUA 2OP5A 3BN4A 5EX0A 3DI6A 1PC4A 4QJVA 1NKBA 2IFYA 1UFKA 4KR0B 3J7YU 2B9XA 3DYCA 2OPSA 1AFJA 2FLLA 1D8ZA 3H2VE 4P2XA 4B9NA 3FBCA 2Z2MA 2C42A 3QBCA 2I2YA 4UY8T 4ZLJA 5HL7Q 3LTOA 3CC2S 2LEAA 4IG3B 1W7WA 4OI4A 3GU0A 2D3UA 3BN7A 3BPSP 2KL8A 1S59A 1SKUB 4ERDA 4EBEA 5HANA 4BLGA 1GFWB 3ELHA 3Q8UA 3EE3A 1SL0A 3N28A 3HSDA 3CJKB 1RU2A 1J5OB 3SCIE 1NEEA 5F8HA 1U48A 1HIYA 2IJRA 4ZVRB 3LWMA 1T0TV 3HT0A 2YTCA 4MAKA 1H74A 2RSQA 2SXLA 2QN6B 1GX6A 2R42A 1N0VC 4PZVA 2BKPA 3CD7A 2ZJPQ 2ZEJA 3DU5A 1YRUA 4HDHA 4OZNA 2HGLA 5F3TA 1TUVA 1MU2A 4UQGA 2XO7A 4K4TA 1QSLA 1LOUA 1VBXA 2R8KA 2AX0A 2KYXA 3FCHA 3FGVA 4NMXA 3MR3A 1TU0B 3PYGA 2JVRA 4YB5A 5HN0A 1T3OA 3Q3QA 2QT7A 1OS5A 2OPQA 4B3TJ 1V9OA 2AJ2A 2APOA 2OO4A 2X7IA 4RW6B 2DH8A 3QZ7A 1NXIA 2ZOFA 3A13A 1IM6A 2GV1A 2VC1A 1E3CP 4PABA 3VALA 4USWA 2V2ZA 5KFNA 3V6DB 4USHA 5JXSA 3H4BA 3E8OA 1UVIA 4GKJF 1C0UB 3A8JA 4K5RA 3DHXA 2GIRA 4CT9A 4DCOB 2HQ3A 1Y9OA 2KFYA 4QAXA 1PJ5A 2XI2A 1U45A 2E5JA 3UDEA 4Q8EA 3OPKA 5F8GA 2HQIA 2Y1RI 2I1RA 3D67A 3BDFA 1QVFR 3FZ2A 3EICA 3P4UB 1NPRA 2GHVC 4OX7A 3M6XA 2HKEA 5KFPA 1FERA 3A3PB 1UJ5A 3IRXA 2UVRA 3EXYA 5DGAA 4KT0C 1FESA 1BXNA 5MAOA 1J2VA 2Z0GA 4K5SA 4CTAB 3HJFA 1DAXA 3DXBA 3OTOF 2XNQA 5GADI 1ELXA 1HI1A 5HP1B 1KSPA 1VJWA 4IG0A 4CRJA 4ETXA 1ZPVA 4J37A 4WBFA 2QMXA 1LK7A 3FFIB 3MR5A 2P6SA 4C8NA 3T9ZA 5D3GB 1NSPA 3GJQB 2C28A 3THTA 1TKTB 2DGUA 5A8RB 3C6UA 2LECA 1U1OA 1TUGB 1X60A 2NS1B 3KJVA 1NBEB 3C66A 5B0DA 4KY3A 1SV5A 1Z2ZA 2K06A 1SBRA 3G82B 3KLFB 1R7IA 2FHJD 3GB0A 2B8QA 1RDRA 2OELA 3PW4A 5IC6B 3IM8A 4DHVA 4EGLA 2ZHAA 4ELUA 4LF8J 3KLEB 2DXDA 3RAQA 1SL1A 1IBMF 3EVOA 4DR1F 3JAMY 5G4DA 3K8WA 2YWGA 3D4JA 1SUQA 3T1HJ 1BQNA 2CQ2A 3BPDA 5FIIA 3IO1A 2HSEB 3Q8PB 4HLBA 1QTNB 1UZDA 1LWEB 1S77D 1AW0A 3E01B 4PR6A 4TQSA 3JSYA 3GFXA 3QATA 1KQFB 1WC3A 1D9FA 3R5CA 2B5JB 1CG2A 4N47A 1X5TA 3M1VA 1VI7A 4QYZJ 1FK9B 3AODA 4J90A 1EB0A 4XDDA 4LRCA 5CYQB 1VQPS 1OSDA 2DNNA 3MR2A 4QR0A 2LQBA 2GO9A 3MM5B 4JI7F 3IGVA 3U1LA 1NB2A 1C4AA 3LUYA 1IKWB 4ZVUB 1YLXA 5B0EA 5GAGI 3F73A 3K5NA 2XS2A 3V4IA 1J27A 1SH3A 1NSKL 2F9JA 2WW8A 4N8OA 4Y00A 3IN5A 2Y9HA 2DR8A 2XRGA 1B0VA 1XR6A 2BZ2A 1VMBA 4P2SA 4JI2J 3H42A 4GO5X 4IOBA 2AZ3A 4ZPCA 2B4OA 3P45B 2VONA 4WE1A 5C25A 3I55S 2JOQA 2KXFA 5LL6d 1YGYA 1U6FA 2XM3A 3NLCA 4H54A 4UUWA 2QZ8A 1O6XA 3UVJB 4ETZA 5F9LA 3HHLB 3BREA 3BKTA 5CQGA 1KHJA 3TG0A 1YRTA 1S99A 2E66A 2X1GA 1FD2A 1W25A 3BH7B 1OSCA 1E6YB 2VFTA 5DDRC 2QC3A 3TQEA 2W9BA 3MEDA 2W2PP 3D0GE 3D6TB 5IWAF 3N6MA 3ZNJ1 2XY6A 4X62J 2RVJA 3MEDB 1HKAA 3ZO7A 2L9DA 5ETOA 4MKVA 2HRYA 1VQYA 3WBZA 2EFNA 3WIUA 3DLGB 3QIPA 5IQ6A 4A8SA 2QYGA 1R8CA 2ACYA 1DLOA 2YNGA 3TARA 3IWNC 4J9VA 1P9QC 2VQFF 3DCAA 1EETB 1SIZA 1SQGA 3KFWX 1S76D 2G0JA 3PYFA 1BQXA 1DBDA 3QYYA 4ED5A 2ZKUA 3EGWB 3NP5A 1NJZA 3RRHA 1ZZFA 3Q86A 3JAMU 4DS5A 3VAKA 3KDOA 1D0EA 2YQ3A 3FSYA 4U9RA 8RUCA 3JSBA 4B9TA 2HLUA 3ZZPA 4FYXB 1JJ2R 4AT1B 1E33P 4ED0A 4MY4A 4LIWA 2GAGC 3AY0A 3FDSA 3UD3P 1W26A 3IDDA 2KM8B 2HHUA 3B8HA 5T41A 1Y0HA 5DETA 3D2WA 2M8HA 1HPZA 3Q2SC 1VQ9S 3HLUA 2X1BA 3K5MA 3CMAS 1C0TA 5J2QA 1N4LA 3D6HB 3OBIA 1FRMA 2PO4A 4F2RA 2EBGA 1MMLA 2QE5A 2AYBA 3CNQP 4MIAA 2W5WA 1IKYB 3DXSX 4B3TF 3BQ1A 2PDAA 4CYUB 2H3EB 1F1BB 1F3VA 4Z7CA 1Q95G 1AUSL 1NNDA 3MOZA 3SIPB 2XQCA 4A8FA 3MPDA 5D6GA 4OMFG 4R8UB 2MQLA 1ZTWA 3KG0A 1TZ0A 3TWZA 4QW9A 1S97A 3CCUS 5G0RA 1EAYC 2XGQA 1S5ZA 1WKLA 4DMZA 2NR0A 4OL8A 5IC4B 4X64F 1TL4A 2BJ9A 2KVIA 3OTCA 3IS9B 4WP9A 3FBFA 4TXSA 2BOAA 4ZCKA 1RE1B 4RW7B 2IC3A 5HROB 1FA0A 4EYIB 1UA0A 4ZVQB 1C1BB 2CA9A 3SQGB 2PC6A 3VQTA 4F04B 3VGVA 1CJVB 4WK3A 5BR8F 3W5YA 4DSEA 1ZTTA 2AP6A 4HHUA 1M1HA 2FZCB 2W01A 1HNVB 1JLGA 3I6PA 4I6WA 5AJ3J 1T3NA 2CDQA 1HYSA 3H5UA 1JNZB 3LGNA 3MI7X 1VQ6S 1TKZA 4PG4A 3MECB 3HK2A 2O3DA 4J9QA 2GCFA 2GGPB 1NU4A 3MM6B 4J5OA 4USMA 3TRGA 2DH9A 3TANA 2W8KA 4BS2A 2EFOA 1SI9A 1FNOA 2BM1A 1WSRA 4H4KC 3VAIA 5LSRA 5C42A 1B8JA 2C2DA 2YH0A 4NXNJ 3RYLA 1KVIA 2AKWB 4GKKJ 3DRXA 4E8UA 1CSJA 2N7CA 4QWEA 2EK6A 2KVQE 3BS9A 1VC5A 2DCLA 2DD8S 2JLFA 1RTJA 2GQ2A 2LQJA 3OR2A 3EPIA 1PILA 5ETVA 3NCPA 2QTWA 4YQWA 4KTQA 5D8HB 1AXQA 1FRXA 1QLNA 4ENOA 2ZHBA 3BDGB 5EGHA 4ZIVA 4B3MF 4KRWA 2EBEA 3OTDA 4JI0F 1FKPA 3PJXA 4DR1J 2CG4A 4JI7J 3OJUA 2MKHA 2FVQA 1Y10A 3D0IE 3T1HF 1XC9A 1NAQA 4F4ZA 2MXYA 4B3SF 5L39A 3I56S 3ZTOA 3U1MA 1L3TA 2QGFB 3CJ3A 1J5EF 2YNGB 3BBFA 4KC5A 4ZHRB 2HVDA 2A3JA 3H0PA 3GV5B 4JV5J 1FWLA 2YKPA 2VC0A 3IM9A 4IFYA 2BYCA 3ILLA 3HP6A 2GMHA 4O0NA 1WNEA 2ZZNA 2NSCA 2MY7A 4LF9J 1HW8A 2WBMA 2JSXA 2R4FA 2QA1A 2DTJA 3D3BJ 2A2DA 1BUXA 2F8MA 3DLKA 5HMWA 1VK3A 5I3QA 1U47A 1SKRA 2E44A 2YPZA 4EEYA 1RAAB 2GMJA 4QIVA 4BCAA 5HLFB 3NKNA 2JEGA 4J9SA 4NLRA 4FYDA 4ECWA 2ADBA 3ONQA 5A8WA 3KLGB 4KE5A 1TV6A 7AT1B 4JP8A 1WSVA 2QL7B 1M0SA 2OH2A 2DY1A 2WHOA 4OI1A 2IRYA 3R9LA 4ES1A 3HPOA 2M52A 3MM7A 1SC6A 4TNOA 1YITS 4IG0B 4Q44A 3CF5Q 3HI9A 2RB7A 3M8YA 1DURA 2OI2A 3IGZB 2CRLA 4NMLA 4M95A 4FBTA 3TOQA 2CPYA 5LSLA 3EGVA 3M8ZA 3D6FB 2B9WA 3R5GA 2CPEA 5DQHA 3T5HA 1F5BA 1MROA 3QJLA 2AW0A 3KJQB 1LWCA 2NXJA 2C3UA 3LP1B 4P7TA 2RQ4A 1K8AT 2DR5A 2EG1A 3PIPQ 1XK8A 1HHQA 1F5CA 1QSSA 1BE4A 2YNIB 2LEPA 2JRSA 3KKFA 2ROGA 4RBUA 1KOOA 4I2PB 4E2FB 1HWUA 4I0WA 1HQUA 1TUWA 2C1EB 2DK2A 2HWIA 2QMWA 5CCMA 2WVDA 1WC0A 4D3GA 1LWFA 2Y8YA 4A8KA 1WJ9A 3GE9A 3ZNUA 2D3O1 3MECA 4FS2A 1Y7AA 1VRTB 3CMQA 2F5GA 4IOAQ 2ZWOA 2KRBA 1X4BA 1FXRA 2MEWA 3H7HB 4EYHB 2XB2D 1H6KX 3EGZA 1GMVA 4DN9A 1VRUA 3VGSA 1FJGF 5J1PA 2A18A 4DQQA 1N34F 3TZZA 4F3MA 2UVWA 4QBUA 5GAEU 1X9SA 1U6BA 4HT5A 2E1RA 1UA1A 4QU6A 5ITHA 4FF3A 2ZFHA 2BJDA 4ICLA 2I0XA 4N77A 2ZD1A 2BW7A 1RUSA 3FQLA 1VQ4S 1S6OA 1N6QA 2AYMA 1XNRF 4R0EA 4N5SA 1BC6A 1F6TA 2RDIA 2PMWA 5IT4A 2RHQB 2MZSA 4XDCA 1NKEA 1U8WA 1CC7A 1YRXA 2EPIA 2LVWA 3HFZB 1OO0B 3IBWA 2LQ9A 2H5EA 4KGXB 3Q8SB 1WEXA 1XN9A 4TU9A 5C2CA 1HBMB 4MJKA 5IT9Y 4BWJA 3CDUA 5CYMA 1C2PA 4NLOA 3G4SS 3PHEA 1OMSA 4YFUA 3M32B 3L4BC 2HNDA 3DLJA 4ZA1A 3M2UB 2MQQA 2R2RA 3QFHA 2ZJQQ 2XY5A 1KEKA 3LPEA 4G65A 3W9IA 3CW2C 2IVMA 2Z4PA 4DV3F 1TR0A 4PQUA 3H5YA 3LGHA 1OPZA 3VZIA 3DC2A 3H40A 2ZH9A 3BQ2A 3CJRA 4ZKAA 1HBUA 4DCJB 4X4PA 2AGQA 3GMGA 2LDYA 2UUBF 1H0HB 1S1UA 2KXHA 3DRSA 3JSMA 1ELYA 2DHXA 2JNJA 4KAVA 2RJZA 1X0FA 4AUKA 3IRXB 1S79A 4J9OA 3K57A 2QJ3A 4NI2B 2ZH1A 1Y3JA 4OZ1A 4DR3J 4FYYB 2YWWA 2RH3A 5FDLA 3QAUA 1IJEB 2KT5A 5LXYA 2B6AB 4G1PA 3P8BB 5DO2A 4CNZA 5A0YA 1R3NA 2BXJA 4DPXA 2AYEA 1FDDA 2NYIA 4CO5A 2A10A 3M6VA 2CJ9A 3WZ0A 5KG5A 1GH8A 1S7IA 3UPFA 2FVSA 4ZOSA 4L75A 1X4FA 1TQLA 4A8OA 2YY3A 3EYZA 1REVB 3RBDA 4PUOA 4RR5A 3W5XA 3FBEA 1VIOA 4R5PB 4PUOB 1HBOA 2W9BB 5LXRA 4A8WA 1T95A 2KZMA 1XWLA 3SFUA 2IYGA 5J1EB 2RILA 1EP4B 1YQHA 4BC9A 5FJ4A 2ANHA 3MM8B 4WU3A 3TVYA 4C0BA 2C2MB 4FYVB 2CPFA 4EBDA 4O3NA 3CCRS 3LALA 2YX4A 2W5VA 4ZVHA 4FF2A 2Q43A 1HBNB 2BE9B 1URRA 2VFRA 2WSEC 3GJRB 2CXEA 4YB7A 4DU7A 1MWZA 1RADB 5ETRA 2RKIB 1RA7A 1VIXA 3PRBA 3TEHB 4UOHA 3CWJA 3D9BA 1X8DA 4JOUA 4J9PA 1T03A 1VQNS 2NXCA 1JIHA 3M8PA 2R8IA 3M8WA 1EQMA 1NPKA 1EI6A 1KKHA 1O99A 1OQ3A 4RW8B 4DR3F 3L7OA 2RNEA 2GX8A 3ISND 1RT1B 4O4GB 2MDAA 3RJMB 5DM7Q 2ZOGA 2HMIA 1WD6A 4RUCA 4LIRA 1HWLA 5GMEA 4CH0S 4ZCMA 5KFCA 3KLHA 3B5QA 5LRMA 2OKQA 1UZHA 4LF5F 5K14A 2XMWA 4DJBA 2KXNB 3G6VA 4JI3J 1IQTA 1EHWA 3UNYA 1O5JA 2NXEA 3J7Z5 4WIIA 5KT6A 2GMLA 1HD1A 2RH6A 3KUGA 1TL3A 2ZNZA 1URBA 4WYWA 2DNRA 5DRKA 1K0VA 3SZ2A 3IA0A 4O44A 3ENQA 2G0IA 1IBKJ 1FJEB 2UU9F 1RTIB 2IVFB 1WHWA 2BV3A 1F5AA 1Q7LB 2GJ2A 1KC8T 1SUQB 1VBZA 3KLVA 2J6SA 5A8RA 5BYSA 4YR1A 4HHHA 4NASA 5C42B 2W24A 4CO3A 2R7XA 2Z57B 2PN6A 1WC4A 2I38A 3C6TA 4LRBA 4CO0A 3PKMA 1N88A 2WOMB 5IFMA 1GX5A 3OLAA 2F4VF 2XTJP 3D68A 2B9YA 4MK7A 4V1Ak 4DI6A 4LQYA 3GQCA 2EKYA 1PBAA 1RT6B 2KZZA 1RKIA 4X4UA 2CQIA 2YBVA 3VAJA 2R3VA 2OJ3A 1EW9A 4RNMA 4K4VA 3CJ8A 4Y65A 1XR7A 1G2EA 3IXQA 1VHFA 2EEYA 2K7KA 3A3OB 4M5DA 3V6KA 1AZSA 2E9ZA 1EW8A 2ZBPA 5D0GA 1R0BG 2B3TB 2VF3A 2VKZG 1JLAB 1WACA 2V8VA 3CDEA 4NA3A 3RRGA 2IUCB 1N34J 3IMQJ 4DR5J 5JVGQ 2R2SA 3NWGA 3EUNA 4IO9Q 2EWHA 2ZC3A 1MROB 3AT1B 3DOKA 2QV6A 3KWMA 4ZN1A 1JXEA 3VAGA 4LQ9A 2IMOA 2CPJA 2VG5B 2VPZB 3R3TA 4LVOP 1EKSA 1N5QA 5B0BA 8ATCB 5J1EA 5LOQA 2B7CB 1JB0C 1LXJA 2HAIA 2Y1JA 1RT2B 4NL5A 3OL9A 2ZH2A 4A4JA 2NREA 3OQ2A 3QFWA 3NMAA 4QIEA 2XEXA 2N3OA 2M4MA 3HHNB 4H4KA 3I82A 2H4YB 5A2QU 3PXGa 4B9VA 2CPZA 2OPQB 2ATCB 4V19X 1ALJA 3MUVP 2EI5A 3EDRB 4ZN3A 1N36J 2XMTA 3BSCA 3UI3A 3ZXWA 4TU7A 3BSOA 4DV4J 1FO1A 3Q8QB 3S01A 2DJWA 2ZZTA 5H9EK 4ANCA 1EJJA 2JFKA 3CCWA 4KB7A 4S0MA 3VTIA 1ITPA 4KV8B 5CZVA 3Q8RB 2LEBA 1XNQF 1IWAA 4UOGA 4RZRA 1VQOS 3N6LA 2KO1A 2AGPA 2KHCA 3VCDA 2YX1A 3NWRA 4PG8A 4OZ3A 2XO6A 3IRWP 2WTFA 5I3UA 4TU8A 5C5JA 2MKKA 3OR1B 4PYDA 3FBBA 1UAWA 4OZJA 3BDPA 4IG3A 2DGSA 3N5FA 4PYAA 1X5SA 2OUGA 3E51A 1UEUA 3DLGA 3QIPB 4JV0A 2W7PA 2FLNA 3GFHA 4CM0A 4KJDA 4NLGA 4RW9B 4RW4B 1FFWB 1YKWA 1V6HA 4CDIA 2YKNB 2ZUGA 4K4XA 4ECYA 4AL6A 4RW4A 2HHWA 2CQPA 4WP3A 2A0FB 2W5QA 1FEHA 1FXLA 1QD1A 3TP2A 2XMJA 2XWXA 2CZ4A 4I7FB 2X1AA 4KQZA 5CD4A 3KDNA 2D1GA 1IKVA 4URSA 1N54B 3HHLA 2BKOA 2EXUA 3M8QA 4Y2AA 3DLBA 4ED6A 1IKVB 2ILYA 3EVMA 4EUVA 4RNFA 3TJAA 3GIRA 3BGUA 4PQUB 4RNNA 4ICLB 1EQJA 1YZ6A 5DZ6A 1X4DA 1RWKB 1CJUB 1VJQA 2F40A 4MFBB 1N5YB 2E1MC 1F2GA 3FEXB 2FGOA 4CYUA 4NLQA 3IR6B 3ZC4A 5DQGA 1YX2A 4CH7A 5DG8A 2UUCF 3OTBA 1HNZJ 4M5GA 2HWHA 5KFQA 3J80Y 3RAMA 2XULA 1TP7A 3PV8A 1M5OC 2AJFE 3WX4A 2E7VA 1O51A 2NXNA 2J7KA 3DDKA 3QT6A 2V5HG 3MAHA 2ZVIA 3MPYA 5F0WA 4DL2A 2GA3A 4C9DA 4OZ0A 5JMNA 2VBZA 3PW5A 5JUMA 3M9OB 2EFGA 3M4XA 5LMUF 1OYEA 1GK8A 4KV8A 4OI0A 5E3CA 4RW7A 4F02A 4ZG9A 4KO0B 1RWWB 2MPUA 4DEZA 2AQ4A 1F9HA 5K20B 4ECVA 4C97A 4MTPA 2C2ZB 4DPYA 3D3CJ 1HD0A 2MB0B 1AJCA 1L3KA 3TR5A 1KWMA 1S57A 2FVCA 3ZTRA 3GONA 4ZITA 4EBCA 4I69A 3V4IB 4HDGA 1DQ9A 4O4RA 3ZZRA 1KVKA 2OSQA 3K0JA 3G2XA 5GADU 3PY8A 2D3ZA 3JTPA 3M8RA 4UZBA 3DLLQ 1UW4A 3L95X 4EI2A 3UN3A 3T02A 3Q89A 2Q3PA 4BHQA 5E3AA 2DGXA 4K4YA 2D7SA 2W5TA 2ZNYA 1EZZB 2MQOA 2RKIA 4OZLA 1QE1A 1N5VA 3MM9B 4PWDB 3UD4P 2XGPA 2XYGB 3JQMA 4NLYA 2AT1B 4USIA 4A8QA 1JLEA 1VBKA 2RRBA 1R6YA 2XMVA 2UZAA 3G6XA 1B4SA 4QW8A 3QRPA 5B08A 1DTQB 2HEKA 