4LRAA

Phosphopentomutase s154g variant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lraA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lraA01
5TJ3A 4N7TA 3TWZA 3UN5A 5L0KA 4UOPA 3NKMA 5LRMA 4LRAA 3E2DA 2D1GA 3TX0A 1P49A 1ELZA 1FSUA 4UORA 3WAVA 4UPIA 5L0EA 1EQJA 5DLVA 4NWXA 5GRRA 5L0BA 4KM4A 2RH6A 3NKNA 4NWJA 4MY4A 5IJSA 1O98A 1ANIA 2VQRA 3TG0A 2W8DA 1ELXA 3SZZA 5DLWA 4KJDA 3BDHA 5IJQA 2ANHA 1ALHA 2W8SA 1AJDA 1ZEBA 3WAWA 3IDDA 3M8YA 4UOOA 3M8WA 1HQAA 1AUKA 3NKRA 5KXAA 2ZKTA 3T00A 1ANJA 3A52A 4LQYA 4LR8A 1AJCA 2W5TA 4LREA 3UN2A 2W5SA 4KAVA 1E3CP 1AJBA 2XR9A 3IGYB 1KHJA 3MK0A 2GSNA 1URAA 1B8JA 4CXSA 1ALIA 1EI6A 4ZG9A 5LIAA 1AJAA 1Y7AA 3DYCA 4LR7A 5GOVA 3T02A 4CYRA 1ALKA 4UPHA 1HJKA 3UNYA 2GSUA 5INHA 3M7VA 4LRFA 4CYSA 4KJGA 1ALJA 1EW9A 1HDHA 4LRDA 1EW8A 4UPLA 4GTZA 1URBA 3BDFA 3NKOA 4MIVA 4ZG7A 3B5QA 4FDIA 4GTXA 3ED4A 3DPCA 5DLTA 1ED8A 2GSOA 4CXUA 1EJJA 3BDGA 4GTWA 3OT9A 1ELYA 4B56A 5LRNA 2W5WA 4LRBA 5K4PA 3NVLA 1KHNA 3KD8A 3WAYA 1KHKA 4CXKA 1E2SP 3UN3A 1E33P 3M8ZA 1N2LA 4LR2A 1ED9A 2W5VA 2IFYA 2X98A 3Q3QA 4FDJA 4MHXA 1KH7A 1SHQA 3WBHA 4LR9A 4ZG6A 2W5RA 2G9YA 1SHNA 1Y6VA 1KH5A 3MK2A 1KH9A 3T01A 2IUCA 5LQQA 1KHLA 5C66A 2XRGA 2GA3A 2W5XA 4KAYA 2W5QA 5HRTA 1N2KA 5EGHA 3CMRA 3SZYA 4GTYA 3MK1A 3NKQA 4LRCA 1KH4A 3BDGB 1O99A 4UPKA 4TN0A 1EW2A 3UO0A 1ZEDA 4YR1A 5AJ9A 3NKPA 3LXQA 3IGZB 1E1ZP 1ZEFA 4ZGAA 1K7HA 2GLQA 4QAXA 2IUCB 3WAXA 5EGEA 2QZUA
chains in the Genus database with same CATH superfamily
2GHPA 4YHHF 2UXCJ 2HFVA 3TAMB 1T9WA 1X60A 5T7LA 3NOCA 2C2OB 1RACB 3KLEB 4ECRA 4UOPA 4GVBA 1Y5LB 4TQRA 1WEZA 4LFAF 1KNZA 3M6VA 3TEGA 3VAGA 2HZAA 4KGMA 3PNIA 1EQJA 4PR6A 4RW4B 3BSAA 2XSJA 5KFYA 4AFFA 5ETQA 4F8RA 3NKNA 1FNOA 3CJ3A 1MNEA 2KZMA 3EZUA 2R9LA 4DL4A 2UUCF 2C3UA 1C1CB 3A4TA 2C2NA 1JLGA 2NZCA 4G1QA 2AD9A 3KUEA 2IYGA 2FJAB 1JLGB 3D0IE 3I55S 5KFZA 5DLFA 3NS7B 3OTEA 2QG9B 4KH0B 4CLZA 4W90B 3W5XA 3QQCD 3KG4A 2KRRA 7FDRA 2OPPB 1UEVA 1HMVB 4AQYJ 5J2NA 1N33F 4F4WA 3BR8A 1FDDA 3NGKA 1W26A 1JJ2R 2V50A 3M8QA 1U24A 5HL7Q 4X65J 4LR8A 4DR1J 1R8CA 2Q3PA 5KFEA 4DL6A 2C3MA 3NGTA 2P9GA 3GIIA 4KPYA 3D5MA 2GAHC 2W24A 1Q8IA 3NG8A 4JI4J 1RZMA 3OLBA 2VICA 3HI9A 3KJFB 4LIWA 4G6VB 3W2VB 4WFAQ 1P6TA 2LQ8A 2IM3A 2A3JA 4Y2IA 4C3KA 1J2VA 2KKHA 4CO3A 4E98A 5HN0A 1U0HA 4KC5A 4OHXA 3H7HB 4WK1A 4IH6A 5LIAA 5EX0A 3IBWA 4DSKA 3HK2A 2QTWA 5KAKA 1FDAA 2OLWA 1YQHA 2PA8D 4LVOP 2B3TB 1SKUB 3HFKA 3M7VA 5LMUF 3TARA 2O01C 3AODA 3RB6A 1N54B 4NCGB 5AJ3J 3IFEA 2VF3A 1T0TV 3DMJA 2F1FA 4MK7A 3DNCA 1AB8A 3WHIA 1KTQA 1S1TA 5DGAA 1F5AA 2ZZMA 1CJVB 2JEIA 3JXOA 1FKPB 2BA9A 5T7LB 5BYQA 5BR8F 2JLFA 4IH7A 1XTZA 2XGPA 3GILA 4ECZA 4B9SA 2R7OA 1F6TA 2YWGA 1QE1B 3TO8A 2DNOA 1UJ6A 2U1AA 4NXMJ 4LUBA 2OMOA 4WE1A 3NAIA 3VAFA 1BLUA 1KDNA 4ZP9A 4F7VA 2GMHA 3D28A 3MECB 1UEKA 1SQFA 2JC0A 2DIVA 3BF4A 2F7VA 2QX0A 3OBIA 4K50A 3EPGA 5C2GA 4U7UD 1U02A 4RNOA 2RSQA 1LWXA 3NRBA 1FRLA 3ETMA 2X3DA 2GVDB 2LQJA 4OJ3A 4F3OA 3KG1A 3W8GA 1UWAA 1MWYA 1S9FA 1KHLA 3RAXA 2XRGA 2W5XA 4NYOA 5IM0A 1HI8A 2LEPA 2VPWB 1I94F 1SKWA 3I9V9 2DRBA 2CQPA 1C0UB 3C6TA 3R1HA 3J7AN 2MZRA 1MMNA 5H9EJ 1Q86T 3TI0A 3D54A 3VVUA 3VVTA 1QUPA 2XTJP 4K5SA 3CJ2A 2H1YA 2XSJB 4CDIA 5GAEI 1FVQA 3TUZC 1HQUA 2I2YA 3VV2B 1S9EA 2K7KA 4B17A 4DN9A 5KFNA 4KR0B 2UUBJ 1CC8A 1R0AA 1FRIA 1LW2A 2PMWA 3R5GA 5K8NA 2VJUA 4B3TF 4IRDA 2G13A 3W3SA 3SDEA 1IQZA 1CQMA 1TU0B 3QGIA 2G0JA 2DB1A 3ENAA 4P75A 4DR5J 1PC5A 1N0UA 2D9OA 1F0XA 1Z4UA 1VBKA 2AP6A 3HHLD 1JXEA 2QYGA 3MMAA 3QO9B 1YVFA 3TJAA 3RG6A 2W8LA 1SH3A 2IC3A 5A0YA 1YX2A 3M32B 2DY1A 5ETKA 4ES2A 5JVHQ 3GPAA 1H7XA 3PEHA 1YJUA 4OZ1A 2RU3A 1H38A 4DN0A 3LP0A 2XHCA 3FKBA 1Q79A 3LPEA 4KO0B 1RTIA 2HHPA 2HFZA 2ROPA 2HFUA 3FQKA 4PEOA 4YB6A 4DV4J 2E29A 4IR1A 3R2DJ 4NWXA 2XYHB 2DGQA 3FNNA 3M8RA 3L7OA 2OPSB 5FIIA 2BJ9A 2R7QA 3MPWA 2HNZB 