3HX9A 1AT1B 3OLBA 1BHNA 5D4LA 1ZETA 3DMJB 1XMQJ 2CJAA 4HHJA 3MMAA 2BRLA 2CIMA 3PKYA 3JSRA 1LWCB 1HNXJ 3ICLA 3QWPA 4TN2A 3VVUA 2W9CA 1RB0A 4PWUA 3GIIA 1UFWA 2KFZA 2W2OP 1S6UA 2ZBCA 3EGNA 1NCLA 3R5BA 4PPZA 1NH7A 1RT4B 2YNHB 4ZJOA 3AOAA 2HHHJ 5L46A 2WSFC 1KHLA 4I56A 2DPIA 2GVDB 4AE5A 2ZDPA 4LBPA 4DOZA 4Z37A 1RK8A 3UDCA 3LWLA 4GTZA 1S0OA 3THVA 2IA0A 2PE8A 5BYRA 4LF2A 4QQBA 5KFMA 2VQFJ 3RRKA 3NKMA 4LREA 3KNAA 2ZBRA 3V5RA 4DR5F 3PW7A 3TNVA 3D66A 2BJ8A 1RAGB 1OYDA 1RCOB 2RQCA 2NQPA 4F3QA 4Q0BB 2OTJS 1CBKA 3ISNC 2KJWA 4ZLNA 1XIQA 1KS2A 3QNWB 4WJBA 1ZM2A 4C0HA 1RTJB 1QUPA 2OPRB 3OR2B 2I6WA 1WEYA 4QPTA 4BBYA 3MK1A 4J9KA 2DYAA 3G8TA 2UXBJ 5ADZA 1FSUA 3CJTA 1NRKA 5LRNA 5C25B 2VBXA 3FZBA 4Q8FA 4HEA9 4CCHA 2XCAA 4XPCA 4ELTA 2BBEA 5B0FA 1SPBP 4Q5VA 2WONB 2B43A 2MTLA 3ISZA 2LMIA 2UV8G 1YJVA 4HACB 2OEJA 2B4PA 3JTOA 3WAWA 4FF4A 4PXEA 1N56A 3AJ2A 2UUAF 5GOVA 1Y5IB 2J9DA 4FVMA 2YNFA 3KUHA 1OJ4A 3OXLA 4FPRA 3W66A 4CLLA 4DV2F 4DV4F 4DV6J 1QAIA 1FE0A 6FDRA 5KFBA 3HHKA 1WOPA 2W9AA 1UVLA 1FK9A 4P73A 2FGCA 4YEAA 5CH7B 5M2RA 2GJIA 3Q8VA 1PJ7A 3QQCD 3I32A 1QSYA 2AJ0A 2RDJA 2UXDF 3I9V9 5K9FA 1GXUA 2QLWA 1BLUA 4M5MA 1FNXH 2IC3B 2HS0A 4ZVEA 2VPXB 3POTA 3LO3A 2E29A 2W7AA 4MIBA 4LF6J 4DR4F 4WKRA 1XR5A 2RD5C 5T7LB 2E7XA 5DDOC 2W1BA 3NKOA 1TELA 3LPYA 1ZM3A 4DR6J 3UFCX 1KTVA 2GGPA 3MM6A 2YWHA 1FRJA 3GIKA 2E1CA 1T9VA 4LUBA 3GIMA 2RAQA 4ZPBA 1RAHB 4K0KF 2R7TA 2JFDA 2DNHA 2WB4A 1PBUA 1NHVA 4P75A 2AZ1A 3IR5B 3OL7A 3MM9A 3DOLB 4XAKA 2XLJA 3LA0A 3BB5A 5DM6Q 2HVZA 1C0UA 2LA4A 3C6UB 3DMJA 3CD6S 4Q2MA 4WFAQ 3PR5B 2HQCA 4Z7YA 1BQMA 4LF4J 4C3MA 4MK9A 3GTYX 1PYTA 4ELVA 2VQEF 2FJDB 7FD1A 5AXLA 3RU0A 1LFWA 1RI7A 3J7A1 5C66A 4WFYA 4NXNF 3EZOA 1NSQA 1U1QA 2Z8QA 2LLZA 4DUZJ 2UUCJ 3SQGA 1Q8BA 5KG6A 4MK8A 1RAJA 1CS4A 1W2BR 2FHKA 4HTIA 4C3KA 1H38A 4YN3B 4CXSA 2HQDA 4DV3J 2EC2A 2HNYB 2BANA 2XSJA 4B3MJ 1N2LA 1Q78A 3DN9A 2OIHA 2BQ3A 1IKXB 4Y2KA 1KQGB 2P8IA 3NKPA 3T00A 3ITHA 2FJVA 5F3ZA 1PCAA 2IUCA 2IDEA 1GMWA 2B0GA 4WKYA 5EWFA 4K4SA 3PFEA 4O3OA 4QWCA 4DL4A 3UR0A 1SL2A 5GMDA 1Q4RA 1X4HA 3ENAA 2VA3A 5AXMA 4GMKA 4NZ7A 1VQ7S 4LF9F 2G2OA 1FDNA 2N4DA 1ZEDA 1D9DA 2ZH7A 1NDPA 4PPDA 4DX8H 4IRCA 2MKSA 4ZCIA 3IBCB 2GVZB 1S12A 3OFFA 2YH1A 1T05A 2R7OA 4C8ZA 1UEVA 4JI5J 1BWEA 4I6AA 1X5PA 3EZ5A 1TV6B 4OYAA 4JI8F 3BGLA 3H59A 2G2ZA 2CNLB 4ECSA 2CJXB 4OZ5A 1MLAA 4B3RJ 4KGZB 4KM4A 4DV1J 4R8UA 4JI1J 1JK9B 4ZLLA 4I7FA 5LJ5Y 3G71S 2FC8A 3QLHB 1WOOA 2OFGX 3M8PB 3VAHA 3CCZA 4B02A 2FD2A 2GW8A 1Q16B 2JEIA 3TEGA 1CJTB 2IJNA 3VAFA 3E2EA 2ATLA 3FCWA 4HVZA 1CPZA 1NHKL 1FKAF 3C46A 1MNEA 3UD5A 1JJ4A 2W8SA 2BDPA 3EXCX 2MKCA 4Y3CA 3POTB 2CNOB 2QIFA 2E1PA 3T6BA 1EW2A 1HDHA 3OR1A 5LT5A 1GXTA 5CYQA 1KH5A 2W8DA 3A4TA 1TL1A 2FHJA 2MJNA 3TUJC 3MPVA 3SSQA 2M9KA 3NOCA 3BEGB 4U96A 1TKZB 5D0HA 3ADAC 3S7RA 5E2QA 1X4GA 3D1QA 4CLWA 2HBRB 5HRTA 2HFVA 4N41A 1VOMA 1LNQA 4QWBA 4DPUA 5F8LA 1VQKS 3P49B 3LXQA 2MMYA 4JI8J 1VQ5S 1YBAA 2BJ3A 3CCQS 2HURA 3MMJA 3V6JA 1Z1ZA 1S6QA 4N56A 4B3OB 2YKOA 5F0UA 1DZ5A 1GXLA 2NPFA 3HHDA 3A3NB 3M30B 4ZMMA 3B6BA 4LFBF 4CYRA 1YVFA 4WCEQ 3Q0AA 1KN6A 3BGOP 4NX9A 4O3PA 3W1YC 5A8KA 4DV0J 2I8EA 3TUIC 4URGA 4X66F 3C8YA 1X4AA 2M0GB 3FNNA 3E3XA 4LF7F 4K2XA 1E6YA 2FDNA 2LXIA 3C15A 4F0MA 1RKJA 1MMNA 3J81Y 4ED4A 2RU3A 2Y8WA 3NKRA 3AOCA 4NWJA 5F9NA 4ER8A 2OD4A 2KHDA 3O5TB 4YDXA 1ELOA 1WHXA 3OUYB 4LR7A 3UVJA 4O23A 2RMLA 2NPIA 2MQPA 1D8YA 3MURP 5F8IA 4F4WA 1CC8A 2BANB 4I67A 1OQ6A 2V2QA 1ZOTA 3QT8A 4X4QA 1SC1B 1FD8A 1ZZNA 2FYXA 4F2SA 3MXHP 1OY9A 2JLGA 2QA4S 2IM3A 2C3OA 2Q6CA 1SC3B 1N52B 3MMBB 3FJ2A 2J7UA 2QO3A 4LF6F 1SCJB 2DNZA 4J91A 4ID8A 1M5SA 5E3QA 5CAAA 1LKZA 2HS4A 2RRNA 2KG0A 1T05B 5INHA 2J0WA 5AE1A 4DV0F 1RTDB 3IWLA 2KTQA 1XJWB 1FFSB 4OX6A 1TL7B 3GSDA 3V2UC 1YJWS 3DLEB 5KFTA 1SJFA 1NKCA 1RTDA 3CMES 3R7SB 4NCGB 1KHKA 4CXUA 1C0TB 3HFVA 5J2QB 1VRUB 2CQDA 4CQ1A 1U2FA 4LT6A 5M2UA 2DHAA 1KDNA 1RU1A 3N79A 1S4FA 2KN4A 5D4NA 1JNRB 2IVYA 1O0PA 4L6V3 4P72A 1RT3A 3MTJA 2VD3A 4ECRA 3FEZA 1RT5A 2MQ8A 2OMOA 3MCMA 4AXJA 3ENVA 3AQPA 4FXVA 3L3CA 2L9NA 4F0KA 2FVPA 4TLQA 2HNZB 2YX7A 4H4MB 2RUGA 2YNIA 3R6LB 1EJ7L 5HSPA 3CCSS 4K7QA 1KLNA 4GTYA 1B70B 2LDIA 4WK1A 2VH7A 1HQEA 3CDWA 1R0CB 4H4OA 4LR2A 1UJ4A 3V81B 4DL6A 4LR9A 1DLOB 4YB1P 1KRPA 3CEDA 2JEFA 2XMUA 3P6YC 2R7RA 1Y11A 4C4WA 2CJYB 1VRTA 4X84A 1RAIB 2PEHA 3EX7B 1E1ZP 2G0CA 1RT1A 4O4GA 1Y3KA 4QU7A 2HS3A 4TLRA 1BGXT 2HIQA 2XWYA 3GG0A 4F25A 1VHIA 3W62A 3H2LA 4LRFA 4LBIA 3IWXA 4GC7A 1VQMS 2YQ1A 2HQGA 5K14B 4FVCA 3DRPB 4FNHA 4Q2LA 3J81j 3T1YJ 1GT8A 1RAEB 1S7HA 2XLKA 2HHXA 2MQMA 2PMHA 5KFEA 2V63A 1S6QB 5C7PA 4QWAA 2CJKA 4MKBA 4F3OA 1F2HA 3R1LA 2AF6A 3A12A 1FT8A 4MYUA 3GV8B 3DOMA 5HBMB 3DGVA 1PO6A 2DR7A 4KHPF 5T7LA 1VK8A 2K1RB 1JWWA 4A8MP 1APSA 2JH3A 5IV3A 3C19A 1TL3B 4OYWA 3AD9C 1SKWA 5EN1A 4KKOA 4GKKF 4CT8A 2ZZMA 4J9NA 2MHNA 4KAIA 2MJUA 1RP5A 2CZ9A 2G9OA 3IAM9 1VFJA 4ZCLA 1PAEX 2VKRA 3GFZA 1DFDA 2ZBIA 5KFAA 1ELZA 4RNOA 1Y7PA 3FC9A 4DR2F 1X9WA 4RX6A 3WAXA 1H2VZ 5L38A 2RT3A 4OHXA 3M2UA 4Y28C 1JXLA 2K7JA 1QAYA 2BM0A 3W65A 3KJVB 1TKXA 2ERRA 1J5EJ 1ALHA 3DPCA 2DCUB 3PTWA 1SJ4P 2W2NP 3HD1A 2U1AA 1G4CA 1JJHA 3DLKB 2VZ9A 3UDLA 5I42B 5K4PA 3BKFA 1S9EA 1WC5A 4DFMA 3SZZA 2VJVA 5KFIA 4NXMF 4NLPA 2LYVA 2Z2LA 3C14B 5HQLA 3CIZA 4LQ3A 2QLJB 3PX6A 1KNZA 1ZPWX 1OWXA 2GS8A 1Z2LA 2PEBA 3NXZA 3PHTA 1UMJA 4Y2CA 3MF5A 2L08A 3NG8A 1JX4A 4IYQA 1ZM4A 3CJ4A 5KFSA 3PO5A 3QZ8A 3FUYA 1F9EB 4CNYA 1RA6A 2EVZA 4WTOB 5HQ8A 2LXFA 1QTMA 2LCWA 3T9NA 1JLCB 3SCLE 4XIUA 1SVDA 3MK2A 4OYXA 1U0HB 3F56A 1NSAA 3PRVA 4HL9A 1BQMB 3G87A 3BF4A 5KFZA 3D54A 2KI2A 4DL5A 2P5VA 4PKDB 3W9JA 1WOSA 1CVJA 1T9YA 2XZWA 4LF7J 2HHSA 4ES3A 3H25A 1P1TA 4H4MA 3TUZC 4MFBA 2KU7A 3I87A 3QWUA 4ID5B 2AEJA 1P27B 3SDEB 4DLGA 4NE9C 2HQFA 3KNGA 1XERA 2CQGA 3RR7A 2VODA 4I64A 3WDOA 4I6YA 3KLIB 1BWVA 4DV5J 5F8NA 2GSUA 2CFXA 1DTQA 4JI6F 3F41A 4KFBB 3SEOA 5I4MA 4O3QA 4F4XA 4U95A 3K17A 2HRUA 4LF5J 1AROP 1JQGA 2W7OA 1V5VA 1T02A 4DU8A 4M5DB 1WEZA 4DSJA 1S1TA 2ALYB 3DGPB 2BOPA 4LF4F 2JJ4D 1AA1B 5D77A 3GV7B 3NKYA 2QL9B 4ZPDA 5AXNA 4UUXA 2V69A 5HROA 1DJ0A 5L0EA 2HWTA 1SJ1A 3DRRA 4JV2A 1C1CA 5B7WA 2L48A 1ZAVA 4IRKA 4I2PA 3GJSB 1CLFA 7FDRA 4G1QB 4MMOA 1PYOB 3QSIA 2KG1A 4WZQA 2ZE2A 4ZPWR 1BY9A 1S6PB 5ETSA 4M5IA 2KJVA 1JLBB 1KTQA 1SXLA 3P5BP 1TL7A 1NK0A 1N8RT 1N6QB 1S6PA 3I5BA 5EGEA 4R0JA 2V2KA 2VOOA 1CQNA 1VYAA 3B82A 4KHMA 4M63A 1Q8KA 1JMTA 2Z30B 4ZJLA 4C48A 1MSWD 2XZTB 2E9RX 1AJDA 1GMUA 2IY5B 3W63A 5IT0A 2HK2A 1RT5B 2XHCA 1IJFB 1XNRJ 3VVTA 3W5ZA 1JLFA 3KK2A 3BR9A 3T41A 5ETPA 4JI4F 4ZLPA 1N2KA 2PIIA 4DR7F 2FJAB 2YWFA 2M5YA 2R7WA 4YY3J 2GZOA 3OJSA 4AD6A 3C6TB 3F44A 3TZWA 3K5PA 4CLFA 2UUAJ 1AB8A 1LW2B 2WONA 1HQUB 4FS1A 1SB6A 1UVJA 4NLTA 4PRFA 1KHVA 3EWGA 2HGMA 2IAJB 1MN9A 2W8LA 4X4OA 2CQHA 1V3SA 2MYFA 1N32J 3GJTB 4DZDA 3BO2A 2V67A 3LF0A 4HI1A 1M5HA 4OHVA 2VDHA 4RW8A 1K7HA 2B56A 3HVRA 3BO3A 4M8LA 3U1NA 3PJWA 4CI0B 4YOEA 2VL1A 2ZDOA 1HQ2A 5K8MA 3GR0A 4D3HA 5KXAA 2FUG9 3RB6A 5AJ9A 1FXDA 1YK9A 3FSIA 3MCNA 1HBUB 5KTQA 4WF9Q 4UW2A 4DG1B 3BZQA 8AT1B 1P1LA 3EM1A 2G2YA 3M8SA 1EP4A 4DFPA 1N33J 3WQPA 3NNCA 5H9FJ 4DG1A 1S1VB 2GVZA 4QR2A 5M2PA 4YY3F 3KLGA 1RHJB 3FEYB 1KH4A 3Q2TC 2KM8C 1H72C 2W4DA 3NAHA 1I6JA 4NCGA 2ZC4A 2Y3YA 2VOPA 1FCAA 2DXFA 4OZ2A 3K7RA 4P71A 3G96A 5J2NA 1MW7A 4WE1B 1AJAA 2VQEJ 2CQ1A 3S1TA 1TFWA 1HA1A 1UWAA 3GR1A 4CIOA 1AUDA 1N32F 1SC4B 4LSLB 2JL9A 3HHLD 4W98A 4PWWA 2WRMA 4C8MA 1L3SA 4ILMA 3EPGA 1V3RA 4CWBA 4KJGA 1R0AB 3CGIA 3DI6B 4NZ0A 4C8KA 2CAJA 3JTNA 1IXKA 1IWGA 2AHOB 4GTXA 4DUTA 4IR9A 3ETMA 3T1AA 1C1CB 4KPYA 3MR6A 1LW2A 3TA2A 1ZAWA 4YHHJ 4AXIA 3MFIA 5IT9U 1NK8A 3BJYA 3QRQA 1JLBA 4LJMA 2VV5A 3ZZ0A 1IR1A 3K59A 1RWUA 3PDNA 5HVGA 4USKA 2CQCA 1X7VA 2G13A 2CQ0A 3C3LA 2ASJA 4UORA 3PO4A 4RU9A 4RU2A 3CSKA 5H1SV 4OLOA 3A8IA 1UPMB 2I9SA 4U8YA 3ITHB 4OJHA 3OL6A 1U1PA 2WVEA 3CJSA 2ZVSA 4OJ3A 3GFYA 1UPPA 3QLHA 2YWKA 5AXKA 4A46A 2FJWA 4JI5F 3RW6A 4QOTA 3N01A 3M30A 4QIFA 2ACMA 4B9MA 4G6VB 2H51B 4ZIWA 3MOJB 4ZJQA 1Y4ZB 3QGGA 4EWTA 1KH7A 4OI6A 5IS2A 1WG4A 2AMCB 1DQ8A 3GWCA 3GLJA 3KHHA 3NKQA 4DPWA 3TX8A 4JI0J 3IGYB 3Q23A 2MZJA 4ZP7A 5KT3A 2LXUA 1T7PA 5CYMB 3NNAA 2MLXA 2PGCA 1RTHB 1OY6A 1IR2A 1LW0B 4ED8A 2AV5A 5HJYA 2HVHA 4FF1A 3WBHA 2YXLA 4K8RA 4OI3A 1HNIA 2JEJA 4C8LA 3LAMA 2HIYA 1GTHA 2EW9A 2QX0A 4ZP6A 4BC7A 4DDFA 1S9FA 4B9UA 4FN5A 5IWAJ 1FRLA 4Q43A 4X2BA 5L0BA 3D0HE 1NK6A 3BBBA 2AWZA 3J7YI 4M5HA 2LU2A 1U8SA 3Q22A 1U09A 2R8HA 5DLTA 3HF5A 1L3VA 4RO0A 2PI5A 3B4MA 4L3NA 4QZVB 4Q0BA 2E5LJ 1DARA 2X51A 2OTLS 3NVLA 4GRSA 1U1NA 1U1RA 1TTHB 5DJBA 2C22A 4RLEA 4OV1A 1N5TA 2R7SA 3CCTA 4KIAA 1S1VA 2W4CA 4HR2A 5TJ3A 3H98A 3NBPA 1NDKA 2QL5B 3KHGA 3MD1A 2F1FA 3PX0A 1VQ8S 4MKAA 2C2RA 2RU9A 4CP5A 1HFEL 3QO9A 4ECQA 3MUTP 4E0DA 2QZUA 4UPKA 1UVKA 1GMWD 2J8AA 3QGHA 5GAHI 3WHIA 3RBEA 1HNXF 2AJ4A 3AB4B 4HACA 4O3RA 3G6YA 3PG9A 4EO8A 2YKMA 1T94A 2WSCC 4KYZA 1HWIA 4RPFA 4RWXA 1RXOB 5HO4A 3OHAA 1LV5A 2IJFA 5H9EJ 4L74A 4DPOA 4IFVA 1VGYA 2OHDA 2OPSB 5AE3A 2JX2A 3OXFA 4E98A 3TO8A 4IFVB 5I42A 2LP4A 1YSJA 1Y5NB 2RS8A 1FHTA 5CA5A 2HNYA 1Q5YA 3ZZTA 3RGIA 2B7BB 2RF2A 4F26A 4GO7X 4X65J 3MUMP 4EU0A 4U67Q 3BDHA 5SUHA 2DT9A 4ILRA 1NZ8A 2YKNA 5KFUA 3CCLS 1U49A 2XNRA 4U7UD 3SFGA 1DTTB 1EARA 4RW9A 3T19A 4P9SA 3L09A 1UFLA 4EZ9A 3ZTPA 3NCRA 2CDRB 3PM9A 1Y00A 3PJ9A 5KFKA 2ROEA 1B3TA 1RABB 1S1XA 3FFIA 3G8QA 1SQFA 1U26A 3PIOQ 5D3GA 1AFIA 3GSIA 2P9CA 4RUHA 1TVRA 4J9RA 1KR4A 5D4PA 3QRRA 4X4RA 3KK3A 1FFGB 2HFZA 2V6AA 2FIUA 2GNKA 1HR0F 3LW5C 1NJWA 2DB1A 3LP0A 2VG7B 3M9NB 2ASLA 2UVVA 5GRRA 1SV5B 2JWNA 2WZ1A 1K1QA 1YWXA 3MMCA 1HQEB 1UEKA 2PD1A 1A0OB 3BKUA 4DX6A 3MMCB 5KOXA 3NAIA 2DIUA 2IAJA 3W61A 4YUDA 4F8RA 3KLEA 3H8YA 1U6ZA 1S0NA 4DFKA 2OFHX 4F4AA 2P6TA 5AE2A 2VFSA 4X65F 2GHWA 4RKUC 3KUEA 4YDDB 1YZ7A 3RBXA 3DU6A 3SMZA 2HNDB 5ETNA 5CABA 1A7GE 3NGDA 2P9GA 5T14A 3H5SA 4OYOA 3GZ7A 1E6VA 3K58A 1U02A 2MSTA 3O2IA 5K8PA 1ALKA 3T5JA 4IDKA 3VR1A 4Y6IA 1HLWA 1E6VB 2V8DA 4N76A 1N5SA 2V34A 3PCOB 3ZZOA 2XCPA 4DR6F 4LFCF 4LSNA 1SHQA 1HMVA 1PIEA 2HFSA 4DQPA 5EGYA 4ANDA 3G9CA 2PSZA 4PXCA 2LKZA 4TY9A 2Z2YB 4CLYA 