3D2WA 1LNQA 4CO2A 1NSKL 4IR9A 4C9DA 4P74A 1XIQA 4X4PA 4A46A 2KG1A 1TKXA 1FJ7A 4ZJQA 2C2EA 4C8LA 1HYSB 4MIAA 2R3VA 2DNGA 3SCLE 3UPFA 2ZBCA 3KLVA 3LPYA 2ANHA 1YKWA 4DPUA 1WTFA 2ZH9A 2AYGA 3HLUA 2HWHA 4OQJA 2UUAF 4A8FA 3R7NB 3KNGA 2AU0A 4UOOA 3G6YA 1HNXF 3OL8A 5MAOA 2NPIA 4RWWA 2W8KA 2FVSA 2V68A 1W2IA 1KLNA 2NXJA 4MAKA 1F1BB 4X4TA 3C19A 2YPYA 4UY8T 5CHCB 2O3DA 3T00A 4CT9A 4OYMA 1CJVA 1RYSA 3KOAA 2AYEA 2XB2D 5IT9Y 3W1YC 4ECVA 3R5BA 2R8IA 5LT5A 3MK0A 3CSKA 2B9WA 3ISZA 3ELHA 5F8LA 3EVWA 3PO4A 4CCHA 4CXSA 1B7YB 3UFCX 1LK5A 2CJXB 4ECXA 4OMFG 3KK2B 2IVMA 4NLVA 3EICA 4HT5A 3TAPA 1VQSA 5I3QA 1RT7A 3CD7A 4TNOA 1L3SA 2ZH6A 3BO4A 2XULA 2LDIA 4CYSA 4IOBA 2YX1A 4M5MA 2H4WB 2HBQB 3I5CA 3KJQB 2HS0A 1PYSB 5KFFA 4RW8B 3FZ2A 4H4MB 3I9ZA 2VH7A 4B3MJ 3KNAA 1OMSA 4HTIA 5C2CA 2PD1A 2DT9A 4ZPVR 3Q0AA 3DN9A 2FZGB 3QIPB 4RW7B 3VHQA 4Q5VA 1BY9A 4F0MA 1VQMS 1JJ4A 2B5JA 5KFXA 3OXGA 1SUQB 3CCQS 2C2RA 2IMWP 5KFGA 2QL9B 2FJEB 3ZZOA 2AGPA 1T3NA 4CH7A 3EDRB 1KHNA 3A8IA 1QAXA 3HX9A 4KIAA 1RISA 1Y3JA 2WW8A 2W4DA 3CD0A 1WHXA 2IAJA 5CXTA 2IAJB 3K0JA 3MD3A 3G87A 3R1LA 4OLPA 1BE4A 1MN7A 4LR9A 4WFXA 3UD4P 2J0QD 2U2FA 1OSCA 3SCKE 4NLQA 5DLGA 2DD8S 2PO4A 2WZ1A 1H6KX 1HWUA 3GV5B 4DV0J 5HRTA 3QLHA 4A8QA 1D0EA 3M8SA 3CMRA 1ZM4A 2DK2A 3N9UC 2LFVA 2B4VA 4IG0B 5KTQA 4A8SA 4JI3F 4LBIA 2BUNA 3KYLA 3BDGB 2I6WA 2DGVA 3T9NA 1N34J 4UPKA 1TK8A 1ROFA 2EBEA 4ILRA 2HG4A 3L9ZA 3RB3A 1GMWA 4NZ6A 2ALYB 1WC6A 2CVIA 4K2JA 5E3QA 5DM7Q 1Q82T 2DNYA 2DPJA 2FHMA 1CJUB 3CXCR 3CE8A 3JSMA 4W4MA 3C14B 3KLFA 5THWA 2IY5B 3PM9A 1R89A 2DR6A 4KJIA 3PW2A 4PG4A 3EGWB 3POTA 3GR1A 1YJ9S 1IXKA 2R4FA 3LO3A 5T14A 3QSYB 1OQ6A 2ZBIA 4I2PB 2D3O1 3G82B 3AHPA 3KXDA 1KFSA 1REGX 3QT8A 4NLDA 4P10A 3G82A 4WFBQ 4LFBJ 3FQLA 1EP4A 4KPCA 5I3UB 1RWOB 3N0VA 3EUNA 3KLHA 1IJEB 1HD0A 1KR4A 2DHHA 4DV6J 4A8YA 5DLVA 5L0BA 3MI7X 1MMLA 3QWUA 4ZP7A 1Q53A 5E3CA 1RT3B 1TL1A 5HBMB 2ZHAA 4AQYF 4FDFA 5KFQA 2D3OR 2B5JB 2ZJPQ 1UA1A 4WU3A 1VQ7S 1HNIA 2X7IA 1QJHA 2XS7A 2BANA 3QJPA 1IBMF 5A8KA 1T03B 3FBCA 4J9UE 4OX6A 1TKDA 3D7SB 1JJCB 2Y3YA 3DRSB 4R5PB 1TKTB 2OFGX 2FZKB 3A3OB 3DLEA 1QTMA 4ZP8A 4DQIA 1SCJB 4HTJA 1C1BB 5LXYA 2DRAA 3MXHP 4Q8FA 5DGBA 3ISND 4KB7A 2OSRA 4HH1A 4F4ZA 2Q1LA 3GMGA 3QRQA 2CPHA 2DIUA 3MR6A 1L3VA 4ZVUB 1BQNB 4MH8A 5H9FJ 3GU0A 4JI8F 4A8OA 1CULB 4IOCQ 2B9YA 5DRKA 2GIQA 3PEJA 2GJIA 1SJFA 1RTJB 4DV5J 1C0TB 1RTZA 2GJFA 2MLXA 1RT4B 4KRWA 4L74A 4X84A 4RNNA 1B3TA 2VG7A 2HNYB 5KFBA 3BKTA 1EKRA 2MZQA 3LP2A 3LGNA 3G71S 1ALIA 1OS5A 3NBPA 4ZG9A 3IG1A 1GT8A 3AJDA 5M2UA 2J6SA 2GO9A 4CYRA 1C4AA 1DQ9A 1T95A 4IRCA 1LXJA 1TMMA 4WTOB 1PC4A 1YZ6A 4DL5A 2ZZNA 4ZHRA 1T05B 2W7AA 2XMWA 1IWGA 4WF9Q 4EO8A 4GTZA 2MZSA 4O3NA 2JVRA 3DLKB 4KFBB 3IR7B 3SCIE 3QLHB 3CCJS 2FJWA 2RUSA 4FN5A 4PG5A 2CFXA 2VC0A 3NNAA 2GQCA 2MZ1A 3KLGB 1ED8A 1DHMA 1RBLA 1NNDA 3OT9A 4NASA 1QLNA 4M95A 2WB4A 2KDOA 5F8IA 5HROA 5I3UA 3DI6A 5K5MA 3CDBA 2JFDA 5EWEA 4DUTA 3T1YJ 4DSEA 2QA4S 2QV6A 2MPUA 3TX8A 2J8AA 2M52A 1FD8A 2ZC3A 1VQLS 1CS4B 3KK1A 4ZVRB 4AD6A 4OYXA 2W5RA 3F56A 2UVUA 1NJYA 4C4WA 1KH9A 2HIYA 3MMBB 1RA7A 4DR3F 3MTKA 1T03A 2MKSA 3CMES 2B56A 4EFAC 3T19A 1H3DA 1WC5A 2CA9A 5CH7B 1KHWA 5KT4A 1SH2A 4OHWA 4DWIA 3GIMA 4A8KA 2JZ5A 3OL7A 3DHXA 2VKZG 4GO7X 2GVZA 3VAMA 5K14A 3KK3B 1PBAA 1YZ7A 3CJSA 1M1KT 1UVIA 2NUUG 4LFBF 1S0MA 2J9CA 5F0WA 2R2TA 4TN0A 2UU9F 3D1OA 4CT8A 1RAEB 3ILOA 1DLOB 2CADA 3Q22A 2KL8A 2HGLA 3OFEA 4TYAA 4Y3CA 1AYEA 3I31A 3H2UB 5GVQA 4NZ0A 2YKOA 4DMZA 4JV2A 3TUJC 4RNFA 5AE2A 3CD6S 1E1ZP 4MTPA 3HKWA 3QJJA 4HHJA 2OI2A 1SL2A 3BGUA 2IUCB 2GQQA 2ASYA 4MKAA 3AD9C 1TL7A 2D69A 1RT5A 2UZAA 2D41A 3ISNC 1NDKA 3CDUA 3BYPA 4A8MP 1C4CA 1TFYA 3NNCA 2Y0SD 3CEDA 3UVJB 1KEKA 5DQGA 2EWHA 3K5PA 2R7UA 2PFDA 2KRBA 2DNZA 2P8IA 2BE2B 2OPRA 3VF0B 3WBZA 1AZSA 5KFMA 1HHTP 2VPXB 1MW7A 1QVGR 2MKHA 4UPIA 1S6PA 2B0GA 2O5DA 5E2QA 1FNMA 5F9NA 4KM4A 1DARA 1RTJA 3VTIA 1O98A 2BJ8A 2XWYA 3LP1B 1Q16B 3Q8PB 3EGZA 4K4ZA 2EEYA 3BH6B 2N7YA 4O44B 3RUBL 4RUCA 4R8UB 2C2DA 3OPKA 3A8JA 4ZPTR 4ED8A 3TAMA 3PX4A 4C2MA 1ZEBA 2QRRA 4TN2A 2MY8A 4G1PA 1GMVA 2VQEJ 4BS2A 1PKUA 5IFMA 4FF2A 1RWNB 4FF4A 2FB0A 5KXAA 3L95X 1PILA 1IKXA 3QYYA 5B0CA 2BQUA 4XPCA 1RT2A 1ZPWX 4PXDA 3G6VA 1XC9A 3IR6B 2CJ9A 4ZCKA 2HVIA 1MLAA 2CNOB 2EVZA 4M5DB 3UN2A 3HVAA 1X0FA 1S48A 2M2BA 2BM1A 3CCWA 3ZTRA 3GWCA 2XNQA 3OLAA 2KM8C 3RR8A 1YJWS 1IKVB 2EFPA 1WC1A 1FVSA 4B3MF 2F3JA 4M5JA 1NK6A 1AJAA 3QPIA 2G1DA 1ZBTA 4NEZA 4NLWA 1YGYA 4LR7A 4TYBA 2AX0A 5AXKA 5KFOA 4K2XA 4X66J 3Q23A 3IS9A 3PIOQ 3D1QA 1XR6A 3D3CJ 1FI4A 4QOTA 5KFPA 4KE5A 3N6MA 2I5JB 2VJVA 2VU5A 3BR9A 3KDOA 3MMBA 2HMIA 4LF4F 4WYWA 4TY8B 1RTIB 4UPLA 2FLPA 2CNNB 2HHXA 2IDLA 1VOMA 4BCAA 1F9FA 2MDAA 3MHYA 5GADI 4DV1J 1FKPA 2W25A 3OR2B 3EZ5A 3BGRA 2OP5A 4NXMF 3LW5C 4V19J 5ETPA 2ZZTA 1IBMJ 2E1CA 1QTNB 1X4BA 4YB7A 1A0OB 3SQOP 5F8GA 1CQNA 2ZH2A 1X9WA 1SXLA 1MU2A 2LYVA 3CD5A 4ZMMA 4ED6A 4ZPWR 3HJFA 3NKYA 2AYMA 2DCLA 2EFQA 2LCWA 1E33P 3R3TA 1Q5YA 1K0TA 4ITSA 1RE1B 3MM9A 3CCLS 2OMLA 2AHOB 2IA0A 1E6YA 3LP1A 4FPIA 1U1KA 1VQ8S 1KH7A 2IYIA 4U7UK 1VHFA 2CPDA 3PKYA 5DDRC 4FNHA 1TUGB 4I6WA 5D8HB 1S1WB 3DXBA 2ZVSA 5DQIA 3C6TB 2BEFA 2Q6BA 4GVBB 4DV5F 3MF5A 5DZ7A 2KFZA 3MMCB 3P5BP 1D3WA 1KSPA 2Q79A 5A8WB 1EQ0A 1YTYA 4HI2A 2D3ZA 3MEDB 1WHYA 5J2NB 4ZVHA 3NKQA 4AYBD 1QVFR 4QU7A 2YWHA 4Q44A 3CCSS 4UQTA 4ZITA 2G4BA 2WB1D 5KFRA 2XY7A 2RRAA 4LFCF 1MN9A 1U48A 2XWXA 1DTTA 2QA4G 4NPOA 1VYAA 2IMOA 3EDQB 3PZPA 2CIMA 4EMDA 1VBXA 5ETRA 5IC4B 1RAIB 5I42A 5A76A 4H4MA 1W2BR 4NLXA 3N01A 3PV8A 5L8RC 3IWLA 3FUYA 3HHNB 3ZZRA 4DV0F 3QIPA 4OV1A 2JJ4D 4RW7A 3ZTQA 4C3LA 2RQCA 4B3SJ 3ILLA 2GO8A 4L75A 2H54B 5G0RB 2VG5A 3WC0A 1NH7A 4Z2XA 4CLUA 3FFIB 3LWLA 3TX0A 1B0TA 1K1SA 3GG1A 4C97A 2AYBA 5KFSA 3TEHB 1HBUA 5KG7A 5HP1A 5D0EA 5HVFA 2ZH3A 1FTRA 1ZA2B 5K9FA 3D67A 4NI2A 5A8RA 1WJ9A 2OD4A 3VAKA 3BPDA 4MY4A 1BUXA 1FEEA 1VRUB 2UUWA 2FGCA 2K1RB 3NCQA 1YRXA 3MGJA 3UWTA 1M5HA 1V9OA 4DR6J 2YKAA 4FP9A 5IXUA 4K4UA 2ZH5A 3FCWA 4PRFA 2MSSA 4FXVA 1LKZA 2YBVA 1NSAA 2AX1A 3QO9A 4FYWB 4ZPDA 4BWJA 2M9KA 2ABYA 3ZTOA 3DLGA 4DDFA 3V6DA 3JS9A 3MR7A 1HBNB 4PWWA 3W7BA 3W64A 4NCGA 2QIFA 2RRNA 1EQMA 2DH8A 2G0IA 5BXIA 5L1KA 3V4IB 3RRGA 2UV8G 3LP0B 3OFGA 4KO0A 4NYPA 3PFEA 3CMQA 3TYTA 1UCNA 1E6VA 4UOFA 4CNZA 3SBMA 3TRGA 4Q2MA 3KHGA 4MIBA 1J5EJ 5CYJA 4DV6F 1HI0P 4URGA 4EGLA 1S76D 4B3OA 2BE9B 2FJDB 2HQFA 2UV8A 2JL9A 2FLOA 3BGLA 3MEEB 2XNRA 3Q2SC 1FKAF 2C3PA 3JSMB 2NXUA 1WOSA 4DR4J 2IRUA 1HYSA 1TV6B 1KWMA 2RRBA 2L08A 1RT1A 4WWSA 1U7LA 2V8HA 4KYZA 3TQEA 3HSZA 5AE3A 3KJVA 1O8BA 1MWQA 3R8YA 2ZHBA 1NKEA 2GHWA 2FVQA 4FNIA 4OYOA 3GG0A 5J1EB 3CCUS 3N5BA 2H9ZA 2XMVA 3EZOA 4KV8B 4OV6A 4WP8A 3OSNA 4TXSA 2JOQA 2DITA 3C6UA 1N88A 4KV8A 3SFUA 4ECUA 4MYUA 3L09A 4QYRA 1R43A 5D4OA 3C15A 1IWAA 1N6QA 1R8PA 5GMKa 3CDAA 2GGPB 2Z2YB 3UQSA 3BDFA 2CRLA 2VODA 4OL8A 4DU8A 3MMCA 2W9BA 2X1GA 4I2QB 2V94A 1RADB 4USIA 4J9OA 2HKEA 1ZM2A 2IRXA 5F8HA 4J9KA 1ZTTA 2GSOA 3CTRA 4WIQA 1EJ7L 4WFZA 1S5ZA 1X8DA 2OPQA 2EG1A 3C66A 2KT3A 3QNWB 1PBUA 1HBUB 2HAFA 5HP1B 4V19X 2UU9J 2JEJA 3FMWA 2HRUA 2FJBB 2IFYA 1RT6B 1SQGA 4OYIA 3M8PB 4DU7A 4XO0A 3LANA 4NEYA 5KFAA 2VBZA 5HJYA 1GXUA 2Y1RI 3HSGA 4RW8A 2CJKA 2QFIA 2J7WA 1MWZA 2AZ3A 2C2ZB 3A13A 3RRKA 4YR3A 1SHNA 2HPUA 2K3IA 3R5JB 1Y6VA 3T01A 3AD8C 1FEHA 1NU4A 1TK5A 4HDGA 4D3GA 1KN6A 2N3OA 1GK8A 4Y0FA 2Z8QA 1NO8A 1S6UA 4LF2A 4USHA 1U2CA 5HMWA 4LRCA 1XNRJ 2EG2A 5HLFA 1HNWF 4NI2B 5A8RB 4X66F 1RHMB 4DUYJ 4RBUA 2WSFC 3M30B 4PYDA 6AT1B 5A6WA 4F0KA 4QIGA 5B0GA 3H0PA 3V5RA 2W2NP 3MEGA 1GX6A 3OXLA 2CPXA 4ID5B 1HR0J 2R8KA 4OX9J 1XJWB 2P5VA 2M88A 5EX3A 4HH0A 4TKTA 2BX6A 4I64A 2GNKA 1WD6A 4FZVA 5LMNF 4J91A 1R27B 3W2WA 4MFBB 1G1XA 4WKRA 2DJWA 4EYHB 