5L1IA 4A47A 3PX4A 1M5PC 3D6MB 5B09A 5SZTA 5L8RC 1XMOF 1GNKA 4B9SA 5LJ3Y 2VU5A 2DGWA 4FDJA 4GVBA 3M2RB 3OTOJ 5J2MA 1WHVA 2CNKB 2DGVA 3HZGA 1RWPB 3OVAA 4TY8A 4CO4A 5KFJA 2LQ5A 2NXUA 3KHRA 4PQAA 2HFNA 1S0MA 1X4EA 4NRTA 4NWBA 3CJKA 3J7ZT 3RB4A 2MLZA 3HVTB 4U7UK 1AUKA 1PKUA 3KLHB 1S72S 2W5XA 4JV1A 4FPIA 2GIQA 4DX7A 4PWDA 4ZP9A 1S1WB 1YJRA 2R9LA 4J9MA 4NWXA 3FMBA 2XLIA 3MCSA 1S9GA 2MGZB 4L72B 5GAGU 3R2DJ 3M05A 1D9AA 4ITSA 3QSYB 1ROFA 2YKQA 3EDQB 4C2MA 4FXDA 1CJUA 1FTCA 2FJEB 2XS7A 1G3OA 1RT7B 4LFBJ 3PEHA 3DRYA 1M5VC 5LSOA 2XMAA 1M1KT 4WU2A 1IBMJ 1QY7A 2OGUA 4F36A 4CO2A 4LFCJ 1HBNA 4ZPVR 4DXLA 4PG5A 1R8AA 3M9MB 2HRTA 3AXKA 2NZCA 5A6PA 3J80U 1WF2A 3W2WA 1I94F 1Z4UA 5ETKA 4WYLA 2L41A 2VPWB 2ZH6A 3I4HX 3KTQA 4IOCQ 1TK5A 2W5RA 3KHLA 3DFEA 3BSAA 5HJXA 2VG6B 5H9FK 3AAWB 3TX0A 3BM7A 1H98A 2VBWA 2WAQD 3JQKA 3N0VA 2J9DE 4LRDA 1URNA 4YMEA 2DNOA 1HNVA 3CJ0A 2ABYA 2M70A 1IVZA 2Y0BB 5KG7A 4K4WA 1FWPA 1B0TA 2XY7A 5A8KB 4OHYA 2CKWA 1RT2A 4XK8C 3BSNA 2CYYA 2CJBA 2FY8A 1NDCA 1YBUA 2P9EA 3U27A 1HI8A 5BXIA 1WF1A 1P8GA 3SQOP 4GC6A 2V68A 1TK0A 4PXBA 4P10A 1QVGR 2A2CA 1AZSB 1WTFA 2CUYA 1FJGJ 2AJ1A 3PEJA 1WC6A 2KKHA 2B6AA 2MZ1A 1K73T 4M5KA 4B9LA 2O67A 3KLIA 3MDFA 3DDIA 1HHSA 4DV7F 1VBYA 5IJQA 3VGTA 1CJTA 2Z2ZA 3LH2S 4K4ZA 1CULA 5IZHA 5A76A 3TW0A 1RWVB 1IQZA 2MSSA 4NLDA 1SHNA 2R8GA 4EMDA 2G1HA 2HK3A 3RB0A 1I94J 2UXCF 1SIWB 4R5PA 1YHQS 4DF8A 3ZZYA 1S4EA 2I5JB 3A1YG 4OX9J 4KJIA 5MLCV 1C1BA 5KFWA 2DVIA 3V4MA 4UY85 3HT3A 1VQLS 1T9TA 1EQ0A 1U7LA 4J9LA 3VZHA 1RYRA 3IS9A 2CADA 4DV2J 1ZAXA 3N9UC 4DV6F 1AYEA 5DS7A 2V8PA 1TFYA 4WZMA 1VC6A 1YJTA 4C7QA 5EX3A 2Q79A 2VPYB 4HTJA 4NA1A 5J1NA 4BWMA 4ES2A 2UXDJ 1RWOB 2QG9B 1IKXA 5J2MB 1KQSR 3W2WB 1WC1A 5F41A 2QA4G 2CVIA 2Y0SD 2IA6A 4YS2A 2XMKA 3H20A 1BMQB 2H5IB 5E7OB 2D41A 4M1KA 3EVWA 5E0OA 5U47A 4URQU 5ETQA 4DQSA 3R97A 5LMNJ 4AQYJ 3EMTA 3TVKA 3BGFA 2XS5A 2ZE2B 3H2UB 1FX4A 1B0PA 3GG1A 1TAUA 2QFJA 6AT1B 4KHRA 2IBOA 4K0KJ 1HPZB 4RNHA 4NEYA 3UN5A 5EDWA 2D69A 4U6PA 2N3LA 2ZM6J 1KLMB 4X4TA 2PT0A 1UW9A 2G1DA 4LBHA 3CD5A 2OLWA 3HKZD 3L7UA 3DLHA 2HBQB 1HBMA 1NDLA 2X3DA 2BABA 3BBCA 4N8NA 2OMLA 4NYOA 4PG6A 3JS9A 5B0AA 4B17A 2KDOA 3V81A 2Y1IA 3QPIA 1H73A 4DZ6A 4LVNP 2ZH4A 4ECUA 2DO4A 1RCXB 2OAUA 5G0RB 3ILOA 3OT9A 4QWDA 2HG4A 2K3KA 2MKJA 2H5JB 3ETOA 3R5DA 3DHWC 1KP6A 2XSJB 4M94A 2KFNA 2KYZA 3EJMA 3KD8A 3M2VB 1UWBB 2UUWA 2VFVA 1P49A 2HBYB 3PYEA 3MAAB 1Q8LA 1SJRA 2DR6A 2IM1A 3KYLA 2QSFA 1V3ZA 3TUPA 1ED8A 3KG1A 4LSNB 3UE2A 2F65A 2XBPA 4DN0A 4V19J 1KH9A 4RJVA 5ETLA 4KGMA 3RR8A 1X0PA 2V9KA 2CVEA 4FDFA 4JB8B 1PG5B 1RT6A 4K4UA 4X4NA 4PEOA 1FDAA 4B08A 5EWEA 4DF4A 1XMOJ 2D74B 3FSXA 3CMRA 1MMDA 1DQAA 1RWMB 4FKXA 5HK4A 5F8MA 1TAQA 3DM2A 2ZM6F 1DTTA 3PW0A 3TAQA 3A8EA 2M8DB 1Q8IA 2WVCA 1RHRB 1T9XA 3HFKA 4UT4A 2C2OB 4QIWD 1UVMA 1S0VA 3NGTA 3A52A 2N82B 1B7FA 1CEZA 2W25A 3P96A 2FJXA 3G8SA 2ASDA 1ZH5A 4AL5A 2O1PA 3LP2B 1X31C 1RBOB 3BYRA 4C8YA 1G7CB 1H2TZ 1S49A 2XHWA 3LP1A 5THWA 4F4KA 1R8PA 4DV1F 3CIMA 2PFDA 4UZCA 4JI1F 4NRUA 1EKRA 2GSNA 2VICA 2R7VA 1PJ6A 4FP9A 2HNZA 1TKXB 3B54A 3MEKA 2UU9J 3L7PA 5E33A 2IIHA 2MZRA 4NLXA 4RUBA 4WFZA 5HQMA 1RQ0A 2DBBA 3CJ5A 2UUBJ 3AQOA 3JXOA 4PG7A 1IBLJ 2GFFA 1RGVA 2BX6A 3W8PA 2F9DA 5KG1A 3T1YF 5GAHU 1WI8A 3WX8A 2AYGA 1D3WA 3PRDA 4UPLA 2J0SD 4JBCA 2HMIB 1E2SP 4KFBA 3HD2A 4Q7AA 1R8BA 4TY8B 3OSNA 2DHHA 5KT5A 3HSGA 1WKKA 4ZVSB 5J2PA 1KOHA 1JLAA 3I31A 4OI2A 4DL3A 5DDPC 2M88A 3FK4A 1GAOA 3O6QA 3IBFB 3ENWA 4I2QB 5KFYA 1FTRA 1HW9A 2B4VA 5D0EA 1FDBA 2DNMA 2EFPA 1FEEA 3PNIA 2H65B 2FTRA 4PAAA 2A1BA 1RHMB 3NL0A 1WWHA 5EWGA 3I0RA 3B4DA 4QIGA 4NI2A 3S8SA 4P7VA 3UCUP 2AU0A 1ANJA 5AT1B 3QAEA 4WWSA 1NHUA 2BE2B 3NGKA 2DKOB 2XYHB 3T01A 2BR0A 1WHYA 4DCPB 4DR2J 1WDTA 4WFXA 4LRAA 3W64A 3IFEA 2E7WA 3ZZZA 2ADCA 4C6AA 3AXMA 1JLQA 2W2QP 2V94A 1KONA 2KRRA 3MWBA 5DQIA 4DV7J 5JJBA 2HW3A 4Y2MA 4W92B 3OUYA 2DITA 3BR8A 2UV8A 4W90B 4OJGA 1JLEB 4LF8F 2OD6A 2YPYA 3I0SA 4DL7A 2AGOA 3TQ1A 3W2VB 2DRDA 2IHR1 3FQKA 1FJ7A 1ZM9A 4M5NA 2MHEA 1R0AA 2F8HA 3VHQA 1VRQC 1N0UA 2ROPA 3A8KA 2X1FA 1RISA 2H1YA 3GP9A 1NJIT 1IM4A 2XR9A 3HMJG 4ID5A 2R7QA 1N5YA 2W9CB 3TVZA 1FRHA 4C11A 4ZPTR 4L76A 4JI3F 3BV8A 3SCJE 1D1UA 3WAYA 4OQJA 3CJQA 4C3LA 1FKOA 1LK5A 2C2EA 2Y1LB 2RE1A 3N4WA 4DQRA 3DYAA 3CCES 3NGUA 5LM7E 5DLGA 3G6ES 3PVXA 4FYWB 1SKSA 1IBKF 1B99A 2DIVA 2ASYA 3VGUA 1B64A 2E5LF 5L1LA 5HP1A 4YR0A 4DSFA 3TJ9A 3PFOA 4MIWA 4B56A 3DOLA 1HWKA 1REVA 1F60B 2MY8A 4JI2F 2POKA 5HLFA 1JLCA 4A8YA 5IQQA 4TYBA 5DZ7A 2BACA 5EUHA 3HXMA 2K1RA 2R2UA 3D1OA 2RQMA 3SZYA 5A8WB 4OIXA 3QJPA 1SJQA 2J0XA 3OVBA 3R5JB 1ACMB 3LOUA 3T5KA 2UXBF 2LFVA 1YJNS 2CPHA 1O98A 5KT7A 1UKUA 3MM8A 5RUBA 2W5SA 1XQIA 1JXVA 3NS7B 4WXWA 1CS4B 2G9YA 1I51B 2RQKA 2VJUA 1RWNB 3U02A 1FI4A 1XEZA 2YKMB 1RJJA 2OSRA 5J2NB 2BKNA 2BQUA 4LFAF 1FF2A 3T3FA 5JVHQ 2A6OA 2E1AA 2EK1A 2MQNA 4M5LA 3KXDA 2F3JA 4KGKA 3SV3A 1FRKA 2GA7A 1QAJA 3DRPA 4FXWA 4OYBA 4MHXA 1NM2A 4ZVFA 5ETMA 2JLEA 4U7CA 2VQRA 3CD0A 2AEFA 1R8HA 4H4OB 2VA2A 2NCKL 3UWTA 3RUBL 4J7CA 4YB6A 3TA0A 3CC7S 4DSKA 5CHCB 1WORA 1XMBA 1VDHA 2ZKTA 1MN7A 2J6UA 2ZJRQ 1YI2S 4QYRA 1WTBA 5F8JA 3HCXA 3DOMB 5HBMA 1HNWJ 1RAFB 1Q5VA 4NEZA 1EETA 5KFXA 3VQSA 2QLBB 1URAA 1S1XB 3QT5A 3W60A 2DY9A 1RACB 2U2FA 4CLUA 2C3MA 2O66A 3RAXA 3R6GB 1ZBTA 4DR7J 3ET6A 1NZAA 1W2IA 2J7WA 3J7AN 1K0TA 2LU1A 3MEEA 3US5A 3Q83A 5IM0B 1JLFB 3KK2B 3TZXA 1CQMA 2DEJA 4Q45A 3MHYA 4LFAJ 4CO1A 4X4SA 1F0XA 2HFUA 4ZPAA 3W7BA 3X3UA 4YR3A 3KLFA 2IRXA 1PGZA 5KFOA 1VCTA 2WVFA 3GYGA 1QJHA 4N7TA 1IBCB 1KQKA 6FD1A 1WI6A 3K5OA 4NLSA 2K8GA 2DXEA 3X1LB 3D1HA 5L1JA 2IM0A 2WB1D 5HATA 4EFAC 4L3KA 5CD4H 2MZTA 3O1LA 4UPHA 3QIDA 4DUYF 1QAXA 2FHOB 1Q82T 1FKOB 1LQ9A 2CQ3A 3CO9A 2VHGA 2YKAA 1LWFB 1NLKL 9RUBA 2OEKA 1ALIA 2CWKA 2CPXA 3K8VA 5K8OA 1KVJA 1G6BA 3FRYA 1RLDA 3MD3A 3W3SA 4WXOA 2HHTA 1HQAA 4CXKA 3CPWR 5LIAA 4NXMJ 2XMMA 4M5JA 3RG6A 2LQ8A 4IO1A 4DL0C
chains in the Genus database with same CATH topology
1AJBA 3UO0A 5INHA 4UORA 1AJCA 3TWZA 4LRBA 1ELXA 2GSUA 2XR9A 1KHKA 4LQYA 4CXUA 5DLVA 1ALKA 3UN5A 3UN3A 3T02A 3WAYA 1N2LA 2W5TA 1EW9A 3NKPA 1SHQA 3T00A 4FDIA 4UOPA 2IUCA 5L0EA 1KH7A 1EW8A 3NKQA 3WAVA 3NKNA 4FDJA 3E2DA 2IUCB 4CYSA 4GTYA 4UPIA 4MIVA 1ZEDA 5EGEA 3OT9A 4B56A 4LR2A 4ZG7A 3KD8A 3WBHA 4LR9A 1AUKA 1B8JA 2W5XA 1AJDA 4LR8A 3ED4A 1P49A 2GSOA 1ED8A 3SZYA 1E1ZP 4NWXA 5L0BA 1KH9A 4KM4A 1ELYA 1KHLA 5IJSA 1Y6VA 4KAVA 5DLTA 4LRCA 4LRFA 1KHNA 1O98A 2W5SA 4GTWA 4GTZA 2G9YA 3BDGB 5EGHA 3CMRA 2IFYA 3NVLA 3NKMA 1ALJA 4LREA 2XRGA 5L0KA 3A52A 2W8SA 5TJ3A 1EJJA 1HDHA 3BDGA 1EW2A 4MHXA 2QZUA 1HJKA 2VQRA 4UPKA 2W8DA 2W5RA 3DYCA 1ZEFA 4KAYA 3IGYB 3MK1A 1K7HA 1KH5A 3TG0A 1KHJA 2GSNA 1ZEBA 1FSUA 1ED9A 1ALHA 5LRNA 3M7VA 3TX0A 5HRTA 2ZKTA 4KJDA 4UOOA 2ANHA 5KXAA 1ELZA 3LXQA 4LRDA 5AJ9A 2W5VA 3UN2A 3WAWA 3WAXA 1URAA 2W5QA 4CXSA 5GOVA 4ZG6A 5DLWA 4CYRA 5C66A 1HQAA 3DPCA 3M8WA 3MK0A 4UPLA 1EI6A 1KH4A 1O99A 2D1GA 5K4PA 1E2SP 3BDHA 3SZZA 3M8YA 3IGZB 3Q3QA 5IJQA 4N7TA 1AJAA 1EQJA 3NKRA 3B5QA 5LRMA 3M8ZA 4NWJA 1SHNA 4TN0A 1E3CP 3UNYA 5LQQA 4ZGAA 4LR7A 4MY4A 1E33P 4UPHA 2RH6A 3NKOA 4KJGA 1ANJA 1URBA 3IDDA 2GLQA 2X98A 4QAXA 4GTXA 1ALIA 3T01A 3MK2A 2GA3A 3BDFA 4LRAA 1N2KA 4CXKA 5GRRA 2W5WA 1ANIA 5LIAA 1Y7AA 4YR1A 4ZG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJB A;  3UO0 A;  5INH A;  4UOR A;  1AJC A;  3TWZ A;  4LRB A;  1ELX A;  2GSU A;  2XR9 A;  1KHK A;  4LQY A;  4CXU A;  5DLV A;  1ALK A;  3UN5 A;  3UN3 A;  3T02 A;  3WAY A;  1N2L A;  2W5T A;  1EW9 A;  3NKP A;  1SHQ A;  3T00 A;  4FDI A;  4UOP A;  2IUC A;  5L0E A;  1KH7 A;  1EW8 A;  3NKQ A;  3WAV A;  3NKN A;  4FDJ A;  3E2D A;  2IUC B;  4CYS A;  4GTY A;  4UPI A;  4MIV A;  1ZED A;  5EGE A;  3OT9 A;  4B56 A;  4LR2 A;  4ZG7 A;  3KD8 A;  3WBH A;  4LR9 A;  1AUK A;  1B8J A;  2W5X A;  1AJD A;  4LR8 A;  3ED4 A;  1P49 A;  2GSO A;  1ED8 A;  3SZY A;  1E1Z P;  4NWX A;  5L0B A;  1KH9 A;  4KM4 A;  1ELY A;  1KHL A;  5IJS A;  1Y6V A;  4KAV A;  5DLT A;  4LRC A;  4LRF A;  1KHN A;  1O98 A;  2W5S A;  4GTW A;  4GTZ A;  2G9Y A;  3BDG B;  5EGH A;  3CMR A;  2IFY A;  3NVL A;  3NKM A;  1ALJ A;  4LRE A;  2XRG A;  5L0K A;  3A52 A;  2W8S A;  5TJ3 A;  1EJJ A;  1HDH A;  3BDG A;  1EW2 A;  4MHX A;  2QZU A;  1HJK A;  2VQR A;  4UPK A;  2W8D A;  2W5R A;  3DYC A;  1ZEF A;  4KAY A;  3IGY B;  3MK1 A;  1K7H A;  1KH5 A;  3TG0 A;  1KHJ A;  2GSN A;  1ZEB A;  1FSU A;  1ED9 A;  1ALH A;  5LRN A;  3M7V A;  3TX0 A;  5HRT A;  2ZKT A;  4KJD A;  4UOO A;  2ANH A;  5KXA A;  1ELZ A;  3LXQ A;  4LRD A;  5AJ9 A;  2W5V A;  3UN2 A;  3WAW A;  3WAX A;  1URA A;  2W5Q A;  4CXS A;  5GOV A;  4ZG6 A;  5DLW A;  4CYR A;  5C66 A;  1HQA A;  3DPC A;  3M8W A;  3MK0 A;  4UPL A;  1EI6 A;  1KH4 A;  1O99 A;  2D1G A;  5K4P A;  1E2S P;  3BDH A;  3SZZ A;  3M8Y A;  3IGZ B;  3Q3Q A;  5IJQ A;  4N7T A;  1AJA A;  1EQJ A;  3NKR A;  3B5Q A;  5LRM A;  3M8Z A;  4NWJ A;  1SHN A;  4TN0 A;  1E3C P;  3UNY A;  5LQQ A;  4ZGA A;  4LR7 A;  4MY4 A;  1E33 P;  4UPH A;  2RH6 A;  3NKO A;  4KJG A;  1ANJ A;  1URB A;  3IDD A;  2GLQ A;  2X98 A;  4QAX A;  4GTX A;  1ALI A;  3T01 A;  3MK2 A;  2GA3 A;  3BDF A;  4LRA A;  1N2K A;  4CXK A;  5GRR A;  2W5W A;  1ANI A;  5LIA A;  1Y7A A;  4YR1 A;  4ZG9 A; 
#chains in the Genus database with same CATH topology