4NLSA 4USMA 4MFBA 2BE7D 1PJ5A 1TTHB 2CWXA 2H5JB 3H4BA 3TWZA 1NK7A 3WDOA 3HPOA 1YJRA 1FRXA 4IG0A 4ZVFA 1KTVA 1UJ5A 5GAGU 2MMYA 2WVCA 3PY8A 4RPFA 4JI0F 2ZNYA 2O67A 1ELZA 2PN6A 1FNXH 1ZAXA 1DAXA 1VDHA 3DI6B 4NX9A 1VC5A 2VD3A 1APSA 4NCAA 1RT3A 1TL1B 1BD6A 1KVKA 1K73T 2DXEA 2HHVA 1N5TA 3J7ZT 2W01A 1RWPB 3W9JA 2VQRA 3OTCA 1D8ZA 1WF1A 3TA2A 3OVSA 1L3KA 4ANEA 3M2RB 5CAAA 4ZP6A 3MR5A 3OW2R 3SYZA 4XAKA 4KGZB 2GV1A 5A8KB 1WDDA 5IT4A 3J7Z5 4I56A 3W61A 3TANA 3R5CA 2R8JA 3GJQB 4GVLA 3G6ES 1GFWB 2ZBQA 3CCES 3TZWA 3POTB 4LVNP 4FBTA 1WF0A 4UZCA 3UW1A 1XR5A 1VIXA 3DRSA 2FD2A 3CUNA 4YQWA 5KFDA 1RT7B 3M8WA 4QWCA 1RT6A 2QA2A 3KUHA 5ITHA 1TFWA 1HQAA 3GCWP 5KT7A 5K14B 3KK3A 3T5KA 4QR2A 1EP4B 2ACMA 4AL7A 3CC7S 3FMBA 3CB4A 1RAFB 2WVDA 3X3UA 2V5HG 4OLOA 2B51A 4PZVA 2GIRA 3EPIA 1XMQJ 4LREA 4KGXB 3CJKA 3ET6A 1RKIA 5JUMA 2B4PA 1RT4A 4DX6A 1URAA 3SZZA 2YKNA 1SI9A 4ZLJA 4CTAB 4LF5F 2R2SA 2MQLA 2CZVC 3IG1B 1I6JA 2KYZA 1NDPA 2RJZA 2R8GA 3QZ7A 1M0SA 4DR7F 1R8BA 1XMBA 4Z7CA 1DZ5A 1CSJA 1GTHA 3P8BB 2VG6A 4CO4A 3MFHA 2CQ3A 2JWNA 1JLEB 3D0HE 3THVA 4F2SA 3DOMA 5KG3A 1YBAA 3TA0A 4ZHRB 1VQOS 1WHVA 1S4FA 1VLOA 3WIUA 1N8RT 2HWIA 3TZYA 1HW9A 4IKAA 2F8MA 1NJXA 3NKOA 4KGVB 4QR1A 4KBIA 1JXLA 3PYDA 4ZPBA 4DPWA 4CLTA 3BDPA 1NBEB 1R6YA 4LF7J 3MPYA 3ZZTA 2MYFA 3HKZD 1T8EA 4QZVB 1SL0A 4F4KA 3T3FA 3MZIA 3SCJE 5EWFA 2CQ2A 3PW4A 4Q2LA 3LOUA 3Q24A 1RA6A 3V2UC 4GC6A 3FCVA 5HLFB 4KY3A 5EHHA 4RW6A 4DX7A 1TP7A 2HZCA 4I6YA 4O3QA 5ETVA 4O3RA 4X62J 4PUOB 3I96A 2W5VA 2X98A 2OPPA 3OHAA 3AT1B 3GFHA 3AY0A 1S1UB 3BM7A 4DL2A 2CQGA 2L9WA 1S7HA 2DXDA 2RAQA 4IFYB 3J81U 1S1UA 1E2SP 1FWLA 1KH5A 4F02A 2FGOA 3KHLA 4N8OA 4KT0C 4ZN1A 1T7PA 3CCZA 2IFXA 3HHLC 2A10A 3FSIA 1S97A 4EBCA 2ZH8A 4RJVA 2UVRA 3FK4A 1RTDA 3QFHA 4D3HA 5HI7A 1VC0A 3H42A 1VK3A 4ZJLA 1FA0A 3HM9A 4P2SA 1AFJA 3UR0A 4OZNA 4C11B 4DFJA 2IM2A 3GCXP 3NCPA 4N56A 3T5LA 4EZ9A 1JQGA 2DR9A 5AJ9A 3E01A 1RHJB 1FE0A 5FDLB 1RK8A 4JI8J 3PW7A 1NMEB 1PG5B 4RBTA 3PW5A 1X31C 2N7CA 4L3KA 1QM9A 2CQDA 2RVJA 3NOGA 1TZ0A 2ASLA 2HQIA 2HQGA 2X1BA 3M05A 3QT6A 2ZE2A 2BRKA 5EWGA 2VG7B 3WAXA 1TMJA 4CYUA 5D4PA 2ERRA 4USVA 2DGXA 4ED5A 3A8EA 2UUCJ 3JB9k 2NR0A 1VQYA 1R8HA 3HVWA 4MKVA 2XC9A 3OUYB 3QGGA 1NK8A 1HNVA 2FJXA 5ETOA 1VQNS 2D1GA 1LFWA 1OPIA 1HNVB 1WUUA 1VK8A 4CNYA 2BR0A 3IGVA 2E7WA 4NLTA 2CDRB 1TUWA 3T1HJ 4FKXA 1S6PB 4A8WA 4UTGA 2JFKA 3IAS9 1WORA 2MHNA 1G3OA 2VFVA 4RW9A 2F65A 2RD5C 4QYZJ 5GMDA 4U9RA 3MURP 1VBYA 3NBPB 1G6BA 3US5A 2CWKA 2W8DA 5IT0A 1NB7A 2CZ4A 2HNYA 1ICEB 4O4GB 4N5SA 4OZLA 5IM0B 2H48B 3I82A 1UFKA 1JLCB 4OJ1A 5J2QB 3LA0A 2FQQB 1H73A 1RU1A 1VFJA 3M8YA 4A48A 1IM4A 3IBFB 1Y3KA 2GAGC 2AV5A 3KHRA 1I1GA 1NH8A 3CCRS 3DU6A 3GLJA 3MCMA 1HNZJ 2CQ0A 2YKMB 5SZTA 1Y11A 1VRTB 2XI2A 5JMNA 1XNQJ 1ANJA 5DO2A 2HQCA 3PRDA 3J81j 1G7CB 3BREA 3HULA 4P72A 4JP8A 1T3OA 2NCKL 1E3CP 3I87A 4QW8A 3G8QA 3IN5A 1SC4B 2KG0A 3F44A 2QLJB 3OJSA 1U47A 2LXUA 3V81A 4R8UA 3GIRA 4CM0A 3OFHA 4ICLA 2FY1A 3SSSA 1V3ZA 5KT3A 1NZAA 3C16B 4JOUA 8AT1B 2OKQA 4F2RA 4AL5A 5BR8J 2KB2A 2NSBA 4P7TA 4YY3J 2HW3A 1H72C 1VQ4S 2KJWA 4O3SA 2F4VJ 4NLOA 3E01B 5FDLA 1LQ9A 4OYAA 1UVLA 5ETLA 5IOLA 3DRPA 4EYIB 2IJRA 2FIUA 2ZBPA 4QWAA 3QRRA 1VJQA 3H2VE 3O3LA 1VISA 2DH7A 3M8QB 4GC7A 4PWDA 1B7FA 4M94A 4M5DA 2XLIA 1VQ6S 4PAAA 3HFZB 2OHDA 3IBCB 1NK4A 1VRUA 2VFUA 4RNMA 2RKIA 1FE4A 1IKVA 2LU2A 1RI7A 2ATCB 3BEGB 4ID8A 1X4HA 4U96A 4BC9A 4JYAJ 2PT0A 4DV2F 5JJBA 4NMXA 3RAQA 2ATLA 4GTWA 3CJ5A 2W5WA 1QE1A 1BMQB 3CC2S 1HNWJ 1AZSB 2W9AA 2ZH7A 2Q6CA 2E7XA 3AQPA 4KSEB 4DUYF 2WOMB 1JMTA 1HQ2A 2DEJA 4J9NA 3T1YF 5CYMB 4DR7J 1SJ4P 4LSLA 3Q3QA 3MMJA 1WC3A 2OEJA 3H25A 4O4RA 5HVGA 3J7YI 4CO5A 1SHQA 4P2XA 3DMJB 2XY5A 1AROP 2AJ0A 1TL7B 1X5PA 3KWMA 3RAMA 3TNVA 1S79A 4AL6A 1M90T 2YKQA 3LGMA 4NXNJ 2IUCA 9ATCB 3D6FB 4O4GA 5AXNA 2WTFA 2R7SA 4UOCA 3M2UA 3ULHA 2CQHA 2MQPA 4K4XA 2Y1JA 4YB5A 1OO0B 1DTQB 1U8SA 2H5IB 4ZG6A 3AQOA 3UVJA 3H4DA 1FCAA 5LSRA 4OZ0A 2IA6A 3THTA 1MU2B 5DLWA 2E1AA 2MLYA 1O0PA 5F3ZA 3U27A 3GYNA 4LSNA 2CZ9A 4ZVSB 3SV4A 4IUFA 3MM8A 2YNFB 3JQMA 4EZ6A 4F26A 4RW4A 1EHWA 2R7WA 3UD3P 5HANA 2ZHOA 2YQ3A 1NLKL 1M5PC 4LF8J 2BJ1A 2E5GA 5KOXA 3O44A 4ZVPB 3EYZA 1ZM9A 2HWTA 1DTTB 1PAUB 1T9UA 2PA3A 3OTDA 1X4EA 5CA5A 4QW9A 2DVIA 3DDIA 3C2PA 2ZOMA 1D8YA 4ED1A 2MTLA 1JLCA 3Q8RB 3DGPA 1SKSA 1SC1B 3MUTP 1YLXA 2C2KB 1J27A 1RABB 1TKZB 2B7CB 4U6PA 4DF4A 2XMUA 3PYFA 3AOBA 4YMEA 2EK1A 4AT1B 5A8WA 3G96A 2COLA 4WTYA 1IKXB 2K2PA 4Y34A 1T11A 2HFOA 3BB5A 4ZA1A 1B70B 5HMZA 2MJNA 3OR1B 2IIHA 2HEKA 1Q7YT 4ED7A 4QQBA 4KKOA 1KQSR 2EFOA 2CPYA 1X7VA 1HR0F 3QGPA 2XEXA 4IQXA 1OSDA 3FGVA 2P9CA 4HL9A 2OSQA 3U1LA 4B3RJ 2EKYA 2V67A 4E2FB 3BBFA 2QE5A 4F3MA 3H20A 2RT3A 1TL3B 4TU9A 1EAYC 1V5VA 4ZPCA 4F36A 2ALZA 3TW0A 2KTQA 5RUBA 1MROA 5CD4A 1CEZA 3DLHA 1UETA 3BDHA 1HBNA 1OYDA 2DGTA 2JH3A 1NK0A 2MKKA 4P6QA 3T6BA 3D4JA 5DJBA 1CBKA 2LECA 1LK7A 2NLWA 1KKHA 1S99A 4DFKA 1VR6A 4R25A 1ULRA 2PGCA 2HBRB 1RAHB 1S1TB 2YQ0A 2CKWA 3DDNA 1OYEA 4C0OC 1FRKA 2WSEC 5A2QU 4OI2A 4YFUA 2K8GA 2QZ8A 4F3QA 2WSCC 3ZXWA 2M3DA 3HJVA 3QT5A 4DX5A 2KYXA 2XMTA 1O51A 1WHWA 3OHBA 1N36F 3TJ9A 5E41A 2KFYA 4WZQA 2J9DE 4FYYB 4ED4A 2HHTA 3AA9A 1AXQA 3B4DA 3HD1A 4C8NA 3W2WB 1WI6A 3KJNB 2UXDJ 1Y7AA 1TKXB 5DDOC 5CYMA 1KONA 1VIOA 2LQBA 4YUDA 5D78A 2ADCA 3SQGA 2VBXA 2AF6A 3CJ8A 4DI6A 4F4AA 1X4FA 3G2XA 1Q8BA 1U1PA 3ZFVA 1YK9A 3QMQA 3MAQA 2P9EA 4DV1F 2DEIA 2DHXA 2N82B 1PIEA 4QJVA 1YI2S 3PJ9A 3R6GB 1C0UA 4WJBA 3ED4A 2QT7A 2XHWA 3OV7A 2DO4A 1YBUA 3NLCA 3VZHA 2IRYA 4I1TA 4CXUA 1J5OB 1J5OA 2LQ9A 4LSNB 3MEDA 5IWAF 5KFUA 1V3RA 1IR2A 2DKOB 3NVLA 1UW4A 1LWCA 4BHQA 1JB0C 2DXFA 4R5PA 4RO0A 4J90A 2BW7A 1HBMA 4X4SA 3GV8B 4FYDA 5A2QY 1LW2B 2AEJA 2EFNA 4HT7A 1PJ6A 1Q5VA 4RLEA 5E0OA 3HP6A 1QAJA 1JWWA 3GE9A 1GQEA 2VFTA 3HT3A 5CZXA 2G9YA 1FO1A 1RUSA 1VMBA 2GJ2A 4C6AA 1QAIA 2RF2B 4CI0B 5EDWA 2BXJA 1U26A 3IM8A 1QUVA 2W5QA 3FBFA 2OO4A 4YN3B 1N2KA 2E7VA 2YH1A 3UCUP 4MK8A 5IV4A 2HVDA 1FRHA 2YWEA 3CCTA 2ZVIA 3K8WA 3ONQA 5C25B 7FD1A 1N5YA 2DR7A 2J6UA 3CIZA 4LF6F 2OTJS 5C25A 2CPFA 2VG6B 3X1LB 3R5DA 3F41A 3QIDA 1HBOB 1K44A 2EFGA 3THPA 2BKOA 2UUTA 1AUDA 3I6PA 1JKHA 3JYTB 3WZ0A 1SKRA 4O23A 4ZJOA 3PACA 4CRJA 5DQHA 4QWEA 3GFXA 3H5SA 4JI4F 3M6UA 1TV6A 2CNLB 4UORA 5EGEA 3NGSA 2QLWA 3B8HA 1HQEA 2RU9A 4NZ7A 1FX2A 1HWJA 5LJ5Y 3KHHA 4FXDA 3SQGB 1HARA 5HATA 5DG9A 2JDJA 2I38A 3MM5B 3KLGA 2EC2A 5KFLA 5D0RA 5B0BA 1D09B 1E6VB 1KBRA 2PMZD 4R0EA 5D0HA 3BSNA 3DLLQ 3VAHA 4WXWA 5E7OB 2BQRA 3J7YU 3TUPA 3OFFA 5J2MA 3PTWA 3H5XA 1SC6A 4C0BA 4JV5J 2C42A 3W65A 2JLEA 4HEA9 5B7WA 2MGZB 2KVIA 3J7A1 4OYBA 1BWEA 3FJ2A 1CJKB 1WG5A 4PWUA 3LH2S 4JV0A 3MR3A 3TG0A 5IQ6A 1QD1A 4MYTA 1XMQF 1RT1B 2E5IA 1R6VA 1X4CA 3M2RA 1ELXA 3GSDA 4DFMA 2YVSA 4IQMA 3R7BB 4ER8A 4FVCA 3BDGA 4LF1A 1S6QB 2CXEA 3G8TA 1SBRA 3H5UA 5GAEU 3A12A 1XBWA 2JEGA 2QL7B 3C6UB 3ZO7A 3EWGA 3FBEA 5B0DA 4B9MA 4QCLA 2HVHA 3M8PA 4QIEA 4HACA 3AXMA 1TR0A 4LBPA 3U1NA 2CNKB 4I2PA 1UTAA 5CZVA 3CF5Q 1JLQA 1Y5IB 1M5OC 2WONB 2HHWA 1RCXB 3RYLA 4OI1A 2F9DA 3DOKA 3TVZA 2VIHA 1N33J 1YJVA 2LXIA 4USJC 1U1NA 2IHR1 4N8NA 5HBMA 1ZZFA 3IXQA 1YJ7A 5F3TA 4M5GA 4EO6A 4KAVA 3MAHA 2HHSA 1U1LA 3BSOA 2E66A 3OTOJ 2BQ3A 3EGVA 2UP1A 4ZLPA 3FC9A 1T9XA 4CO0A 4YHHJ 2DNHA 3LAKA 1OJ4A 2HVZA 4CLWA 1N5QA 1RBAA 5ADZA 1NAQA 4B3SF 2J76E 2VV5A 1G4CA 3MCOA 2GSUA 1RWVB 2BDPA 5M2PA 4N77A 5INHA 4O3OA 3OQ2A 5DM6Q 4EBEA 2FTRA 1HHQA 1TKTA 2YNHB 3I0RA 2LA6A 1YSJA 1Y00A 3UR3C 2YNHA 4X64F 3P3DA 4QWBA 1JLAA 3CJTA 1NPKA 1WEXA 4M1KA 2EKNA 1BQNA 2NYHA 4CLLA 3ENVA 1CC7A 3KMSA 4LMZA 1H2VZ 4NA3A 4ZG7A 3TA1A 4EBDA 5J2PA 1P1TA 4DSJA 3K2YA 4DR5F 2WBRA 1IKWB 3ZTPA 4JI2J 3QRPA 3BSCA 1UZHA 4ANCA 1YRTA 3DM2B 2B6AA 4DG1A 4WP9A 3K59A 3RBDA 2R7VA 