 1AJB A;  2C3Y A;  3UO0 A;  3ZTQ A;  3O44 A;  3I5A A;  3PW2 A;  2QSW A;  3GIJ A;  4U8V A;  3SV4 A;  2V0N A;  4Y2I A;  2DRA A;  4LF1 A;  3SBM A;  2OPP A;  3H90 A;  2OPP B;  1HHT P;  4ANE A;  3BDE A;  1NO8 A;  2VG5 A;  2NSB A;  1LEO A;  5GVQ A;  2H54 B;  1Q0N A;  2BE2 A;  3T6J A;  2F7V A;  3OFG A;  1FNM A;  4PXD A;  2R2T A;  3KG4 A;  3N5B A;  4IH6 A;  2NLW A;  3HSJ A;  1HNZ F;  4B3R F;  3MEG B;  3IG1 A;  4JUZ A;  4JYA F;  4KH0 B;  1O8B A;  3SDE A;  3UQS A;  3TAM B;  1OPI A;  1RTH A;  5IV4 A;  3QJJ A;  3V6H A;  4YHH F;  4DLE A;  4CYS A;  1KFS A;  4QYZ K;  1RYS A;  5GMK a;  1TL5 A;  4YP3 A;  4J9U E;  5HMY A;  4B3S J;  4IQX A;  4DV5 F;  4F50 A;  1S1T B;  3DGP A;  4OLP A;  1MG7 A;  4JI6 J;  1YG0 A;  4IDK B;  2MZQ A;  3NY0 A;  5D78 A;  4BDP A;  2JVO A;  2F4V J;  4HI2 A;  2HVI A;  2DIS A;  3UCZ P;  3IC1 A;  3SXL A;  1TMJ A;  4CLZ A;  1CJV A;  2ZUA A;  4OYZ A;  1P9Y A;  2HHV A;  1OIA A;  1UJ6 A;  3N6N A;  2XZD B;  1P6T A;  5KFL A;  2RIJ A;  4CTA A;  1KBR A;  4ZDN A;  2RF2 B;  3FMW A;  3RTV A;  4CM2 A;  5KG4 A;  3O8W A;  5KT2 A;  1NK7 A;  3FKB A;  2QYC A;  3MAQ A;  2HFO A;  3UR3 C;  2DGQ A;  3GIL A;  4NLU A;  1ZA1 B;  3D5M A;  1WDD A;  3HVW A;  4F0H A;  1WKJ A;  1R6V A;  1UL3 A;  1HR0 J;  1K44 A;  3M6W A;  2A6M A;  2FLO A;  3R5A A;  3GYX B;  2ILZ A;  2BEF A;  3LP2 A;  4KBI A;  1RWX B;  2F63 A;  5KFF A;  1ZA2 B;  3AFG A;  1GEH A;  1QUV A;  2FJB B;  3CTR A;  3TAP A;  1U1L A;  2DHG A;  1ZYQ A;  4NOH A;  1WF0 A;  1HBO B;  3PAC A;  3P3D A;  3CXC R;  2J5A A;  2DGT A;  2BMB A;  3F0N A;  5E5N A;  1X5O A;  3UW1 A;  1HWJ A;  1PYS B;  1Q79 A;  2I5J A;  2QA2 A;  2HGN A;  3QGI A;  2PA8 D;  4UQT A;  3JYT B;  2FY1 A;  3KOA A;  3MM7 B;  1U2R A;  4WTY A;  1PSD A;  4JI4 J;  4ED2 A;  4IH5 A;  3DKD A;  1V5I B;  3AA8 A;  4HKQ A;  4RW6 A;  5IXU A;  4YR2 A;  4F7V A;  2ALZ A;  2HHH F;  1VLO A;  3D7S B;  3W8G A;  2RUS A;  2J76 E;  3WIV A;  5EHH A;  3RB3 A;  2M7S A;  2ZWP A;  3KJN B;  4LSL A;  2D1C A;  2EFQ A;  1UCN A;  1FWK A;  3M32 A;  1N36 F;  2ZIT A;  3OFH A;  1H7W A;  4NLW A;  4HYK A;  4AFF A;  3VAM A;  4DQI A;  1U24 A;  3E01 A;  2QLX A;  1UWB A;  5KFD A;  1RBA A;  2IDL A;  2W2M P;  2BW2 A;  2GO8 A;  3EZU A;  1A6L A;  4USV A;  1RTZ A;  1R27 B;  5KG0 A;  4DX5 A;  5C2G A;  4RUA A;  4X4V A;  2Z58 B;  4IH7 A;  2F4F A;  5FLX Y;  1IKW A;  4QR1 A;  1YBT A;  1R43 A;  1DY3 A;  1RHQ B;  1HYS B;  3MM5 A;  4CLS A;  3ILJ A;  2H9Z A;  4GVL A;  4USJ C;  4QPX A;  1N33 F;  4FKY A;  4NYP A;  3T5L A;  4UST A;  1XTZ A;  2VUG A;  3HM9 A;  2UVU A;  2IFX A;  5LMN F;  2RRA A;  5KAK A;  2J6T A;  4DSI A;  1I5O B;  2RHS B;  3DM2 B;  4I68 A;  1ZS6 A;  3D28 A;  4ALZ A;  5HMZ A;  4ILL A;  1C4C A;  4DSL A;  3W9H A;  3HVT A;  4ED3 A;  5A0Y B;  3CC4 S;  1QM9 A;  1SH0 A;  4ED1 A;  2H48 B;  3MEG A;  1L3U A;  2HAF A;  5DDQ C;  2AX1 A;  1SQE A;  2FB0 A;  4AL7 A;  3W2V A;  2ZH8 A;  1RT7 A;  2F8E X;  2DH7 A;  2B9E A;  3SI8 A;  1HL6 A;  2DPJ A;  3OFE A;  1U2C A;  3TYT A;  1KD1 T;  2V8G A;  3OW2 R;  1M90 T;  1IKY A;  4O0I A;  2CWX A;  1K1S A;  4GKJ J;  4ATN A;  2ZOM A;  3VF0 B;  1FE4 A;  4DUY J;  1NPP A;  1QDU B;  1S9E B;  4RBT A;  1Q53 A;  5C24 A;  4A8X A;  1EIY B;  1K9M T;  3K5L A;  3CUN A;  2GVD A;  4G1I A;  1LW0 A;  1I1G A;  1JLG B;  2ZHO A;  4KH1 B;  1U4B A;  2DNY A;  2PFF B;  2YNF B;  4MKY A;  3DDN A;  2O01 C;  4FDI A;  1T8E A;  5LMU J;  1U25 A;  4PCQ A;  4UOP A;  3MAA A;  3CDA A;  3I9Z A;  4DBQ A;  5IM0 A;  2BRK A;  2GIF A;  2MLY A;  2PMZ D;  3BO4 A;  4K59 A;  2KB2 A;  2H4W B;  1MWY A;  3MR7 A;  4OYP A;  4ZVG A;  5L9X A;  1HI0 P;  3TJ8 A;  3R27 A;  3KK3 B;  3HO1 A;  4B3O A;  1HMV B;  5D15 A;  3AB2 B;  3MMB A;  4ECX A;  1BD6 A;  1TVR B;  2N7Y A;  5HVH A;  1RBL A;  2OPR A;  2VG7 A;  1U0S A;  5K5M A;  1MU2 B;  4HT7 A;  4MH8 A;  3UCG A;  3KJF B;  4KAY A;  1VIS A;  5A6W A;  3NOG A;  3PZP A;  4QCL A;  3G82 A;  3C15 B;  3HHL C;  2VAS A;  5DG9 A;  2GQC A;  3DLE A;  3ILI A;  3JB9 k;  2J8S A;  3OV7 A;  1RT3 B;  4JYA J;  1Y6V A;  3HVA A;  2C2K B;  3MEE B;  4ED7 A;  4TYA A;  1I3O B;  1H3D A;  2J0Q D;  3MCO A;  2CPI A;  1M1G A;  4NZ6 A;  3AH6 A;  4IR1 A;  3R2C J;  3RBZ A;  1NJY A;  2DNK A;  3SSS A;  3U7J A;  5BR8 J;  1G1X A;  3S6E A;  3K2Y A;  4X66 J;  2E5H A;  3IGN A;  4EO6 A;  4FBU A;  3C2P A;  3CUL A;  1T9W A;  4P74 A;  5AJ3 F;  2BJ7 A;  3QGP A;  4Y34 A;  1NK9 A;  4CZC A;  1H7X A;  1CJK B;  2LA6 A;  2N4C A;  1YDL A;  5L9N A;  3CO0 P;  3K89 A;  1T03 B;  2R8J A;  3IP0 A;  2IPO B;  1ICE B;  2IM2 A;  2PA3 A;  2UUT A;  1S1U B;  3DRS B;  3JSM B;  3OSP A;  1BQN B;  2D9P A;  3ZFV A;  2DNG A;  1ED9 A;  4GVB B;  5E3P A;  2BE7 D;  3J81 U;  2HHP A;  2FHM A;  2K3I A;  3LAN A;  3NBP B;  4UOO A;  2FPH X;  5J2P B;  2KT3 A;  2O5D A;  2QRR A;  4NLV A;  2C3P A;  3UN2 A;  9ATC B;  3PR4 A;  2D3O R;  3GYN A;  4EK2 A;  2B5J A;  5KOW A;  3AD7 C;  3C16 A;  3FCV A;  2CQ4 A;  2J9E A;  4NPO A;  3KK1 B;  3IAS 9;  2V4R A;  3QO9 B;  3CCV S;  1J5O A;  4ZG6 A;  5DLW A;  2J9C A;  1TKT A;  3AJD A;  1WG5 A;  3MK0 A;  2GJF A;  2V4J B;  3BH6 B;  3DOK B;  5E41 A;  2CZV C;  4C98 A;  2HVE A;  2M2B A;  4KPC A;  3NS6 A;  3OVS A;  4WP8 A;  1JJC B;  1FX2 A;  3O3L A;  1KHW A;  4XPE A;  4TQR A;  3JYT A;  3TI0 A;  5A2Q Y;  1Y5L B;  3FRZ A;  2CG8 A;  3SSR A;  1FKP B;  2ZD1 B;  2DO0 A;  4OHW A;  4USU A;  3H4D A;  1VLY A;  4JV5 F;  1REG X;  2W4P A;  3DNC A;  4TN0 A;  3MZI A;  3MFH A;  1N48 A;  4G3I A;  4ZVO B;  2WBR A;  2HLT A;  5HI7 A;  5I3P A;  4UOF A;  3IG1 B;  5KFV A;  4ZGA A;  1DRZ A;  4X62 F;  2D9O A;  4IFY B;  3OXG A;  4A48 A;  1MWQ A;  2ZBQ A;  3BGR B;  4WFB Q;  2GLQ A;  1HNI B;  2X98 A;  1FVS A;  2DNP A;  1K47 A;  1RHK B;  4HH0 A;  2QLF B;  4ZHR A;  3CCJ S;  2VG6 A;  5DGB A;  4P52 A;  1FJC A;  1Q7Y T;  2R7U A;  2NZ4 A;  3M1V B;  4I4B A;  2XG8 A;  3Q8Y A;  2NUH A;  1SJ3 P;  5CZX A;  1ANI A;  2KT2 A;  5D4O A;  3UNG C;  2DHS A;  3HJV A;  1A9N B;  2WVB A;  4UTG A;  2HHQ A;  3R8Y A;  3Q24 A;  2AJQ A;  2IMW P;  4NCA A;  2FC9 A;  2X3G A;  4C11 B;  2AD9 A;  4DWI A;  4FNI A;  4DR4 J;  5KG2 A;  2FLP A;  3DYA B;  3SYZ A;  5KFG A;  1TK8 A;  3I0R B;  2BVZ A;  3C14 A;  4TKT A;  3HKW A;  5GAE I;  2XYP B;  3OTE A;  3M2R A;  4XTT A;  1X4C A;  3VV2 B;  2HZV A;  4MT1 A;  1D09 B;  4EZ6 A;  3LP0 B;  5HVF A;  1WEL A;  3OD2 A;  4L73 A;  5DLV A;  1UET A;  2Z56 B;  1U1K A;  2CNN B;  1R89 A;  3GCX P;  2V4Q A;  4OV6 A;  2BJE A;  1JLQ B;  1NK5 A;  2PI4 A;  2UXC J;  2DGO A;  4OFZ A;  4WIQ A;  2MKI A;  3M8Q B;  1U1M A;  4ZS6 A;  4KHP J;  4UOC A;  3I0S B;  3WAV A;  4RL1 A;  1GQE A;  3ULH A;  3MTK A;  3MGJ A;  2CJQ A;  2VFU A;  2WOM A;  1LWX A;  1NH8 A;  1S48 A;  5K8N A;  2UP1 A;  4MIV A;  4UPI A;  1XBW A;  5I3U B;  4DUZ F;  2WCX A;  3ZTS A;  5CYJ A;  1F9F A;  2VBY A;  3WC0 A;  3JQJ A;  4NCB A;  3MPW A;  2L9W A;  1FRI A;  2GHP A;  4ECT A;  4X64 J;  1M5K C;  2B51 A;  4C8O A;  3P5T L;  4LR8 A;  3BGR A;  4IUF A;  2GSO A;  1PAU B;  1VR6 A;  2Q66 A;  1JKH A;  3MPU B;  5B0G A;  1T9U A;  1IR0 A;  2E5I A;  5IJS A;  5FDL B;  1KFD A;  2IRU A;  4OX8 A;  5FLX U;  1KHN A;  4GTW A;  4P2M A;  2HYI B;  3RZA A;  3CVK A;  3CT9 A;  4KO0 A;  5L1K A;  1WG1 A;  3C16 B;  2EKN A;  5D0R A;  2XI3 A;  2OEM A;  3GPA A;  4XO0 A;  1S9G B;  2QMU B;  5L0K A;  1U0H A;  3NMR A;  1S1W A;  1TMM A;  2V4J A;  1DHM A;  3LGM A;  2JC0 A;  3LQV A;  3HZE A;  3R7N B;  5DLF A;  3BDG A;  1RSC A;  2M3D A;  4UF4 A;  2Q1L A;  2V8H A;  2ZH3 A;  1HJK A;  4HH1 A;  1GTE A;  1VS3 A;  1ZEF A;  2BQR A;  2DEI A;  1YIJ S;  1Q1K A;  1IUJ A;  4KKO B;  3QMQ A;  2HBZ B;  4DS4 A;  1ZEB A;  3M7V A;  3PYD A;  4TVA B;  1OY8 A;  3HHE A;  3ET6 B;  4ZVT B;  1CUL B;  2GC8 A;  3VWS A;  1LWE A;  2QFI A;  3NRB A;  5BJR A;  1YTY A;  1NB7 A;  2WW4 A;  1FVQ A;  4IKA A;  3V6D A;  1Q81 T;  3AOB A;  3QT7 A;  4DFJ A;  4OJ1 A;  2YVS A;  1SH2 A;  5DG7 A;  5HAO A;  3I5C A;  1IN0 A;  1CJK A;  4I1T A;  1RAO A;  3R7B B;  4OHZ A;  2DR9 A;  4O3S A;  1T11 A;  1WUU A;  3I96 A;  2V2V A;  4P6Q A;  3KMQ A;  1NME B;  1H2U X;  2Q6B A;  1TL1 B;  1NUE A;  5KT4 A;  1RT4 A;  2YNH A;  2BJ1 A;  2GQQ A;  3FVY A;  1HAR A;  4F67 A;  2XC9 A;  4IRD A;  2GAH C;  2DRB A;  4OYI A;  3BQ0 A;  2JDJ A;  4ZVP B;  2VB6 A;  2YQ0 A;  4ZK7 M;  3NNH A;  2C2N A;  2P2C B;  4RBV A;  2JC1 A;  5LQQ A;  2VDI A;  3HDS A;  3CB4 A;  2CPD A;  4OYM A;  2QEX S;  3GCW P;  4DPT A;  1UVN A;  4Z2X A;  5KFH A;  4R25 A;  1UTA A;  2EG2 A;  5ETT A;  3SCK E;  2KH9 A;  3THP A;  4RWW A;  1S10 A;  1EX8 A;  1UP1 A;  2EFV A;  4FZV A;  2L3M A;  4LMZ A;  1B7Y B;  1R31 A;  4P2F A;  3H5X A;  4KGV B;  2MGZ A;  5CCL A;  1RLC L;  3MMA B;  4CLP A;  2FZK B;  1KLM A;  3UDV A;  2CQB A;  2DNL A;  2AIR B;  4KSE B;  1VC0 A;  1IBL F;  5FD1 A;  4CLK A;  3L9Z A;  2FQQ B;  3M6U A;  4LSZ B;  3B78 A;  3I4P A;  2RDD A;  1VQS A;  5C24 B;  4CLT A;  2FZG B;  3RW7 A;  3KMS A;  3LAK A;  2RS2 A;  4NYZ A;  3NGR A;  1XMQ F;  1F3F A;  4MYT A;  4F4Y A;  4WPA A;  2DNQ A;  3IR7 B;  3NGS A;  4AYB D;  1Q86 T;  2FVR A;  3TAM A;  2COL A;  3M2V A;  2IYI A;  2AEM A;  2K2P A;  1JKH B;  4IQM A;  3CE8 A;  4NA2 A;  4ECZ A;  2NUU G;  3OL8 A;  3G86 A;  1RHU B;  4OX9 F;  2IBK A;  5E3R A;  2V50 A;  5IOL A;  4C0O C;  1NJX A;  2WK4 A;  4G1Q A;  3CCM S;  2EC0 A;  1RZM A;  4I2Q A;  1PC5 A;  3DRR B;  1TKD A;  2E5G A;  3E2D A;  4W4M A;  1YJ7 A;  3TA1 A;  4WFN Q;  1XNQ J;  3AD8 C;  3AJ1 A;  2MKY A;  3AHP A;  5HMX A;  2ZH5 A;  4AQY F;  2NYH A;  1NK4 A;  2G4B A;  5BYQ A;  1YJ9 S;  1RTI A;  1X9M A;  3CDB A;  3ZZU A;  4ZG7 A;  3HSZ A;  3BYP A;  4O44 B;  5KG3 A;  2VIH A;  2YWE A;  3WC2 A;  5B0C A;  1L5U A;  3CJ2 A;  2BA9 A;  3NCQ A;  1LXN A;  1QE1 B;  2B8P A;  3NEK A;  1LFP A;  4K2J A;  3TZY A;  2HPU A;  2HZA A;  3KK1 A;  1HNW F;  2E9T A;  4CH1 A;  2XSF A;  3AA9 A;  4ZP8 A;  4Y0F A;  4K50 A;  3HUL A;  3R1H A;  1ULR A;  2V9W A;  2B4U A;  5CXT A;  3ED4 A;  5KFR A;  2JHE A;  3NS5 A;  2BUN A;  2HZC A;  3OHB A;  2JZ5 A;  1YJU A;  2OP5 A;  3BN4 A;  5EX0 A;  3DI6 A;  1PC4 A;  4QJV A;  1NKB A;  2IFY A;  1UFK A;  4KR0 B;  3J7Y U;  2B9X A;  3DYC A;  2OPS A;  1AFJ A;  2FLL A;  1D8Z A;  3H2V E;  4P2X A;  4B9N A;  3FBC A;  2Z2M A;  2C42 A;  3QBC A;  2I2Y A;  4UY8 T;  4ZLJ A;  5HL7 Q;  3LTO A;  3CC2 S;  2LEA A;  4IG3 B;  1W7W A;  4OI4 A;  3GU0 A;  2D3U A;  3BN7 A;  3BPS P;  2KL8 A;  1S59 A;  1SKU B;  4ERD A;  4EBE A;  5HAN A;  4BLG A;  1GFW B;  3ELH A;  3Q8U A;  3EE3 A;  1SL0 A;  3N28 A;  3HSD A;  3CJK B;  1RU2 A;  1J5O B;  3SCI E;  1NEE A;  5F8H A;  1U48 A;  1HIY A;  2IJR A;  4ZVR B;  3LWM A;  1T0T V;  3HT0 A;  2YTC A;  4MAK A;  1H74 A;  2RSQ A;  2SXL A;  2QN6 B;  1GX6 A;  2R42 A;  1N0V C;  4PZV A;  2BKP A;  3CD7 A;  2ZJP Q;  2ZEJ A;  3DU5 A;  1YRU A;  4HDH A;  4OZN A;  2HGL A;  