1C0TA 4J5OA 3M30A 4B02A 4DR2F 2KZZA 1SJQA 4ZVGA 1NPPA 4FYXB 2W1BA 3W62A 5F8MA 4RR5A 1B0VA 3CIMA 4PG7A 3NAHA 3UN3A 2AW0A 2DGSA 2ZOGA 1N2LA 3I5AA 4KAIA 4ID5A 2QL5B 3IRXB 3L4BC 3WX4A 4PQUB 4MHXA 2FHKA 3CWJA 5JXSA 5HQMA 2Y0BB 3BN4A 3FSXA 4P7VA 4DR1F 3IGYB 1Q0NA 1HQEB 1UFWA 2ZBRA 3AOAA 1I94J 2NXNA 3PJWA 4LF8F 2WAQD 1LWEB 2DNPA 2OFHX 4YDDB 4KAYA 1WOPA 3P96A 3V6KA 3PX6A 5B08A 1TL5A 2LU1A 4RUAA 4OIXA 2Z2MA 3H8YA 3N5FA 3V81B 1S7IA 5CCLA 2EW9A 2RDJA 1Q81T 4C11A 3UNGC 1N32F 3B4MA 4DXLA 3B82A 2IDEA 4Z7YA 1I5OB 5KT5A 4J9QA 1SJ3P 3DFEA 3QATA 3H40A 3DOKB 3BKFA 2CDQA 3M1VA 4FXWA 4J9VA 1VQKS 3WC2A 3Q2TC 3O5TB 2J9DA 3IGZB 3PG9A 2CUYA 1KOOA 3T5HA 4DSFA 5D15A 4Q0BB 5IT9U 1K7HA 2GLQA 4PPDA 2MHEA 1P9YA 1S6QA 3R5AA 3DLEB 1PJ7A 3KDNA 3MPUB 4PPZA 2H5EA 5LJ3Y 3K5MA 3UCZP 1Y10A 3PDNA 3IC1A 4UT4A 1RTDB 3C46A 1FTCA 4ECWA 2J0WA 5L9NA 3NKMA 2QLXA 2BW2A 2PEBA 1YJTA 2EC0A 2A1BA 3B5QA 3UDVA 4A4JA 1HPZA 2WOMA 3E3XA 3JSYA 1DLOA 3F73A 3PR4A 4W98A 1X9MA 3M6XA 4JI1J 2DR8A 1CULA 4IO9Q 3LF0A 3CJKB 3B6BA 5GMEA 4RZRA 2AIRB 2G0CA 2RIJA 4F0HA 3OTOF 5EN1A 1NHVA 4OHZA 3KKFA 2K3KA 1S72S 1P8GA 2FY8A 3S01A 1U45A 1XN9A 4B9TA 1RHQB 3GIJA 3CCMS 1X5SA 2FHJD 1ALHA 2DO0A 2WBMA 3I0RB 3D6MB 1U6FA 3DRXA 5HSPA 4WYLA 3ZZUA 2PMHA 1AUKA 3TQ1A 3PJXA 3GR0A 2LQ5A 2FVCA 3MWBA 5ETNA 2XZDB 1ZAVA 2ROGA 5J2PB 4LQYA 2XS5A 3DLJA 3T9ZA 4I69A 4O0IA 3DOLB 2JVOA 3E8OA 4KTQA 3N6LA 4EI2A 2POKA 2B6AB 2MZTA 4V1Ak 3T5JA 3DLBA 2PE8A 3NP5A 1X5TA 2V69A 2WRMA 3DRRB 1Q1KA 1P9QC 3CJRA 2OJ3A 2FC8A 4O44A 1N48A 4I6AA 4B9LA 4IO1A 4P52A 4UUWA 4M63A 2YX7A 3OXFA 2QSFA 2R42A 3BGOP 3UDEA 4TU7A 2QMUB 1VQ5S 4XTTA 2HZVA 1ZZNA 3WAYA 2YTCA 4RWXA 2KXFA 3GONA 4DV4F 2V0NA 3UCGA 2VPZB 1CJTA 2A6MA 4ZIVA 4K4TA 1Z2LA 4OX7A 1VRTA 4J9RA 4JI5J 6FD1A 2DNKA 2E1MC 1LW0B 4ERDA 2HNDB 4UW2A 3P49B 1LW0A 2CJAA 3NMRA 2AT1B 2D9PA 2BVZA 3IP0A 3NGDA 2WCXA 1N36J 4ILLA 5DDQC 2K1RA 2V4JA 3QGHA 3O2IA 2M4MA 4L3NA 3R9LA 2B9XA 2VOOA 3KTQA 2ROEA 4A47A 1FFSB 3IR5B 4MMOA 2UXDF 2F63A 4IG3A 2GX8A 2A0FB 4ALZA 2HYIB 4AXIA 2ILZA 3DLGB 4WKYA 3VALA 4ED3A 1EETA 1KQGB 1RWWB 4B08A 4LSLB 1RLCL 4F25A 2RHQB 2FVPA 2W8SA 1TVRB 2QC3A 4QR0A 4Y2AA 1AT1B 3HZGA 4K59A 2HHHJ 2EFVA 1Q95G 2F8HA 3B78A 4ZOSA 5IQQA 1UWBA 4OYPA 4UUXA 2R7TA 3JAMY 1UWBB 1VRQC 4JBCA 4ED0A 2AGQA 2ZNZA 2I9SA 2LDYA 5LQQA 5C66A 3GJRB 3PKMA 3BGRB 3CJ0A 3ITHA 4DR2J 2XS2A 2RKIB 3M2UB 2GA3A 3BBCA 3NGRA 4NLPA 4CO1A 4ZS6A 1YIJS 5EGHA 4OJHA 1URRA 1JLFA 1NB2A 3Q83A 1ZPVA 3A3PB 4H4OB 3VCDA 4DV3F 4WE1B 1FJCA 3MM8B 1W7WA 4DL0C 2XZTB 2RQMA 1UZDA 3GIKA 3C8YA 2XCAA 3SZ2A 2ZUAA 4ZLLA 2Y8YA 1NXIA 1X4DA 3BDEA 4IDKA 4M8LA 1DFDA 1I51B 3FZBA 2M8HA 3DCAA 1T94A 3L3CA 4LIRA 2VA2A 3C15B 2KM8B 1WG4A 3DRRA 2DH9A 4NL5A 2H51B 5LM7E 4LBHA 2M70A 4DCJB 4JI6F 5C5JA 1JNZB 3O8WA 4C48A 2CG8A 1F9HA 3N6NA 2BJ7A 3UN5A 2BOAA 1IKYB 1WACA 1URNA 5DETA 2ZJRQ 2ZEJA 2XLJA 1JLBA 1OWXA 7AT1B 2VG5B 4OX8A 1TAUA 3GFYA 2PSZA 2PDAA 1PCAA 2VUGA 4WFYA 4XK8C 5BYRA 5LL6d 3OD2A 2AJFE 2YNFA 8ATCB 2ZM6J 2G9OA 1L3UA 3BV8A 3SSRA 2NREA 2DNMA 3JAMU 2MKIA 4KKOB 4C98A 1UFLA 2Z30B 1RDRA 3H90A 1PO6A 2B8QA 1J5EF 4KGKA 4RU2A 2V8DA 2GW8A 3AOCA 3QFWA 2A2DA 3K7RA 4FVMA 5KG0A 2VQFF 2QMXA 4BDPA 1K0VA 3GYGA 3VAIA 5ETSA 4ICLB 1XEZA 2VDIA 3I0SA 1TKZA 1U0HB 4J9MA 4IYQA 3BN7A 2Z2ZA 4YP3A 1BHNA 3LTOA 4LFAJ 2NUHA 3MMAB 2V2ZA 5J1NA 1S49A 5DDPC 5T41A 1D9AA 3CCVS 5KG4A 2AEMA 2A6OA 2BJ3A 3ADAC 2ZKTA 4TVAB 1EARA 3A1YG 3JTPA 5H1SV 1S0VA 2NXEA 2MQQA 1FT8A 1RTHB 4ZIWA 2W7PA 2HBZB 2LEBA 3VWSA 4RL1A 3ITHB 3LALA 2AGOA 3PXGa 3RW6A 2XR9A 1ZOTA 3U7JA 3PYEA 1S12A 2JSXA 1YITS 1C2PA 1UVNA 1TL3A 3HSJA 5D3GB 2X1FA 4U8YA 5CCMA 4CH0S 2Z2LA 5GOVA 3MM9B 3NCRA 2XBPA 1TUVA 2RDDA 4ATNA 2ADBA 3MM5A 3D68A 2L9DA 3HMJG 2C3OA 3DRYA 1FERA 2HHHF 4LRFA 4X4NA 5FLXU 1SQEA 4KJGA 1DURA 1ALJA 1EW9A 2GVDA 4OZ3A 4EU0A 1NKBA 4HKQA 3T1HF 5KG6A 2W2QP 2ILYA 4CQ1A 5GAHI 4FF1A 2HFNA 2RDIA 3SXLA 4M5HA 4DPOA 4WBFA 2MQOA 1CJKA 4DV2J 1UPPA 3CGIA 4OI6A 1PYOB 2QGFB 3E2EA 3NS6A 2L48A 4DEZA 5DLTA 3KLEA 2J7KA 4C7QA 1FK9A 1S57A 1S10A 4DJBA 4DV3J 4C8OA 4LRBA 5K4PA 3QT7A 3PRVA 4OI0A 1KP6A 1WC4A 2LVWA 3KJVB 1KHKA 2XG8A 1VC6A 1V6HA 1R31A 5CYQA 4CXKA 4LQ3A 2VONA 4LR2A 1F5BA 2YPZA 5CYQB 1CLFA 3KFWX 2ZD1A 3AJ1A 4DV7F 1ZAWA 4OYZA 1FHTA 5CABA 4DQRA 3MOJB 2R2UA 4ANDA 3WBHA 4LSZB 4EK2A 2G1HA 3HHEA 1JIHA 4DBQA 3IM9A 4E8UA 4WK3A 3MM7A 4JI2F 3JTOA 4BWMA 5F8JA 4L6V3 4ZN3A 5HO4A 3V6HA 5A0YB 3AB4B 3FEXB 4USUA 5G0RA 1T9YA 1IJFB 2EBGA 2MEWA 3GFZA 1N5YB 3MK1A 2E1RA 3HD2A 5SUHA 2ZM6F 3RBEA 5FLXY 4K0KF 1S9EB 5LSLA 1SIZA 4HVZA 2JC1A 4CLFA 1EZZB 4QIVA 3BQ0A 2VB6A 1KLMA 1SPBP 4ES3A 5C7PA 2OGUA 3QBCA 2IBKA 5HQ8A 1A9NB 3CNQP 3R2CJ 4ZCIA 4X64J 2V6AA 3NWRA 3A8KA 3R27A 4OYWA 4FS2A 4CWBA 5LXRA 1YBTA 2LMIA 3FDSA 2F9JA 4I68A 4CLSA 2ZH1A 1KD1T 3SMZA 4ZCLA 4G3IA 2Z58B 1UVJA 4IRKA 5KG2A 4ZGAA 4AXJA 3UDCA 4I7FA 4OFZA 3L7UA 4RX6A 5LMUJ 5K8PA 3TAQA 1KRPA 1IBLJ 2D74B 4I7FB 3RGIA 4GRSA 4K4YA 2V63A 2XZWA 3MAAA 4X4VA 4NWBA 3L7PA 2IJFA 3ENQA 3U1MA 2RH6A 4NWJA 1NSPA 4K8RA 4QPTA 2XY6A 5E3AA 4WU2A 1GMWD 3RZAA 3VZIA 5IZHA 4ECQA 5L1IA 3ZNUA 4GKKJ 2QYCA 2VKRA 4C3MA 4DQQA 5L9XA 1FDNA 3D1HA 2W2OP 5G4DA 1R0BG 2W2MP 4HI1A 5KG5A 4QIFA 3BJYA 4KJDA 5IJQA 1TQLA 1PGZA 2UXCF 4URSA 4IFVB 2UXBJ 5B0FA 3N79A 2LKZA 2ZJQQ 2E9RX 2W4PA 4IFVA 2ZUGA 3UD5A 4O3PA 2R7RA 2VL1A 2DTJA 2AJQA 3HFVA 2MKYA 3W60A 1JLQB 4WP3A 1NM2A 5KFHA 2FLLA 2VQFJ 4NMLA 2FC9A 2PIIA 1Q7LB 4DUZF 4JI1F 1HD1A 1AJCA 2I1RA 1U2RA 2D1CA 2FPHX 3FEZA 5HVHA 1WKKA 2V8VA 2KXNB 4UOGA 2DPIA 2E1PA 2RH3A 3MM6B 4DCPB 1B8JA 2BANB 3FCHA 2N4DA 4JI6J 2PC6A 1BQMB 1EI6A 1HBMB 1UP1A 3DYCA 1HWLA 5B0AA 1LWCB 4N47A 2X51A 2B7BB 1REVA 4DPTA 1T9TA 1HJKA 2VHGA 4X4QA 1VLYA 5BJRA 3PHTA 4HACB 3Q89A 4ZLNA 2QA1A 1JLEA 4ZVEA 4Y00A 1HWIA 3V6JA 3IWNC 3QWPA 4B3TJ 1URBA 1RKJA 4NXNF 4GKJF 1TK0A 1IKWA 3ICLA 4PYAA 1OY8A 4C8YA 1GH8A 3Q8SB 3M9MB 2YKNB 1VQPS 1HA1A 1S0OA 3H98A 1SC3B 5KFIA 2WVFA 3PRBA 2XYGB 4JB8B 3VGSA 3JSRA 3E51A 4PKDB 5E5NA 4RKUC 4DHVA 1U25A 3UDLA 2R8HA 3VAJA 2VQEF 2QN6B 5J2MB 3IAM9 2KHDA 5J2QA 2P2CB 2RQ4A 3JQKA 1JKHB 3JYTA 4YEAA 1U49A 2XLKA 1HNZF 1HBOA 4FDJA 1NKCA 3M6WA 5H9EK 3H5YA 2HLUA 3HVTA 3K8VA 1IN0A 2HURA 1Z2ZA 1KC8T 2W9CB 2YX4A 3RU0A 5B0EA 4F67A 4HDHA 4X2BA 4KFBA 2F5GA 2RS8A 3S1TA 4P9SA 2D7SA 1U09A 2KHCA 2IVYA 3S7RA 3SZYA 2NSCA 4UF4A 1S1VB 3KLIB 2VZ9A 4LF9J 4K4VA 1RHKB 4GTYA 4YY3F 5HROB 2HHUA 4RW6B 1BQXA 3W5ZA 2G2ZA 3MEKA 4FYVB 3HZEA 5F0UA 1K47A 5LSOA 1SJ1A 1VS3A 3CT9A 1WNEA 3IRXA 3OVBA 3ETOA 2B4UA 5GAHU 4Y6IA 5LMNJ 4LFCJ 1RU2A 2CJQA 2J5AA 1R0CB 4XIUA 4NE9C 4YS2A 5K8OA 1FESA 3TOQA 1BQMA 1KFDA 3DC2A 3GTYX 2GS8A 1DQ8A 3RRHA 3TZXA 3TVKA 4ZVOB 3DKDA 4XDDA 4N7TA 3RB0A 1REVB 5TJ3A 4WFNQ 3M9NB 2WHOA 3OSPA 2Q66A 2E44A 1WWHA 2GQ2A 5LRMA 2V9WA 2R7XA 2MQNA 5F41A 2WONA 4RU9A 2HGMA 2DNLA 1L5UA 1KHVA 4IG3B 1JLAB 1N5SA 2VBWA 5B09A 3WAVA 2YH0A 4W92B 1DQAA 2J9EA 1GXTA 1UPMB 2DHAA 1NK9A 2UUBF 3CPWR 1UL3A 1KQFB 1GXLA 1U2FA 2BKNA 2F40A 2PEHA 2OEMA 1RJJA 2BYCA 2HS4A 2M5YA 3ET6B 1HNIB 4L76A 2ZE2B 4CH1A 2A2CA 2HK3A 1ZTWA 5GADU 2M8DB 4DR6F 3AH6A 2OEKA 3Q8UA 3V4MA 2C28A 1NJZA 5LOQA 1Q78A 3HHLA 4MJKA 5E33A 2HVEA 1U0SA 3GJSB 1QSSA 1FKOB 4MKYA 1A6LA 2WW4A 2JRSA 3WAWA 1RT5B 1C1BA 2ACYA 2D3UA 3DOMB 1X4GA 1HIYA 5CQGA 3TVYA 2V2KA 4I67A 4ETZA 1DTQA 2SXLA 2K7JA 2IVFB 4N41A 1KOHA 5FJ4A 4RNHA 1Q4RA 2KJVA 2KN4A 3WIVA 4DFPA 1FDBA 1U1QA 2FZCB 2HAIA 2BE2A 2OPRB 2YNIB 1H74A 4OJGA 2W5TA 1UEUA 3BS9A 3BO2A 1LV5A 4GO5X 1ZH5A 1ZA1B 1OQ3A 3K57A 5E3PA 4CP5A 4DG1B 1KHJA 2Y1LB 1O5JA 2C2MB 3ILIA 2DHSA 3PFOA 5C24B 3DU5A 1WDTA 2YWKA 4NYZA 3PW0A 1HLWA 3G9CA 5EGYA 4TY9A 3GJTB 1RQ0A 4G1QB 1F9EB 1WC0A 2HQ3A 3TUIC 4ZCMA 3T02A 4PUOA 1SVDA 3BO3A 2MB0B 1M1GA 2DNQA 1N34F 4NCBA 5D4NA 1IKYA 