5F3T A;  1TUV A;  1MU2 A;  4UQG A;  2XO7 A;  4K4T A;  1QSL A;  1LOU A;  1VBX A;  2R8K A;  2AX0 A;  2KYX A;  3FCH A;  3FGV A;  4NMX A;  3MR3 A;  1TU0 B;  3PYG A;  2JVR A;  4YB5 A;  5HN0 A;  1T3O A;  3Q3Q A;  2QT7 A;  1OS5 A;  2OPQ A;  4B3T J;  1V9O A;  2AJ2 A;  2APO A;  2OO4 A;  2X7I A;  4RW6 B;  2DH8 A;  3QZ7 A;  1NXI A;  2ZOF A;  3A13 A;  1IM6 A;  2GV1 A;  2VC1 A;  1E3C P;  4PAB A;  3VAL A;  4USW A;  2V2Z A;  5KFN A;  3V6D B;  4USH A;  5JXS A;  3H4B A;  3E8O A;  1UVI A;  4GKJ F;  1C0U B;  3A8J A;  4K5R A;  3DHX A;  2GIR A;  4CT9 A;  4DCO B;  2HQ3 A;  1Y9O A;  2KFY A;  4QAX A;  1PJ5 A;  2XI2 A;  1U45 A;  2E5J A;  3UDE A;  4Q8E A;  3OPK A;  5F8G A;  2HQI A;  2Y1R I;  2I1R A;  3D67 A;  3BDF A;  1QVF R;  3FZ2 A;  3EIC A;  3P4U B;  1NPR A;  2GHV C;  4OX7 A;  3M6X A;  2HKE A;  5KFP A;  1FER A;  3A3P B;  1UJ5 A;  3IRX A;  2UVR A;  3EXY A;  5DGA A;  4KT0 C;  1FES A;  1BXN A;  5MAO A;  1J2V A;  2Z0G A;  4K5S A;  4CTA B;  3HJF A;  1DAX A;  3DXB A;  3OTO F;  2XNQ A;  5GAD I;  1ELX A;  1HI1 A;  5HP1 B;  1KSP A;  1VJW A;  4IG0 A;  4CRJ A;  4ETX A;  1ZPV A;  4J37 A;  4WBF A;  2QMX A;  1LK7 A;  3FFI B;  3MR5 A;  2P6S A;  4C8N A;  3T9Z A;  5D3G B;  1NSP A;  3GJQ B;  2C28 A;  3THT A;  1TKT B;  2DGU A;  5A8R B;  3C6U A;  2LEC A;  1U1O A;  1TUG B;  1X60 A;  2NS1 B;  3KJV A;  1NBE B;  3C66 A;  5B0D A;  4KY3 A;  1SV5 A;  1Z2Z A;  2K06 A;  1SBR A;  3G82 B;  3KLF B;  1R7I A;  2FHJ D;  3GB0 A;  2B8Q A;  1RDR A;  2OEL A;  3PW4 A;  5IC6 B;  3IM8 A;  4DHV A;  4EGL A;  2ZHA A;  4ELU A;  4LF8 J;  3KLE B;  2DXD A;  3RAQ A;  1SL1 A;  1IBM F;  3EVO A;  4DR1 F;  3JAM Y;  5G4D A;  3K8W A;  2YWG A;  3D4J A;  1SUQ A;  3T1H J;  1BQN A;  2CQ2 A;  3BPD A;  5FII A;  3IO1 A;  2HSE B;  3Q8P B;  4HLB A;  1QTN B;  1UZD A;  1LWE B;  1S77 D;  1AW0 A;  3E01 B;  4PR6 A;  4TQS A;  3JSY A;  3GFX A;  3QAT A;  1KQF B;  1WC3 A;  1D9F A;  3R5C A;  2B5J B;  1CG2 A;  4N47 A;  1X5T A;  3M1V A;  1VI7 A;  4QYZ J;  1FK9 B;  3AOD A;  4J90 A;  1EB0 A;  4XDD A;  4LRC A;  5CYQ B;  1VQP S;  1OSD A;  2DNN A;  3MR2 A;  4QR0 A;  2LQB A;  2GO9 A;  3MM5 B;  4JI7 F;  3IGV A;  3U1L A;  1NB2 A;  1C4A A;  3LUY A;  1IKW B;  4ZVU B;  1YLX A;  5B0E A;  5GAG I;  3F73 A;  3K5N A;  2XS2 A;  3V4I A;  1J27 A;  1SH3 A;  1NSK L;  2F9J A;  2WW8 A;  4N8O A;  4Y00 A;  3IN5 A;  2Y9H A;  2DR8 A;  2XRG A;  1B0V A;  1XR6 A;  2BZ2 A;  1VMB A;  4P2S A;  4JI2 J;  3H42 A;  4GO5 X;  4IOB A;  2AZ3 A;  4ZPC A;  2B4O A;  3P45 B;  2VON A;  4WE1 A;  5C25 A;  3I55 S;  2JOQ A;  2KXF A;  5LL6 d;  1YGY A;  1U6F A;  2XM3 A;  3NLC A;  4H54 A;  4UUW A;  2QZ8 A;  1O6X A;  3UVJ B;  4ETZ A;  5F9L A;  3HHL B;  3BRE A;  3BKT A;  5CQG A;  1KHJ A;  3TG0 A;  1YRT A;  1S99 A;  2E66 A;  2X1G A;  1FD2 A;  1W25 A;  3BH7 B;  1OSC A;  1E6Y B;  2VFT A;  5DDR C;  2QC3 A;  3TQE A;  2W9B A;  3MED A;  2W2P P;  3D0G E;  3D6T B;  5IWA F;  3N6M A;  3ZNJ 1;  2XY6 A;  4X62 J;  2RVJ A;  3MED B;  1HKA A;  3ZO7 A;  2L9D A;  5ETO A;  4MKV A;  2HRY A;  1VQY A;  3WBZ A;  2EFN A;  3WIU A;  3DLG B;  3QIP A;  5IQ6 A;  4A8S A;  2QYG A;  1R8C A;  2ACY A;  1DLO A;  2YNG A;  3TAR A;  3IWN C;  4J9V A;  1P9Q C;  2VQF F;  3DCA A;  1EET B;  1SIZ A;  1SQG A;  3KFW X;  1S76 D;  2G0J A;  3PYF A;  1BQX A;  1DBD A;  3QYY A;  4ED5 A;  2ZKU A;  3EGW B;  3NP5 A;  1NJZ A;  3RRH A;  1ZZF A;  3Q86 A;  3JAM U;  4DS5 A;  3VAK A;  3KDO A;  1D0E A;  2YQ3 A;  3FSY A;  4U9R A;  8RUC A;  3JSB A;  4B9T A;  2HLU A;  3ZZP A;  4FYX B;  1JJ2 R;  4AT1 B;  1E33 P;  4ED0 A;  4MY4 A;  4LIW A;  2GAG C;  3AY0 A;  3FDS A;  3UD3 P;  1W26 A;  3IDD A;  2KM8 B;  2HHU A;  3B8H A;  5T41 A;  1Y0H A;  5DET A;  3D2W A;  2M8H A;  1HPZ A;  3Q2S C;  1VQ9 S;  3HLU A;  2X1B A;  3K5M A;  3CMA S;  1C0T A;  5J2Q A;  1N4L A;  3D6H B;  3OBI A;  1FRM A;  2PO4 A;  4F2R A;  2EBG A;  1MML A;  2QE5 A;  2AYB A;  3CNQ P;  4MIA A;  2W5W A;  1IKY B;  3DXS X;  4B3T F;  3BQ1 A;  2PDA A;  4CYU B;  2H3E B;  1F1B B;  1F3V A;  4Z7C A;  1Q95 G;  1AUS L;  1NND A;  3MOZ A;  3SIP B;  2XQC A;  4A8F A;  3MPD A;  5D6G A;  4OMF G;  4R8U B;  2MQL A;  1ZTW A;  3KG0 A;  1TZ0 A;  3TWZ A;  4QW9 A;  1S97 A;  3CCU S;  5G0R A;  1EAY C;  2XGQ A;  1S5Z A;  1WKL A;  4DMZ A;  2NR0 A;  4OL8 A;  5IC4 B;  4X64 F;  1TL4 A;  2BJ9 A;  2KVI A;  3OTC A;  3IS9 B;  4WP9 A;  3FBF A;  4TXS A;  2BOA A;  4ZCK A;  1RE1 B;  4RW7 B;  2IC3 A;  5HRO B;  1FA0 A;  4EYI B;  1UA0 A;  4ZVQ B;  1C1B B;  2CA9 A;  3SQG B;  2PC6 A;  3VQT A;  4F04 B;  3VGV A;  1CJV B;  4WK3 A;  5BR8 F;  3W5Y A;  4DSE A;  1ZTT A;  2AP6 A;  4HHU A;  1M1H A;  2FZC B;  2W01 A;  1HNV B;  1JLG A;  3I6P A;  4I6W A;  5AJ3 J;  1T3N A;  2CDQ A;  1HYS A;  3H5U A;  1JNZ B;  3LGN A;  3MI7 X;  1VQ6 S;  1TKZ A;  4PG4 A;  3MEC B;  3HK2 A;  2O3D A;  4J9Q A;  2GCF A;  2GGP B;  1NU4 A;  3MM6 B;  4J5O A;  4USM A;  3TRG A;  2DH9 A;  3TAN A;  2W8K A;  4BS2 A;  2EFO A;  1SI9 A;  1FNO A;  2BM1 A;  1WSR A;  4H4K C;  3VAI A;  5LSR A;  5C42 A;  1B8J A;  2C2D A;  2YH0 A;  4NXN J;  3RYL A;  1KVI A;  2AKW B;  4GKK J;  3DRX A;  4E8U A;  1CSJ A;  2N7C A;  4QWE A;  2EK6 A;  2KVQ E;  3BS9 A;  1VC5 A;  2DCL A;  2DD8 S;  2JLF A;  1RTJ A;  2GQ2 A;  2LQJ A;  3OR2 A;  3EPI A;  1PIL A;  5ETV A;  3NCP A;  2QTW A;  4YQW A;  4KTQ A;  5D8H B;  1AXQ A;  1FRX A;  1QLN A;  4ENO A;  2ZHB A;  3BDG B;  5EGH A;  4ZIV A;  4B3M F;  4KRW A;  2EBE A;  3OTD A;  4JI0 F;  1FKP A;  3PJX A;  4DR1 J;  2CG4 A;  4JI7 J;  3OJU A;  2MKH A;  2FVQ A;  1Y10 A;  3D0I E;  3T1H F;  1XC9 A;  1NAQ A;  4F4Z A;  2MXY A;  4B3S F;  5L39 A;  3I56 S;  3ZTO A;  3U1M A;  1L3T A;  2QGF B;  3CJ3 A;  1J5E F;  2YNG B;  3BBF A;  4KC5 A;  4ZHR B;  2HVD A;  2A3J A;  3H0P A;  3GV5 B;  4JV5 J;  1FWL A;  2YKP A;  2VC0 A;  3IM9 A;  4IFY A;  2BYC A;  3ILL A;  3HP6 A;  2GMH A;  4O0N A;  1WNE A;  2ZZN A;  2NSC A;  2MY7 A;  4LF9 J;  1HW8 A;  2WBM A;  2JSX A;  2R4F A;  2QA1 A;  2DTJ A;  3D3B J;  2A2D A;  1BUX A;  2F8M A;  3DLK A;  5HMW A;  1VK3 A;  5I3Q A;  1U47 A;  1SKR A;  2E44 A;  2YPZ A;  4EEY A;  1RAA B;  2GMJ A;  4QIV A;  4BCA A;  5HLF B;  3NKN A;  2JEG A;  4J9S A;  4NLR A;  4FYD A;  4ECW A;  2ADB A;  3ONQ A;  5A8W A;  3KLG B;  4KE5 A;  1TV6 A;  7AT1 B;  4JP8 A;  1WSV A;  2QL7 B;  1M0S A;  2OH2 A;  2DY1 A;  2WHO A;  4OI1 A;  2IRY A;  3R9L A;  4ES1 A;  3HPO A;  2M52 A;  3MM7 A;  1SC6 A;  4TNO A;  1YIT S;  4IG0 B;  4Q44 A;  3CF5 Q;  3HI9 A;  2RB7 A;  3M8Y A;  1DUR A;  2OI2 A;  3IGZ B;  2CRL A;  4NML A;  4M95 A;  4FBT A;  3TOQ A;  2CPY A;  5LSL A;  3EGV A;  3M8Z A;  3D6F B;  2B9W A;  3R5G A;  2CPE A;  5DQH A;  3T5H A;  1F5B A;  1MRO A;  3QJL A;  2AW0 A;  3KJQ B;  1LWC A;  2NXJ A;  2C3U A;  3LP1 B;  4P7T A;  2RQ4 A;  1K8A T;  2DR5 A;  2EG1 A;  3PIP Q;  1XK8 A;  1HHQ A;  1F5C A;  1QSS A;  1BE4 A;  2YNI B;  2LEP A;  2JRS A;  3KKF A;  2ROG A;  4RBU A;  1KOO A;  4I2P B;  4E2F B;  1HWU A;  4I0W A;  1HQU A;  1TUW A;  2C1E B;  2DK2 A;  2HWI A;  2QMW A;  5CCM A;  2WVD A;  1WC0 A;  4D3G A;  1LWF A;  2Y8Y A;  4A8K A;  1WJ9 A;  3GE9 A;  3ZNU A;  2D3O 1;  3MEC A;  4FS2 A;  1Y7A A;  1VRT B;  3CMQ A;  2F5G A;  4IOA Q;  2ZWO A;  2KRB A;  1X4B A;  1FXR A;  2MEW A;  3H7H B;  4EYH B;  2XB2 D;  1H6K X;  3EGZ A;  1GMV A;  4DN9 A;  1VRU A;  3VGS A;  1FJG F;  5J1P A;  2A18 A;  4DQQ A;  1N34 F;  3TZZ A;  4F3M A;  2UVW A;  4QBU A;  5GAE U;  1X9S A;  1U6B A;  4HT5 A;  2E1R A;  1UA1 A;  4QU6 A;  5ITH A;  4FF3 A;  2ZFH A;  2BJD A;  4ICL A;  2I0X A;  4N77 A;  2ZD1 A;  2BW7 A;  1RUS A;  3FQL A;  1VQ4 S;  1S6O A;  1N6Q A;  2AYM A;  1XNR F;  4R0E A;  4N5S A;  1BC6 A;  1F6T A;  2RDI A;  2PMW A;  5IT4 A;  2RHQ B;  2MZS A;  4XDC A;  1NKE A;  1U8W A;  1CC7 A;  1YRX A;  2EPI A;  2LVW A;  3HFZ B;  1OO0 B;  3IBW A;  2LQ9 A;  2H5E A;  4KGX B;  3Q8S B;  1WEX A;  1XN9 A;  4TU9 A;  5C2C A;  1HBM B;  4MJK A;  5IT9 Y;  4BWJ A;  3CDU A;  5CYM A;  1C2P A;  4NLO A;  3G4S S;  3PHE A;  1OMS A;  4YFU A;  3M32 B;  3L4B C;  2HND A;  3DLJ A;  4ZA1 A;  3M2U B;  2MQQ A;  2R2R A;  3QFH A;  2ZJQ Q;  2XY5 A;  1KEK A;  3LPE A;  4G65 A;  3W9I A;  3CW2 C;  2IVM A;  2Z4P A;  4DV3 F;  1TR0 A;  4PQU A;  3H5Y A;  3LGH A;  1OPZ A;  3VZI A;  3DC2 A;  3H40 A;  2ZH9 A;  3BQ2 A;  3CJR A;  4ZKA A;  1HBU A;  4DCJ B;  4X4P A;  2AGQ A;  3GMG A;  2LDY A;  2UUB F;  1H0H B;  1S1U A;  2KXH A;  3DRS A;  3JSM A;  1ELY A;  2DHX A;  2JNJ A;  4KAV A;  2RJZ A;  1X0F A;  4AUK A;  3IRX B;  1S79 A;  4J9O A;  3K57 A;  2QJ3 A;  4NI2 B;  2ZH1 A;  1Y3J A;  4OZ1 A;  4DR3 J;  4FYY B;  2YWW A;  2RH3 A;  5FDL A;  3QAU A;  1IJE B;  2KT5 A;  5LXY A;  2B6A B;  4G1P A;  3P8B B;  5DO2 A;  4CNZ A;  5A0Y A;  1R3N A;  2BXJ A;  4DPX A;  2AYE A;  1FDD A;  2NYI A;  4CO5 A;  2A10 A;  3M6V A;  2CJ9 A;  3WZ0 A;  5KG5 A;  1GH8 A;  1S7I A;  3UPF A;  2FVS A;  4ZOS A;  4L75 A;  1X4F A;  1TQL A;  4A8O A;  2YY3 A;  3EYZ A;  1REV B;  3RBD A;  4PUO A;  4RR5 A;  3W5X A;  3FBE A;  1VIO A;  4R5P B;  4PUO B;  1HBO A;  2W9B B;  5LXR A;  4A8W A;  1T95 A;  2KZM A;  1XWL A;  3SFU A;  2IYG A;  5J1E B;  2RIL A;  1EP4 B;  1YQH A;  4BC9 A;  5FJ4 A;  2ANH A;  3MM8 B;  4WU3 A;  3TVY A;  4C0B A;  2C2M B;  4FYV B;  2CPF A;  4EBD A;  4O3N A;  3CCR S;  3LAL A;  2YX4 A;  2W5V A;  4ZVH A;  4FF2 A;  2Q43 A;  1HBN B;  2BE9 B;  1URR A;  2VFR A;  2WSE C;  3GJR B;  2CXE A;  4YB7 A;  4DU7 A;  1MWZ A;  1RAD B;  5ETR A;  2RKI B;  1RA7 A;  1VIX A;  3PRB A;  3TEH B;  4UOH A;  3CWJ A;  3D9B A;  1X8D A;  4JOU A;  4J9P A;  1T03 A;  1VQN S;  2NXC A;  1JIH A;  3M8P A;  2R8I A;  3M8W A;  1EQM A;  1NPK A;  1EI6 A;  1KKH A;  1O99 A;  1OQ3 A;  4RW8 B;  4DR3 F;  3L7O A;  2RNE A;  2GX8 A;  3ISN D;  1RT1 B;  4O4G B;  2MDA A;  3RJM B;  5DM7 Q;  2ZOG A;  2HMI A;  1WD6 A;  4RUC A;  4LIR A;  1HWL A;  5GME A;  4CH0 S;  4ZCM A;  5KFC A;  3KLH A;  3B5Q A;  5LRM A;  2OKQ A;  1UZH A;  4LF5 F;  5K14 A;  2XMW A;  4DJB A;  2KXN B;  3G6V A;  4JI3 J;  1IQT A;  1EHW A;  3UNY A;  1O5J A;  2NXE A;  3J7Z 5;  4WII A;  5KT6 A;  2GML A;  1HD1 A;  2RH6 A;  3KUG A;  1TL3 A;  2ZNZ A;  1URB A;  4WYW A;  2DNR A;  5DRK A;  1K0V A;  3SZ2 A;  3IA0 A;  4O44 A;  3ENQ A;  2G0I A;  1IBK J;  1FJE B;  2UU9 F;  1RTI B;  2IVF B;  1WHW A;  2BV3 A;  1F5A A;  1Q7L B;  2GJ2 A;  1KC8 T;  1SUQ B;  1VBZ A;  3KLV A;  2J6S A;  5A8R A;  5BYS A;  4YR1 A;  4HHH A;  4NAS A;  5C42 B;  2W24 A;  4CO3 A;  2R7X A;  2Z57 B;  2PN6 A;  1WC4 A;  2I38 A;  3C6T A;  4LRB A;  4CO0 A;  3PKM A;  1N88 A;  2WOM B;  5IFM A;  1GX5 A;  3OLA A;  2F4V F;  2XTJ P;  3D68 A;  2B9Y A;  4MK7 A;  4V1A k;  4DI6 A;  4LQY A;  3GQC A;  2EKY A;  1PBA A;  1RT6 B;  2KZZ A;  1RKI A;  4X4U A;  2CQI A;  2YBV A;  3VAJ A;  2R3V A;  2OJ3 A;  1EW9 A;  4RNM A;  4K4V A;  3CJ8 A;  4Y65 A;  1XR7 A;  1G2E A;  3IXQ A;  1VHF A;  2EEY A;  2K7K A;  3A3O B;  4M5D A;  3V6K A;  1AZS A;  2E9Z A;  1EW8 A;  2ZBP A;  5D0G A;  1R0B G;  2B3T B;  2VF3 A;  2VKZ G;  1JLA B;  1WAC A;  2V8V A;  3CDE A;  4NA3 A;  3RRG A;  2IUC B;  1N34 J;  3IMQ J;  4DR5 J;  5JVG Q;  2R2S A;  3NWG A;  3EUN A;  4IO9 Q;  2EWH A;  2ZC3 A;  1MRO B;  3AT1 B;  3DOK A;  2QV6 A;  3KWM A;  4ZN1 A;  1JXE A;  3VAG A;  4LQ9 A;  2IMO A;  2CPJ A;  2VG5 B;  2VPZ B;  3R3T A;  4LVO P;  1EKS A;  1N5Q A;  5B0B A;  8ATC B;  5J1E A;  5LOQ A;  2B7C B;  1JB0 C;  1LXJ A;  2HAI A;  2Y1J A;  1RT2 B;  4NL5 A;  3OL9 A;  2ZH2 A;  4A4J A;  2NRE A;  3OQ2 A;  3QFW A;  3NMA A;  4QIE A;  2XEX A;  2N3O A;  2M4M A;  3HHN B;  4H4K A;  3I82 A;  2H4Y B;  5A2Q U;  3PXG a;  4B9V A;  2CPZ A;  2OPQ B;  2ATC B;  4V19 X;  1ALJ A;  3MUV P;  2EI5 A;  3EDR B;  4ZN3 A;  1N36 J;  2XMT A;  3BSC A;  3UI3 A;  3ZXW A;  4TU7 A;  3BSO A;  4DV4 J;  1FO1 A;  3Q8Q B;  3S01 A;  2DJW A;  2ZZT A;  5H9E K;  4ANC A;  1EJJ A;  2JFK A;  3CCW A;  4KB7 A;  4S0M A;  3VTI A;  1ITP A;  4KV8 B;  5CZV A;  3Q8R B;  2LEB A;  1XNQ F;  1IWA A;  4UOG A;  4RZR A;  1VQO S;  3N6L A;  2KO1 A;  2AGP A;  2KHC A;  3VCD A;  2YX1 A;  3NWR A;  4PG8 A;  4OZ3 A;  2XO6 A;  3IRW P;  2WTF A;  5I3U A;  4TU8 A;  5C5J A;  2MKK A;  3OR1 B;  4PYD A;  3FBB A;  1UAW A;  4OZJ A;  3BDP A;  4IG3 A;  2DGS A;  3N5F A;  4PYA A;  1X5S A;  2OUG A;  3E51 A;  1UEU A;  3DLG A;  3QIP B;  4JV0 A;  2W7P A;  2FLN A;  3GFH A;  4CM0 A;  4KJD A;  4NLG A;  4RW9 B;  4RW4 B;  1FFW B;  1YKW A;  1V6H A;  4CDI A;  2YKN B;  2ZUG A;  4K4X A;  4ECY A;  4AL6 A;  4RW4 A;  2HHW A;  2CQP A;  4WP3 A;  2A0F B;  2W5Q A;  1FEH A;  1FXL A;  1QD1 A;  3TP2 A;  2XMJ A;  2XWX A;  2CZ4 A;  4I7F B;  2X1A A;  4KQZ A;  5CD4 A;  3KDN A;  2D1G A;  1IKV A;  4URS A;  1N54 B;  3HHL A;  2BKO A;  2EXU A;  3M8Q A;  4Y2A A;  3DLB A;  4ED6 A;  1IKV B;  2ILY A;  3EVM A;  4EUV A;  4RNF A;  3TJA A;  3GIR A;  3BGU A;  4PQU B;  4RNN A;  4ICL B;  1EQJ A;  1YZ6 A;  5DZ6 A;  1X4D A;  1RWK B;  1CJU B;  1VJQ A;  2F40 A;  4MFB B;  1N5Y B;  2E1M C;  1F2G A;  3FEX B;  2FGO A;  4CYU A;  4NLQ A;  3IR6 B;  3ZC4 A;  5DQG A;  1YX2 A;  4CH7 A;  5DG8 A;  2UUC F;  3OTB A;  1HNZ J;  4M5G A;  2HWH A;  5KFQ A;  3J80 Y;  3RAM A;  2XUL A;  1TP7 A;  3PV8 A;  1M5O C;  2AJF E;  3WX4 A;  2E7V A;  1O51 A;  2NXN A;  2J7K A;  3DDK A;  3QT6 A;  2V5H G;  3MAH A;  2ZVI A;  3MPY A;  5F0W A;  4DL2 A;  2GA3 A;  4C9D A;  4OZ0 A;  5JMN A;  2VBZ A;  3PW5 A;  5JUM A;  3M9O B;  2EFG A;  3M4X A;  5LMU F;  1OYE A;  1GK8 A;  4KV8 A;  4OI0 A;  5E3C A;  4RW7 A;  4F02 A;  4ZG9 A;  4KO0 B;  1RWW B;  2MPU A;  4DEZ A;  2AQ4 A;  1F9H A;  5K20 B;  4ECV A;  4C97 A;  4MTP A;  2C2Z B;  4DPY A;  3D3C J;  1HD0 A;  2MB0 B;  1AJC A;  1L3K A;  3TR5 A;  1KWM A;  1S57 A;  2FVC A;  3ZTR A;  3GON A;  4ZIT A;  4EBC A;  4I69 A;  3V4I B;  4HDG A;  1DQ9 A;  4O4R A;  3ZZR A;  1KVK A;  2OSQ A;  3K0J A;  3G2X A;  5GAD U;  3PY8 A;  2D3Z A;  3JTP A;  3M8R A;  4UZB A;  3DLL Q;  1UW4 A;  3L95 X;  4EI2 A;  3UN3 A;  3T02 A;  3Q89 A;  2Q3P A;  4BHQ A;  5E3A A;  2DGX A;  4K4Y A;  2D7S A;  2W5T A;  2ZNY A;  1EZZ B;  2MQO A;  2RKI A;  4OZL A;  1QE1 A;  1N5V A;  3MM9 B;  4PWD B;  3UD4 P;  2XGP A;  2XYG B;  3JQM A;  4NLY A;  2AT1 B;  4USI A;  4A8Q A;  1JLE A;  1VBK A;  2RRB A;  1R6Y A;  2XMV A;  2UZA A;  3G6X A;  1B4S A;  4QW8 A;  3QRP A;  5B08 A;  1DTQ B;  2HEK A;  3HX9 A;  1AT1 B;  3OLB A;  1BHN A;  5D4L A;  1ZET A;  3DMJ B;  1XMQ J;  2CJA A;  4HHJ A;  3MMA A;  2BRL A;  2CIM A;  3PKY A;  3JSR A;  1LWC B;  1HNX J;  3ICL A;  3QWP A;  4TN2 A;  3VVU A;  2W9C A;  1RB0 A;  4PWU A;  3GII A;  1UFW A;  2KFZ A;  2W2O P;  1S6U A;  2ZBC A;  3EGN A;  1NCL A;  3R5B A;  4PPZ A;  1NH7 A;  1RT4 B;  2YNH B;  4ZJO A;  3AOA A;  2HHH J;  5L46 A;  2WSF C;  1KHL A;  4I56 A;  2DPI A;  2GVD B;  4AE5 A;  2ZDP A;  4LBP A;  4DOZ A;  4Z37 A;  1RK8 A;  3UDC A;  3LWL A;  4GTZ A;  1S0O A;  3THV A;  2IA0 A;  2PE8 A;  5BYR A;  4LF2 A;  4QQB A;  5KFM A;  2VQF J;  3RRK A;  3NKM A;  4LRE A;  3KNA A;  2ZBR A;  3V5R A;  4DR5 F;  3PW7 A;  3TNV A;  3D66 A;  2BJ8 A;  1RAG B;  1OYD A;  1RCO B;  2RQC A;  2NQP A;  4F3Q A;  4Q0B B;  2OTJ S;  1CBK A;  3ISN C;  2KJW A;  4ZLN A;  1XIQ A;  1KS2 A;  3QNW B;  4WJB A;  1ZM2 A;  4C0H A;  1RTJ B;  1QUP A;  2OPR B;  3OR2 B;  2I6W A;  1WEY A;  4QPT A;  4BBY A;  3MK1 A;  4J9K A;  2DYA A;  3G8T A;  2UXB J;  5ADZ A;  1FSU A;  3CJT A;  1NRK A;  5LRN A;  5C25 B;  2VBX A;  3FZB A;  4Q8F A;  4HEA 9;  4CCH A;  2XCA A;  4XPC A;  4ELT A;  2BBE A;  5B0F A;  1SPB P;  4Q5V A;  2WON B;  2B43 A;  2MTL A;  3ISZ A;  2LMI A;  2UV8 G;  1YJV A;  4HAC B;  2OEJ A;  2B4P A;  3JTO A;  3WAW A;  4FF4 A;  4PXE A;  1N56 A;  3AJ2 A;  2UUA F;  5GOV A;  1Y5I B;  2J9D A;  4FVM A;  2YNF A;  3KUH A;  1OJ4 A;  3OXL A;  4FPR A;  3W66 A;  4CLL A;  4DV2 F;  4DV4 F;  4DV6 J;  1QAI A;  1FE0 A;  6FDR A;  5KFB A;  3HHK A;  1WOP A;  2W9A A;  1UVL A;  1FK9 A;  4P73 A;  2FGC A;  4YEA A;  5CH7 B;  5M2R A;  2GJI A;  3Q8V A;  1PJ7 A;  3QQC D;  3I32 A;  1QSY A;  2AJ0 A;  2RDJ A;  2UXD F;  3I9V 9;  5K9F A;  1GXU A;  2QLW A;  1BLU A;  4M5M A;  1FNX H;  2IC3 B;  2HS0 A;  4ZVE A;  2VPX B;  3POT A;  3LO3 A;  2E29 A;  2W7A A;  4MIB A;  4LF6 J;  4DR4 F;  4WKR A;  1XR5 A;  2RD5 C;  5T7L B;  2E7X A;  5DDO C;  2W1B A;  3NKO A;  1TEL A;  3LPY A;  1ZM3 A;  4DR6 J;  3UFC X;  1KTV A;  2GGP A;  3MM6 A;  2YWH A;  1FRJ A;  3GIK A;  2E1C A;  1T9V A;  4LUB A;  3GIM A;  2RAQ A;  4ZPB A;  1RAH B;  4K0K F;  2R7T A;  2JFD A;  2DNH A;  2WB4 A;  1PBU A;  1NHV A;  4P75 A;  2AZ1 A;  3IR5 B;  3OL7 A;  3MM9 A;  3DOL B;  4XAK A;  2XLJ A;  3LA0 A;  3BB5 A;  5DM6 Q;  2HVZ A;  1C0U A;  2LA4 A;  3C6U B;  3DMJ A;  3CD6 S;  4Q2M A;  4WFA Q;  3PR5 B;  2HQC A;  4Z7Y A;  1BQM A;  4LF4 J;  4C3M A;  4MK9 A;  3GTY X;  1PYT A;  4ELV A;  2VQE F;  2FJD B;  7FD1 A;  5AXL A;  3RU0 A;  1LFW A;  1RI7 A;  3J7A 1;  5C66 A;  4WFY A;  4NXN F;  3EZO A;  1NSQ A;  1U1Q A;  2Z8Q A;  2LLZ A;  4DUZ J;  2UUC J;  3SQG A;  1Q8B A;  5KG6 A;  4MK8 A;  1RAJ A;  1CS4 A;  1W2B R;  2FHK A;  4HTI A;  4C3K A;  1H38 A;  4YN3 B;  4CXS A;  2HQD A;  4DV3 J;  2EC2 A;  2HNY B;  2BAN A;  2XSJ A;  4B3M J;  1N2L A;  1Q78 A;  3DN9 A;  2OIH A;  2BQ3 A;  1IKX B;  4Y2K A;  1KQG B;  2P8I A;  3NKP A;  3T00 A;  3ITH A;  2FJV A;  5F3Z A;  1PCA A;  2IUC A;  2IDE A;  1GMW A;  2B0G A;  4WKY A;  5EWF A;  4K4S A;  3PFE A;  4O3O A;  4QWC A;  4DL4 A;  3UR0 A;  1SL2 A;  5GMD A;  1Q4R A;  1X4H A;  3ENA A;  2VA3 A;  5AXM A;  4GMK A;  4NZ7 A;  1VQ7 S;  4LF9 F;  2G2O A;  1FDN A;  2N4D A;  1ZED A;  1D9D A;  2ZH7 A;  1NDP A;  4PPD A;  4DX8 H;  4IRC A;  2MKS A;  4ZCI A;  3IBC B;  2GVZ B;  1S12 A;  3OFF A;  2YH1 A;  1T05 A;  2R7O A;  4C8Z A;  1UEV A;  4JI5 J;  1BWE A;  4I6A A;  1X5P A;  3EZ5 A;  1TV6 B;  4OYA A;  4JI8 F;  3BGL A;  3H59 A;  2G2Z A;  2CNL B;  4ECS A;  2CJX B;  4OZ5 A;  1MLA A;  4B3R J;  4KGZ B;  4KM4 A;  4DV1 J;  4R8U A;  4JI1 J;  1JK9 B;  4ZLL A;  4I7F A;  5LJ5 Y;  3G71 S;  2FC8 A;  3QLH B;  1WOO A;  2OFG X;  3M8P B;  3VAH A;  3CCZ A;  4B02 A;  2FD2 A;  2GW8 A;  1Q16 B;  2JEI A;  3TEG A;  1CJT B;  2IJN A;  3VAF A;  3E2E A;  2ATL A;  3FCW A;  4HVZ A;  1CPZ A;  1NHK L;  1FKA F;  3C46 A;  1MNE A;  3UD5 A;  1JJ4 A;  2W8S A;  2BDP A;  3EXC X;  2MKC A;  4Y3C A;  3POT B;  2CNO B;  2QIF A;  2E1P A;  3T6B A;  1EW2 A;  1HDH A;  3OR1 A;  5LT5 A;  1GXT A;  5CYQ A;  1KH5 A;  2W8D A;  3A4T A;  1TL1 A;  2FHJ A;  2MJN A;  3TUJ C;  3MPV A;  3SSQ A;  2M9K A;  3NOC A;  3BEG B;  4U96 A;  1TKZ B;  5D0H A;  3ADA C;  3S7R A;  5E2Q A;  1X4G A;  3D1Q A;  4CLW A;  2HBR B;  5HRT A;  2HFV A;  4N41 A;  1VOM A;  1LNQ A;  4QWB A;  4DPU A;  5F8L A;  1VQK S;  3P49 B;  3LXQ A;  2MMY A;  4JI8 J;  1VQ5 S;  1YBA A;  2BJ3 A;  3CCQ S;  2HUR A;  3MMJ A;  3V6J A;  1Z1Z A;  1S6Q A;  4N56 A;  4B3O B;  2YKO A;  5F0U A;  1DZ5 A;  1GXL A;  2NPF A;  3HHD A;  3A3N B;  3M30 B;  4ZMM A;  3B6B A;  4LFB F;  4CYR A;  1YVF A;  4WCE Q;  3Q0A A;  1KN6 A;  3BGO P;  4NX9 A;  4O3P A;  3W1Y C;  5A8K A;  4DV0 J;  2I8E A;  3TUI C;  4URG A;  4X66 F;  3C8Y A;  1X4A A;  2M0G B;  3FNN A;  3E3X A;  4LF7 F;  4K2X A;  1E6Y A;  2FDN A;  2LXI A;  3C15 A;  4F0M A;  1RKJ A;  1MMN A;  3J81 Y;  4ED4 A;  2RU3 A;  2Y8W A;  3NKR A;  3AOC A;  4NWJ A;  5F9N A;  4ER8 A;  2OD4 A;  2KHD A;  3O5T B;  4YDX A;  1ELO A;  1WHX A;  3OUY B;  4LR7 A;  3UVJ A;  4O23 A;  2RML A;  2NPI A;  2MQP A;  1D8Y A;  3MUR P;  5F8I A;  4F4W A;  1CC8 A;  2BAN B;  4I67 A;  1OQ6 A;  2V2Q A;  1ZOT A;  3QT8 A;  4X4Q A;  1SC1 B;  1FD8 A;  1ZZN A;  2FYX A;  4F2S A;  3MXH P;  1OY9 A;  2JLG A;  2QA4 S;  2IM3 A;  2C3O A;  2Q6C A;  1SC3 B;  1N52 B;  3MMB B;  3FJ2 A;  2J7U A;  2QO3 A;  4LF6 F;  1SCJ B;  2DNZ A;  4J91 A;  4ID8 A;  1M5S A;  5E3Q A;  5CAA A;  1LKZ A;  2HS4 A;  2RRN A;  2KG0 A;  1T05 B;  5INH A;  2J0W A;  5AE1 A;  4DV0 F;  1RTD B;  3IWL A;  2KTQ A;  1XJW B;  1FFS B;  4OX6 A;  1TL7 B;  3GSD A;  3V2U C;  1YJW S;  3DLE B;  5KFT A;  1SJF A;  1NKC A;  1RTD A;  3CME S;  3R7S B;  4NCG B;  1KHK A;  4CXU A;  1C0T B;  3HFV A;  5J2Q B;  1VRU B;  2CQD A;  4CQ1 A;  1U2F A;  4LT6 A;  5M2U A;  2DHA A;  1KDN A;  1RU1 A;  3N79 A;  1S4F A;  2KN4 A;  5D4N A;  1JNR B;  2IVY A;  1O0P A;  4L6V 3;  4P72 A;  1RT3 A;  3MTJ A;  2VD3 A;  4ECR A;  3FEZ A;  1RT5 A;  2MQ8 A;  2OMO A;  3MCM A;  4AXJ A;  3ENV A;  3AQP A;  4FXV A;  3L3C A;  2L9N A;  4F0K A;  2FVP A;  4TLQ A;  2HNZ B;  2YX7 A;  4H4M B;  2RUG A;  2YNI A;  3R6L B;  1EJ7 L;  5HSP A;  3CCS S;  4K7Q A;  1KLN A;  4GTY A;  1B70 B;  2LDI A;  4WK1 A;  2VH7 A;  1HQE A;  3CDW A;  1R0C B;  4H4O A;  4LR2 A;  1UJ4 A;  3V81 B;  4DL6 A;  4LR9 A;  1DLO B;  4YB1 P;  1KRP A;  3CED A;  2JEF A;  2XMU A;  3P6Y C;  2R7R A;  1Y11 A;  4C4W A;  2CJY B;  1VRT A;  4X84 A;  1RAI B;  2PEH A;  3EX7 B;  1E1Z P;  2G0C A;  1RT1 A;  4O4G A;  1Y3K A;  4QU7 A;  2HS3 A;  4TLR A;  1BGX T;  2HIQ A;  2XWY A;  3GG0 A;  4F25 A;  1VHI A;  3W62 A;  3H2L A;  4LRF A;  4LBI A;  3IWX A;  4GC7 A;  1VQM S;  2YQ1 A;  2HQG A;  5K14 B;  4FVC A;  3DRP B;  4FNH A;  4Q2L A;  3J81 j;  3T1Y J;  1GT8 A;  1RAE B;  1S7H A;  2XLK A;  2HHX A;  2MQM A;  2PMH A;  5KFE A;  2V63 A;  1S6Q B;  5C7P A;  4QWA A;  2CJK A;  4MKB A;  4F3O A;  1F2H A;  3R1L A;  2AF6 A;  3A12 A;  1FT8 A;  4MYU A;  3GV8 B;  3DOM A;  5HBM B;  3DGV A;  1PO6 A;  2DR7 A;  4KHP F;  5T7L A;  1VK8 A;  2K1R B;  1JWW A;  4A8M P;  1APS A;  2JH3 A;  5IV3 A;  3C19 A;  1TL3 B;  4OYW A;  3AD9 C;  1SKW A;  5EN1 A;  4KKO A;  4GKK F;  4CT8 A;  2ZZM A;  4J9N A;  2MHN A;  4KAI A;  2MJU A;  1RP5 A;  2CZ9 A;  2G9O A;  3IAM 9;  1VFJ A;  4ZCL A;  1PAE X;  2VKR A;  3GFZ A;  1DFD A;  2ZBI A;  5KFA A;  1ELZ A;  4RNO A;  1Y7P A;  3FC9 A;  4DR2 F;  1X9W A;  4RX6 A;  3WAX A;  1H2V Z;  5L38 A;  2RT3 A;  4OHX A;  3M2U A;  4Y28 C;  1JXL A;  2K7J A;  1QAY A;  2BM0 A;  3W65 A;  3KJV B;  1TKX A;  2ERR A;  1J5E J;  1ALH A;  3DPC A;  2DCU B;  3PTW A;  1SJ4 P;  2W2N P;  3HD1 A;  2U1A A;  1G4C A;  1JJH A;  3DLK B;  2VZ9 A;  3UDL A;  5I42 B;  5K4P A;  3BKF A;  1S9E A;  1WC5 A;  4DFM A;  3SZZ A;  2VJV A;  5KFI A;  4NXM F;  4NLP A;  2LYV A;  2Z2L A;  3C14 B;  5HQL A;  3CIZ A;  4LQ3 A;  2QLJ B;  3PX6 A;  1KNZ A;  1ZPW X;  1OWX A;  2GS8 A;  1Z2L A;  2PEB A;  3NXZ A;  3PHT A;  1UMJ A;  4Y2C A;  3MF5 A;  2L08 A;  3NG8 A;  1JX4 A;  4IYQ A;  1ZM4 A;  3CJ4 A;  5KFS A;  3PO5 A;  3QZ8 A;  3FUY A;  1F9E B;  4CNY A;  1RA6 A;  2EVZ A;  4WTO B;  5HQ8 A;  2LXF A;  1QTM A;  2LCW A;  3T9N A;  1JLC B;  3SCL E;  4XIU A;  1SVD A;  3MK2 A;  4OYX A;  1U0H B;  3F56 A;  1NSA A;  3PRV A;  4HL9 A;  1BQM B;  3G87 A;  3BF4 A;  5KFZ A;  3D54 A;  2KI2 A;  4DL5 A;  2P5V A;  4PKD B;  3W9J A;  1WOS A;  1CVJ A;  1T9Y A;  2XZW A;  4LF7 J;  2HHS A;  4ES3 A;  3H25 A;  1P1T A;  4H4M A;  3TUZ C;  4MFB A;  2KU7 A;  3I87 A;  3QWU A;  4ID5 B;  2AEJ A;  1P27 B;  3SDE B;  4DLG A;  4NE9 C;  2HQF A;  3KNG A;  1XER A;  2CQG A;  3RR7 A;  2VOD A;  4I64 A;  3WDO A;  4I6Y A;  3KLI B;  1BWV A;  4DV5 J;  5F8N A;  2GSU A;  2CFX A;  1DTQ A;  4JI6 F;  3F41 A;  4KFB B;  3SEO A;  5I4M A;  4O3Q A;  4F4X A;  4U95 A;  3K17 A;  2HRU A;  4LF5 J;  1ARO P;  1JQG A;  2W7O A;  1V5V A;  1T02 A;  4DU8 A;  4M5D B;  1WEZ A;  4DSJ A;  1S1T A;  2ALY B;  3DGP B;  2BOP A;  4LF4 F;  2JJ4 D;  1AA1 B;  5D77 A;  3GV7 B;  3NKY A;  2QL9 B;  4ZPD A;  5AXN A;  4UUX A;  2V69 A;  5HRO A;  1DJ0 A;  5L0E A;  2HWT A;  1SJ1 A;  3DRR A;  4JV2 A;  1C1C A;  5B7W A;  2L48 A;  1ZAV A;  4IRK A;  4I2P A;  3GJS B;  1CLF A;  7FDR A;  4G1Q B;  4MMO A;  1PYO B;  3QSI A;  2KG1 A;  4WZQ A;  2ZE2 A;  4ZPW R;  1BY9 A;  1S6P B;  5ETS A;  4M5I A;  2KJV A;  1JLB B;  1KTQ A;  1SXL A;  3P5B P;  1TL7 A;  1NK0 A;  1N8R T;  1N6Q B;  1S6P A;  3I5B A;  5EGE A;  4R0J A;  2V2K A;  2VOO A;  1CQN A;  1VYA A;  3B82 A;  4KHM A;  4M63 A;  1Q8K A;  1JMT A;  2Z30 B;  4ZJL A;  4C48 A;  1MSW D;  2XZT B;  2E9R X;  1AJD A;  1GMU A;  2IY5 B;  3W63 A;  5IT0 A;  2HK2 A;  1RT5 B;  2XHC A;  1IJF B;  1XNR J;  3VVT A;  3W5Z A;  1JLF A;  3KK2 A;  3BR9 A;  3T41 A;  5ETP A;  4JI4 F;  4ZLP A;  1N2K A;  2PII A;  4DR7 F;  2FJA B;  2YWF A;  2M5Y A;  2R7W A;  4YY3 J;  2GZO A;  3OJS A;  4AD6 A;  3C6T B;  3F44 A;  3TZW A;  3K5P A;  4CLF A;  2UUA J;  1AB8 A;  1LW2 B;  2WON A;  1HQU B;  4FS1 A;  1SB6 A;  1UVJ A;  4NLT A;  4PRF A;  1KHV A;  3EWG A;  2HGM A;  2IAJ B;  1MN9 A;  2W8L A;  4X4O A;  2CQH A;  1V3S A;  2MYF A;  1N32 J;  3GJT B;  4DZD A;  3BO2 A;  2V67 A;  3LF0 A;  4HI1 A;  1M5H A;  4OHV A;  2VDH A;  4RW8 A;  1K7H A;  2B56 A;  3HVR A;  3BO3 A;  4M8L A;  3U1N A;  3PJW A;  4CI0 B;  4YOE A;  2VL1 A;  2ZDO A;  1HQ2 A;  5K8M A;  3GR0 A;  4D3H A;  5KXA A;  2FUG 9;  3RB6 A;  5AJ9 A;  1FXD A;  1YK9 A;  3FSI A;  3MCN A;  1HBU B;  5KTQ A;  4WF9 Q;  4UW2 A;  4DG1 B;  3BZQ A;  8AT1 B;  1P1L A;  3EM1 A;  2G2Y A;  3M8S A;  1EP4 A;  4DFP A;  1N33 J;  3WQP A;  3NNC A;  5H9F J;  4DG1 A;  1S1V B;  2GVZ A;  4QR2 A;  5M2P A;  4YY3 F;  3KLG A;  1RHJ B;  3FEY B;  1KH4 A;  3Q2T C;  2KM8 C;  1H72 C;  2W4D A;  3NAH A;  1I6J A;  4NCG A;  2ZC4 A;  2Y3Y A;  2VOP A;  1FCA A;  2DXF A;  4OZ2 A;  3K7R A;  4P71 A;  3G96 A;  5J2N A;  1MW7 A;  4WE1 B;  1AJA A;  2VQE J;  2CQ1 A;  3S1T A;  1TFW A;  1HA1 A;  1UWA A;  3GR1 A;  4CIO A;  1AUD A;  1N32 F;  1SC4 B;  4LSL B;  2JL9 A;  3HHL D;  4W98 A;  4PWW A;  2WRM A;  4C8M A;  1L3S A;  4ILM A;  3EPG A;  1V3R A;  4CWB A;  4KJG A;  1R0A B;  3CGI A;  3DI6 B;  4NZ0 A;  4C8K A;  2CAJ A;  3JTN A;  1IXK A;  1IWG A;  2AHO B;  4GTX A;  4DUT A;  4IR9 A;  3ETM A;  3T1A A;  1C1C B;  4KPY A;  3MR6 A;  1LW2 A;  3TA2 A;  1ZAW A;  4YHH J;  4AXI A;  3MFI A;  5IT9 U;  1NK8 A;  3BJY A;  3QRQ A;  1JLB A;  4LJM A;  2VV5 A;  3ZZ0 A;  1IR1 A;  3K59 A;  1RWU A;  3PDN A;  5HVG A;  4USK A;  2CQC A;  1X7V A;  2G13 A;  2CQ0 A;  3C3L A;  2ASJ A;  4UOR A;  3PO4 A;  4RU9 A;  4RU2 A;  3CSK A;  5H1S V;  4OLO A;  3A8I A;  1UPM B;  2I9S A;  4U8Y A;  3ITH B;  4OJH A;  3OL6 A;  1U1P A;  2WVE A;  3CJS A;  2ZVS A;  4OJ3 A;  3GFY A;  1UPP A;  3QLH A;  2YWK A;  5AXK A;  4A46 A;  2FJW A;  4JI5 F;  3RW6 A;  4QOT A;  3N01 A;  3M30 A;  4QIF A;  2ACM A;  4B9M A;  4G6V B;  2H51 B;  4ZIW A;  3MOJ B;  4ZJQ A;  1Y4Z B;  3QGG A;  4EWT A;  1KH7 A;  4OI6 A;  5IS2 A;  1WG4 A;  2AMC B;  1DQ8 A;  3GWC A;  3GLJ A;  3KHH A;  3NKQ A;  4DPW A;  3TX8 A;  4JI0 J;  3IGY B;  3Q23 A;  2MZJ A;  4ZP7 A;  5KT3 A;  2LXU A;  1T7P A;  5CYM B;  3NNA A;  2MLX A;  2PGC A;  1RTH B;  1OY6 A;  1IR2 A;  1LW0 B;  4ED8 A;  2AV5 A;  5HJY A;  2HVH A;  4FF1 A;  3WBH A;  2YXL A;  4K8R A;  4OI3 A;  1HNI A;  2JEJ A;  4C8L A;  3LAM A;  2HIY A;  1GTH A;  2EW9 A;  2QX0 A;  4ZP6 A;  4BC7 A;  4DDF A;  1S9F A;  4B9U A;  4FN5 A;  5IWA J;  1FRL A;  4Q43 A;  4X2B A;  5L0B A;  3D0H E;  1NK6 A;  3BBB A;  2AWZ A;  3J7Y I;  4M5H A;  2LU2 A;  1U8S A;  3Q22 A;  1U09 A;  2R8H A;  5DLT A;  3HF5 A;  1L3V A;  4RO0 A;  2PI5 A;  3B4M A;  4L3N A;  4QZV B;  4Q0B A;  2E5L J;  1DAR A;  2X51 A;  2OTL S;  3NVL A;  4GRS A;  1U1N A;  1U1R A;  1TTH B;  5DJB A;  2C22 A;  4RLE A;  4OV1 A;  1N5T A;  2R7S A;  3CCT A;  4KIA A;  1S1V A;  2W4C A;  4HR2 A;  5TJ3 A;  3H98 A;  3NBP A;  1NDK A;  2QL5 B;  3KHG A;  3MD1 A;  2F1F A;  3PX0 A;  1VQ8 S;  4MKA A;  2C2R A;  2RU9 A;  4CP5 A;  1HFE L;  3QO9 A;  4ECQ A;  3MUT P;  4E0D A;  2QZU A;  4UPK A;  1UVK A;  1GMW D;  2J8A A;  3QGH A;  5GAH I;  3WHI A;  3RBE A;  1HNX F;  2AJ4 A;  3AB4 B;  4HAC A;  4O3R A;  3G6Y A;  3PG9 A;  4EO8 A;  2YKM A;  1T94 A;  2WSC C;  4KYZ A;  1HWI A;  4RPF A;  4RWX A;  1RXO B;  5HO4 A;  3OHA A;  1LV5 A;  2IJF A;  5H9E J;  4L74 A;  4DPO A;  4IFV A;  1VGY A;  2OHD A;  2OPS B;  5AE3 A;  2JX2 A;  3OXF A;  4E98 A;  3TO8 A;  4IFV B;  5I42 A;  2LP4 A;  1YSJ A;  1Y5N B;  2RS8 A;  1FHT A;  5CA5 A;  2HNY A;  1Q5Y A;  3ZZT A;  3RGI A;  2B7B B;  2RF2 A;  4F26 A;  4GO7 X;  4X65 J;  3MUM P;  4EU0 A;  4U67 Q;  3BDH A;  5SUH A;  2DT9 A;  4ILR A;  1NZ8 A;  2YKN A;  5KFU A;  3CCL S;  1U49 A;  2XNR A;  4U7U D;  3SFG A;  1DTT B;  1EAR A;  4RW9 A;  3T19 A;  4P9S A;  3L09 A;  1UFL A;  4EZ9 A;  3ZTP A;  3NCR A;  2CDR B;  3PM9 A;  1Y00 A;  3PJ9 A;  5KFK A;  2ROE A;  1B3T A;  1RAB B;  1S1X A;  3FFI A;  3G8Q A;  1SQF A;  1U26 A;  3PIO Q;  5D3G A;  1AFI A;  3GSI A;  2P9C A;  4RUH A;  1TVR A;  4J9R A;  1KR4 A;  5D4P A;  3QRR A;  4X4R A;  3KK3 A;  1FFG B;  2HFZ A;  2V6A A;  2FIU A;  2GNK A;  1HR0 F;  3LW5 C;  1NJW A;  2DB1 A;  3LP0 A;  2VG7 B;  3M9N B;  2ASL A;  2UVV A;  5GRR A;  1SV5 B;  2JWN A;  2WZ1 A;  1K1Q A;  1YWX A;  3MMC A;  1HQE B;  1UEK A;  2PD1 A;  1A0O B;  3BKU A;  4DX6 A;  3MMC B;  5KOX A;  3NAI A;  2DIU A;  2IAJ A;  3W61 A;  4YUD A;  4F8R A;  3KLE A;  3H8Y A;  1U6Z A;  1S0N A;  4DFK A;  2OFH X;  4F4A A;  2P6T A;  5AE2 A;  2VFS A;  4X65 F;  2GHW A;  4RKU C;  3KUE A;  4YDD B;  1YZ7 A;  3RBX A;  3DU6 A;  3SMZ A;  2HND B;  5ETN A;  5CAB A;  1A7G E;  3NGD A;  2P9G A;  5T14 A;  3H5S A;  4OYO A;  3GZ7 A;  1E6V A;  3K58 A;  1U02 A;  2MST A;  3O2I A;  5K8P A;  1ALK A;  3T5J A;  4IDK A;  3VR1 A;  4Y6I A;  1HLW A;  1E6V B;  2V8D A;  4N76 A;  1N5S A;  2V34 A;  3PCO B;  3ZZO A;  2XCP A;  4DR6 F;  4LFC F;  4LSN A;  1SHQ A;  1HMV A;  1PIE A;  2HFS A;  4DQP A;  5EGY A;  4AND A;  3G9C A;  2PSZ A;  4PXC A;  2LKZ A;  4TY9 A;  2Z2Y B;  4CLY A;  5L1I A;  4A47 A;  3PX4 A;  1M5P C;  3D6M B;  5B09 A;  5SZT A;  5L8R C;  1XMO F;  1GNK A;  4B9S A;  5LJ3 Y;  2VU5 A;  2DGW A;  4FDJ A;  4GVB A;  3M2R B;  3OTO J;  5J2M A;  1WHV A;  2CNK B;  2DGV A;  3HZG A;  1RWP B;  3OVA A;  4TY8 A;  4CO4 A;  5KFJ A;  2LQ5 A;  2NXU A;  3KHR A;  4PQA A;  2HFN A;  1S0M A;  1X4E A;  4NRT A;  4NWB A;  3CJK A;  3J7Z T;  3RB4 A;  2MLZ A;  3HVT B;  4U7U K;  1AUK A;  1PKU A;  3KLH B;  1S72 S;  2W5X A;  4JV1 A;  4FPI A;  2GIQ A;  4DX7 A;  4PWD A;  4ZP9 A;  1S1W B;  1YJR A;  2R9L A;  4J9M A;  4NWX A;  3FMB A;  2XLI A;  3MCS A;  1S9G A;  2MGZ B;  4L72 B;  5GAG U;  3R2D J;  3M05 A;  1D9A A;  4ITS A;  3QSY B;  1ROF A;  2YKQ A;  3EDQ B;  4C2M A;  4FXD A;  1CJU A;  1FTC A;  2FJE B;  2XS7 A;  1G3O A;  1RT7 B;  4LFB J;  3PEH A;  3DRY A;  1M5V C;  5LSO A;  2XMA A;  1M1K T;  4WU2 A;  1IBM J;  1QY7 A;  2OGU A;  4F36 A;  4CO2 A;  4LFC J;  1HBN A;  4ZPV R;  4DXL A;  4PG5 A;  1R8A A;  3M9M B;  2HRT A;  3AXK A;  2NZC A;  5A6P A;  3J80 U;  1WF2 A;  3W2W A;  1I94 F;  1Z4U A;  5ETK A;  4WYL A;  2L41 A;  2VPW B;  2ZH6 A;  3I4H X;  3KTQ A;  4IOC Q;  1TK5 A;  2W5R A;  3KHL A;  3DFE A;  3BSA A;  5HJX A;  2VG6 B;  5H9F K;  3AAW B;  3TX0 A;  3BM7 A;  1H98 A;  2VBW A;  2WAQ D;  3JQK A;  3N0V A;  2J9D E;  4LRD A;  1URN A;  4YME A;  2DNO A;  1HNV A;  3CJ0 A;  2ABY A;  2M70 A;  1IVZ A;  2Y0B B;  5KG7 A;  4K4W A;  1FWP A;  1B0T A;  2XY7 A;  5A8K B;  4OHY A;  2CKW A;  1RT2 A;  4XK8 C;  3BSN A;  2CYY A;  2CJB A;  2FY8 A;  1NDC A;  1YBU A;  2P9E A;  3U27 A;  1HI8 A;  5BXI A;  1WF1 A;  1P8G A;  3SQO P;  4GC6 A;  2V68 A;  1TK0 A;  4PXB A;  4P10 A;  1QVG R;  2A2C A;  1AZS B;  1WTF A;  2CUY A;  1FJG J;  2AJ1 A;  3PEJ A;  1WC6 A;  2KKH A;  2B6A A;  2MZ1 A;  1K73 T;  4M5K A;  4B9L A;  2O67 A;  3KLI A;  3MDF A;  3DDI A;  1HHS A;  4DV7 F;  1VBY A;  5IJQ A;  3VGT A;  1CJT A;  2Z2Z A;  3LH2 S;  4K4Z A;  1CUL A;  5IZH A;  5A76 A;  3TW0 A;  1RWV B;  1IQZ A;  2MSS A;  4NLD A;  1SHN A;  2R8G A;  4EMD A;  2G1H A;  2HK3 A;  3RB0 A;  1I94 J;  2UXC F;  1SIW B;  4R5P A;  1YHQ S;  4DF8 A;  3ZZY A;  1S4E A;  2I5J B;  3A1Y G;  4OX9 J;  4KJI A;  5MLC V;  1C1B A;  5KFW A;  2DVI A;  3V4M A;  4UY8 5;  3HT3 A;  1VQL S;  1T9T A;  1EQ0 A;  1U7L A;  4J9L A;  3VZH A;  1RYR A;  3IS9 A;  2CAD A;  4DV2 J;  1ZAX A;  3N9U C;  4DV6 F;  1AYE A;  5DS7 A;  2V8P A;  1TFY A;  4WZM A;  1VC6 A;  1YJT A;  4C7Q A;  5EX3 A;  2Q79 A;  2VPY B;  4HTJ A;  4NA1 A;  5J1N A;  4BWM A;  4ES2 A;  2UXD J;  1RWO B;  2QG9 B;  1IKX A;  5J2M B;  1KQS R;  3W2W B;  1WC1 A;  5F41 A;  2QA4 G;  2CVI A;  2Y0S D;  2IA6 A;  4YS2 A;  2XMK A;  3H20 A;  1BMQ B;  2H5I B;  5E7O B;  2D41 A;  4M1K A;  3EVW A;  5E0O A;  5U47 A;  4URQ U;  5ETQ A;  4DQS A;  3R97 A;  5LMN J;  4AQY J;  3EMT A;  3TVK A;  3BGF A;  2XS5 A;  2ZE2 B;  3H2U B;  1FX4 A;  1B0P A;  3GG1 A;  1TAU A;  2QFJ A;  6AT1 B;  4KHR A;  2IBO A;  4K0K J;  1HPZ B;  4RNH A;  4NEY A;  3UN5 A;  5EDW A;  2D69 A;  4U6P A;  2N3L A;  2ZM6 J;  1KLM B;  4X4T A;  2PT0 A;  1UW9 A;  2G1D A;  4LBH A;  3CD5 A;  2OLW A;  3HKZ D;  3L7U A;  3DLH A;  2HBQ B;  1HBM A;  1NDL A;  2X3D A;  2BAB A;  3BBC A;  4N8N A;  2OML A;  4NYO A;  4PG6 A;  3JS9 A;  5B0A A;  4B17 A;  2KDO A;  3V81 A;  2Y1I A;  3QPI A;  1H73 A;  4DZ6 A;  4LVN P;  2ZH4 A;  4ECU A;  2DO4 A;  1RCX B;  2OAU A;  5G0R B;  3ILO A;  3OT9 A;  4QWD A;  2HG4 A;  2K3K A;  2MKJ A;  2H5J B;  3ETO A;  3R5D A;  3DHW C;  1KP6 A;  2XSJ B;  4M94 A;  2KFN A;  2KYZ A;  3EJM A;  3KD8 A;  3M2V B;  1UWB B;  2UUW A;  2VFV A;  1P49 A;  2HBY B;  3PYE A;  3MAA B;  1Q8L A;  1SJR A;  2DR6 A;  2IM1 A;  3KYL A;  2QSF A;  1V3Z A;  3TUP A;  1ED8 A;  3KG1 A;  4LSN B;  3UE2 A;  2F65 A;  2XBP A;  4DN0 A;  4V19 J;  1KH9 A;  4RJV A;  5ETL A;  4KGM A;  3RR8 A;  1X0P A;  2V9K A;  2CVE A;  4FDF A;  4JB8 B;  1PG5 B;  1RT6 A;  4K4U A;  4X4N A;  4PEO A;  1FDA A;  4B08 A;  5EWE A;  4DF4 A;  1XMO J;  2D74 B;  3FSX A;  3CMR A;  1MMD A;  1DQA A;  1RWM B;  4FKX A;  5HK4 A;  5F8M A;  1TAQ A;  3DM2 A;  2ZM6 F;  1DTT A;  3PW0 A;  3TAQ A;  3A8E A;  2M8D B;  1Q8I A;  2WVC A;  1RHR B;  1T9X A;  3HFK A;  4UT4 A;  2C2O B;  4QIW D;  1UVM A;  1S0V A;  3NGT A;  3A52 A;  2N82 B;  1B7F A;  1CEZ A;  2W25 A;  3P96 A;  2FJX A;  3G8S A;  2ASD A;  1ZH5 A;  4AL5 A;  2O1P A;  3LP2 B;  1X31 C;  1RBO B;  3BYR A;  4C8Y A;  1G7C B;  1H2T Z;  1S49 A;  2XHW A;  3LP1 A;  5THW A;  4F4K A;  1R8P A;  4DV1 F;  3CIM A;  2PFD A;  4UZC A;  4JI1 F;  4NRU A;  1EKR A;  2GSN A;  2VIC A;  2R7V A;  1PJ6 A;  4FP9 A;  2HNZ A;  1TKX B;  3B54 A;  3MEK A;  2UU9 J;  3L7P A;  5E33 A;  2IIH A;  2MZR A;  4NLX A;  4RUB A;  4WFZ A;  5HQM A;  1RQ0 A;  2DBB A;  3CJ5 A;  2UUB J;  3AQO A;  3JXO A;  4PG7 A;  1IBL J;  2GFF A;  1RGV A;  2BX6 A;  3W8P A;  2F9D A;  5KG1 A;  3T1Y F;  5GAH U;  1WI8 A;  3WX8 A;  2AYG A;  1D3W A;  3PRD A;  4UPL A;  2J0S D;  4JBC A;  2HMI B;  1E2S P;  4KFB A;  3HD2 A;  4Q7A A;  1R8B A;  4TY8 B;  3OSN A;  2DHH A;  5KT5 A;  3HSG A;  1WKK A;  4ZVS B;  5J2P A;  1KOH A;  1JLA A;  3I31 A;  4OI2 A;  4DL3 A;  5DDP C;  2M88 A;  3FK4 A;  1GAO A;  3O6Q A;  3IBF B;  3ENW A;  4I2Q B;  5KFY A;  1FTR A;  1HW9 A;  2B4V A;  5D0E A;  1FDB A;  2DNM A;  2EFP A;  1FEE A;  3PNI A;  2H65 B;  2FTR A;  4PAA A;  2A1B A;  1RHM B;  3NL0 A;  1WWH A;  5EWG A;  3I0R A;  3B4D A;  4QIG A;  4NI2 A;  3S8S A;  4P7V A;  3UCU P;  2AU0 A;  1ANJ A;  5AT1 B;  3QAE A;  4WWS A;  1NHU A;  2BE2 B;  3NGK A;  2DKO B;  2XYH B;  3T01 A;  2BR0 A;  1WHY A;  4DCP B;  4DR2 J;  1WDT A;  4WFX A;  4LRA A;  3W64 A;  3IFE A;  2E7W A;  3ZZZ A;  2ADC A;  4C6A A;  3AXM A;  1JLQ A;  2W2Q P;  2V94 A;  1KON A;  2KRR A;  3MWB A;  5DQI A;  4DV7 J;  5JJB A;  2HW3 A;  4Y2M A;  4W92 B;  3OUY A;  2DIT A;  3BR8 A;  2UV8 A;  4W90 B;  4OJG A;  1JLE B;  4LF8 F;  2OD6 A;  2YPY A;  3I0S A;  4DL7 A;  2AGO A;  3TQ1 A;  3W2V B;  2DRD A;  2IHR 1;  3FQK A;  1FJ7 A;  1ZM9 A;  4M5N A;  2MHE A;  1R0A A;  2F8H A;  3VHQ A;  1VRQ C;  1N0U A;  2ROP A;  3A8K A;  2X1F A;  1RIS A;  2H1Y A;  3GP9 A;  1NJI T;  1IM4 A;  2XR9 A;  3HMJ G;  4ID5 A;  2R7Q A;  1N5Y A;  2W9C B;  3TVZ A;  1FRH A;  4C11 A;  4ZPT R;  4L76 A;  4JI3 F;  3BV8 A;  3SCJ E;  1D1U A;  3WAY A;  4OQJ A;  3CJQ A;  4C3L A;  1FKO A;  1LK5 A;  2C2E A;  2Y1L B;  2RE1 A;  3N4W A;  4DQR A;  3DYA A;  3CCE S;  3NGU A;  5LM7 E;  5DLG A;  3G6E S;  3PVX A;  4FYW B;  1SKS A;  1IBK F;  1B99 A;  2DIV A;  2ASY A;  3VGU A;  1B64 A;  2E5L F;  5L1L A;  5HP1 A;  4YR0 A;  4DSF A;  3TJ9 A;  3PFO A;  4MIW A;  4B56 A;  3DOL A;  1HWK A;  1REV A;  1F60 B;  2MY8 A;  4JI2 F;  2POK A;  5HLF A;  1JLC A;  4A8Y A;  5IQQ A;  4TYB A;  5DZ7 A;  2BAC A;  5EUH A;  3HXM A;  2K1R A;  2R2U A;  3D1O A;  2RQM A;  3SZY A;  5A8W B;  4OIX A;  3QJP A;  1SJQ A;  2J0X A;  3OVB A;  3R5J B;  1ACM B;  3LOU A;  3T5K A;  2UXB F;  2LFV A;  1YJN S;  2CPH A;  1O98 A;  5KT7 A;  1UKU A;  3MM8 A;  5RUB A;  2W5S A;  1XQI A;  1JXV A;  3NS7 B;  4WXW A;  1CS4 B;  2G9Y A;  1I51 B;  2RQK A;  2VJU A;  1RWN B;  3U02 A;  1FI4 A;  1XEZ A;  2YKM B;  1RJJ A;  2OSR A;  5J2N B;  2BKN A;  2BQU A;  4LFA F;  1FF2 A;  3T3F A;  5JVH Q;  2A6O A;  2E1A A;  2EK1 A;  2MQN A;  4M5L A;  3KXD A;  2F3J A;  4KGK A;  3SV3 A;  1FRK A;  2GA7 A;  1QAJ A;  3DRP A;  4FXW A;  4OYB A;  4MHX A;  1NM2 A;  4ZVF A;  5ETM A;  2JLE A;  4U7C A;  2VQR A;  3CD0 A;  2AEF A;  1R8H A;  4H4O B;  2VA2 A;  2NCK L;  3UWT A;  3RUB L;  4J7C A;  4YB6 A;  3TA0 A;  3CC7 S;  4DSK A;  5CHC B;  1WOR A;  1XMB A;  1VDH A;  2ZKT A;  1MN7 A;  2J6U A;  2ZJR Q;  1YI2 S;  4QYR A;  1WTB A;  5F8J A;  3HCX A;  3DOM B;  5HBM A;  1HNW J;  1RAF B;  1Q5V A;  4NEZ A;  1EET A;  5KFX A;  3VQS A;  2QLB B;  1URA A;  1S1X B;  3QT5 A;  3W60 A;  2DY9 A;  1RAC B;  2U2F A;  4CLU A;  2C3M A;  2O66 A;  3RAX A;  3R6G B;  1ZBT A;  4DR7 J;  3ET6 A;  1NZA A;  1W2I A;  2J7W A;  3J7A N;  1K0T A;  2LU1 A;  3MEE A;  3US5 A;  3Q83 A;  5IM0 B;  1JLF B;  3KK2 B;  3TZX A;  1CQM A;  2DEJ A;  4Q45 A;  3MHY A;  4LFA J;  4CO1 A;  4X4S A;  1F0X A;  2HFU A;  4ZPA A;  3W7B A;  3X3U A;  4YR3 A;  3KLF A;  2IRX A;  1PGZ A;  5KFO A;  1VCT A;  2WVF A;  3GYG A;  1QJH A;  4N7T A;  1IBC B;  1KQK A;  6FD1 A;  1WI6 A;  3K5O A;  4NLS A;  2K8G A;  2DXE A;  3X1L B;  3D1H A;  5L1J A;  2IM0 A;  2WB1 D;  5HAT A;  4EFA C;  4L3K A;  5CD4 H;  2MZT A;  3O1L A;  4UPH A;  3QID A;  4DUY F;  1QAX A;  2FHO B;  1Q82 T;  1FKO B;  1LQ9 A;  2CQ3 A;  3CO9 A;  2VHG A;  2YKA A;  1LWF B;  1NLK L;  9RUB A;  2OEK A;  1ALI A;  2CWK A;  2CPX A;  3K8V A;  5K8O A;  1KVJ A;  1G6B A;  3FRY A;  1RLD A;  3MD3 A;  3W3S A;  4WXO A;  2HHT A;  1HQA A;  4CXK A;  3CPW R;  5LIA A;  4NXM J;  2XMM A;  4M5J A;  3RG6 A;  2LQ8 A;  4IO1 A;  4DL0 C; 
#chains in the Genus database with same CATH homology
 1AJB A;  3UO0 A;  5INH A;  4UOR A;  1AJC A;  3TWZ A;  4LRB A;  1ELX A;  2GSU A;  2XR9 A;  1KHK A;  4LQY A;  4CXU A;  5DLV A;  1ALK A;  3UN5 A;  3UN3 A;  3T02 A;  3WAY A;  1N2L A;  2W5T A;  1EW9 A;  3NKP A;  1SHQ A;  3T00 A;  4FDI A;  4UOP A;  2IUC A;  5L0E A;  1KH7 A;  1EW8 A;  3NKQ A;  3WAV A;  3NKN A;  4FDJ A;  3E2D A;  2IUC B;  4CYS A;  4GTY A;  4UPI A;  4MIV A;  1ZED A;  5EGE A;  3OT9 A;  4B56 A;  4LR2 A;  4ZG7 A;  3KD8 A;  3WBH A;  4LR9 A;  1AUK A;  1B8J A;  2W5X A;  1AJD A;  4LR8 A;  3ED4 A;  1P49 A;  2GSO A;  1ED8 A;  3SZY A;  1E1Z P;  4NWX A;  5L0B A;  1KH9 A;  4KM4 A;  1ELY A;  1KHL A;  5IJS A;  1Y6V A;  4KAV A;  5DLT A;  4LRC A;  4LRF A;  1KHN A;  1O98 A;  2W5S A;  4GTW A;  4GTZ A;  2G9Y A;  3BDG B;  5EGH A;  3CMR A;  2IFY A;  3NVL A;  3NKM A;  1ALJ A;  4LRE A;  2XRG A;  5L0K A;  3A52 A;  2W8S A;  5TJ3 A;  1EJJ A;  1HDH A;  3BDG A;  1EW2 A;  4MHX A;  2QZU A;  1HJK A;  2VQR A;  4UPK A;  2W8D A;  2W5R A;  3DYC A;  1ZEF A;  4KAY A;  3IGY B;  3MK1 A;  1K7H A;  1KH5 A;  3TG0 A;  1KHJ A;  2GSN A;  1ZEB A;  1FSU A;  1ED9 A;  1ALH A;  5LRN A;  3M7V A;  3TX0 A;  5HRT A;  2ZKT A;  4KJD A;  4UOO A;  2ANH A;  5KXA A;  1ELZ A;  3LXQ A;  4LRD A;  5AJ9 A;  2W5V A;  3UN2 A;  3WAW A;  3WAX A;  1URA A;  2W5Q A;  4CXS A;  5GOV A;  4ZG6 A;  5DLW A;  4CYR A;  5C66 A;  1HQA A;  3DPC A;  3M8W A;  3MK0 A;  4UPL A;  1EI6 A;  1KH4 A;  1O99 A;  2D1G A;  5K4P A;  1E2S P;  3BDH A;  3SZZ A;  3M8Y A;  3IGZ B;  3Q3Q A;  5IJQ A;  4N7T A;  1AJA A;  1EQJ A;  3NKR A;  3B5Q A;  5LRM A;  3M8Z A;  4NWJ A;  1SHN A;  4TN0 A;  1E3C P;  3UNY A;  5LQQ A;  4ZGA A;  4LR7 A;  4MY4 A;  1E33 P;  4UPH A;  2RH6 A;  3NKO A;  4KJG A;  1ANJ A;  1URB A;  3IDD A;  2GLQ A;  2X98 A;  4QAX A;  4GTX A;  1ALI A;  3T01 A;  3MK2 A;  2GA3 A;  3BDF A;  4LRA A;  1N2K A;  4CXK A;  5GRR A;  2W5W A;  1ANI A;  5LIA A;  1Y7A A;  4YR1 A;  4ZG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...