1OIAA 2N3LA 4X4RA 2APOA 4DV7J 2E9ZA 4DL3A 4DUZJ 3DGVA 2KXHA 2BOPA 2FJVA 1HDHA 1XMOF 1U8WA 1B99A 2HS3A 2Z56B 3QJLA 2RNEA 3Q8QB 4DLEA 1EW8A 5AJ3F 1GMUA 3EM1A 5KG1A 4J37A 3KLFB 2VA3A 1H0HB 2H3EB 2BV3A 2QLFB 2YKMA 4QIWD 4LF7F 4PWDB 1PSDA 1UKUA 4R0JA 2V8PA 1LWEA 4NOHA 5H9FK 5F8NA 4URQU 3CW2C 2J7UA 3HXMA 3K58A 4G65A 4B56A 1ZETA 5LRNA 2MJUA 1PYTA 2LLZA 3I0SB 3MTJA 1FFGB 2K06A 2B8PA 3VGVA 3K5NA 1LWFB 1DBDA 3JQJA 2V2VA 3C16A 5IWAJ 3D6HB 1RWMB 3M8ZA 3TJ8A 3RR7A 2CPJA 2XMMA 2YWFA 5I3PA 4K0KJ 2Q43A 2ZDPA 2GHVC 2OUGA 4OZ2A 3CVKA 2CVEA 4CYUB 3MK2A 1VI7A 3DRPB 4QYZK 2IBOA 4DOZA 4IH5A 1F60B 2V8GA 2RMLA 5U47A 2JLGA 4ILMA 5A6PA 1S9GB 1WTBA 1MSWD 4N76A 1KS2A 4FPRA 2RB7A 1IM6A 1XERA 1JLFB 3OR2A 2LA4A 2JNJA 4M5KA 4RBVA 1IBCB 4OHVA 4PQAA 2XQCA 4F50A 3FRYA 4KH1B 1N5VA 3VGTA 3G4SS 2R2RA 2CQ1A 2PFFB 1SV5B 1ZS6A 2FDNA 3MD1A 4L73A 4NA2A 1EW2A 1FXLA 1ZEDA 3MUMP 2YNIA 2CQBA 3EXCX 1IBLF 3MPDA 1UW9A 2NXCA 1RAAB 3BGFA 3DOLA 3N4WA 3NWGA 5KOWA 3W63A 3IRWP 3K5LA 4DR3J 2IM1A 1Q8LA 3KG0A 3LQVA 3GYXB 2YWWA 4USWA 4OX9F 2B4OA 4TLRA 2FYXA 4J9LA 1JX4A 2ZKUA 1AW0A 4BC7A 2DBBA 2H65B 2XYPB 3LP2B 4USTA 2IJNA 5L46A 9RUBA 1IR1A 4DZDA 2L3MA 3UI3A 2VOPA 4B9UA 3DGPB 3GB0A 5KFWA 1N4LA 1YG0A 2BJDA 5F9LA 5L0KA 2QO3A 1JLBB 1NEEA 2CYYA 3RBXA 3VQTA 2OH2A 2V34A 5D6GA 4JI7J 4JI3J 1Z1ZA 2RE1A 1HWKA 5HMXA 3P45B 1H2TZ 1XR7A 5DZ6A 1K1QA 2G2OA 1HQUB 2UXBF 3SSQA 1IVZA 1VBZA 3P6YC 1D9FA 4FF3A 5L0EA 5GRRA 2BM0A 1ACMB 2HGNA 4Q45A 2YY3A 1QAYA 1S77D 5IJSA 2HLTA 1NPRA 5C24A 1ANIA 4WXOA 1YDLA 1WOOA 3FRZA 2JHEA 3I5BA 2P6SA 1B4SA 3CJQA 1C1CA 2DISA 3CC4S 3N28A 1JXVA 1IQTA 5K20B 3LUYA 1H98A 1LWFA 4J7CA 2IC3B 3D66A 5D4LA 1PAEX 4TLQA 4ZVQB 4ECTA 3GSIA 4LF9F 2I5JA 3DHWC 3W9HA 2KT2A 3ZZ0A 3C3LA 1XNRF 3EGNA 2BMBA 3H59A 4K7QA 4CZCA 4X62F 4YR0A 1U6BA 1CS4A 4MK9A 3KK1B 3OR1A 1RT2B 1F2HA 2HRYA 3FFIA 1RTHA 2HNDA 2C22A 5L38A 1AA1B 2VASA 3GP9A 3S6EA 1HFEL 5AE1A 2XSFA 3A52A 3Q86A 3W66A 4PABA 1FXRA 2GCFA 1M1HA 3W8PA 1S9GA 2XMKA 3PIPQ 1R0AB 1RGVA 2HIQA 4ELVA 4KHPF 3J81Y 1RSCA 3EVOA 2V4RA 3KMQA 4WZMA 4PG6A 4RUHA 1D9DA 2GSNA 3WX8A 4DSLA 4WIIA 3PCOB 4DPXA 4H4OA 3DYAA 3EVMA 5KFCA 1EETB 4ZDNA 3PR5B 4FKYA 2YNGA 1XWLA 2MZJA 3HDSA 2C3YA 2Z4PA 4C8KA 1RAJA 2GA7A 4OZJA 4CLKA 1ALKA 4NLRA 1EX8A 3K89A 4AUKA 2OTLS 1N52B 4IDKB 3R7SB 3S8SA 3AJ2A 4OZ5A 4BBYA 4HLBA 2M7SA 1RWXB 1O6XA 2MXYA 4Z37A 1E6YB 5K8MA 4XPEA 5JVGQ 4ECYA 4HYKA 2Y9HA 3T41A 2P6TA 2EI5A 1RXOB 1EKSA 3T1AA 1S6OA 3DXSX 6FDRA 1CVJA 4MIVA 4S0MA 3BZQA 1DY3A 4GTXA 2O66A 3ZZZA 1Q8KA 2VPYB 4JYAF 2AMCB 1DJ0A 2J8SA 1O99A 1NRKA 2DGUA 4ECSA 1F3FA 2A18A 1EJJA 2VDHA 5C42B 1SV5A 1L3TA 3OTBA 4K4SA 1RYRA 4Y28C 4NLUA 5C42A 3IMQJ 3AA8A 4DCOB 3HVRA 1SL1A 2BRLA 3AXKA 3AD7C 3MECA 2DY9A 2B43A 4P2MA 5D0GA 3NEKA 3KK2A 5GAGI 5BYSA 4EWTA 2RILA 2QFJA 4UOHA 2WVBA 3K5OA 1RAOA 4QWDA 5ETMA 2G2YA 5AXLA 3HCXA 2RUGA 1UAWA 4OI3A 1WI8A 4C0HA 3QZ8A 1WELA 4ZVTB 2BKPA 1FJGJ 1MMDA 1Y4ZB 5FD1A 3RW7A 5L1LA 4JV1A 4PG8A 3MFIA 3PX0A 2XGQA 1FD2A 3LWMA 1XQIA 1R8AA 4I2QA 4M5NA 2RS2A 3FBBA 3I4HX 2MQMA 2GGPA 2GMJA 3HHDA 1NSQA 3RBZA 4K4WA 1F5CA 3R6LB 2M0GB 3M32A 3MM6A 5HK4A 2HRTA 1FWKA 4WCEQ 1LOUA 4ZPAA 1M5VC 1UVMA 2NQPA 3B54A 1KH4A 1RLDA 1ELOA 4ENOA 1TAQA 3UO0A 2XMJA 4J9PA 3LGHA 3SV3A 3BH7B 4YR1A 3NKPA 1XK8A 2ZD1B 4CLPA 3BQ1A 1RB0A 1S1XA 1WSRA 1RWKB 5AT1B 2VFRA 5IC6B 3SDEB 3U02A 3P4UB 2HNZA 1GTEA 1DRZA 1QSYA 2MY7A 3W2VA 3SEOA 3BKUA 4QAXA 2RF2A 1N56A 1GX5A 3DYAB 3MM7B 3BPSP 2CPEA 4QPXA 5HMYA 2XO6A 1MROB 4AE5A 3FSYA 4DZ6A 3HSDA 4ETXA 2DR5A 3IS9B 4GKKF 1G2EA 4P73A 4LRAA 4LJMA 3OVAA 3E2DA 1U6ZA 3PHEA 3RJMB 4F4YA 1OY9A 1P49A 2C1EB 1SJRA 1Y7PA 3EE3A 2BJEA 3SIPB 1ITPA 4TU8A 2WVEA 1R7IA 3G6XA 3KUGA 3MEGB 4X65F 1RAGB 2MLZA 2OPSA 3MAAB 4PXCA 2MKCA 2ZFHA 3MEEA 3QAEA 3QSIA 4B3OB 2DHGA 2KU7A 3ENWA 1YHQS 4H4KC 1AFIA 4NLYA 4BLGA 3TZZA 3AFGA 3C14A 2CJBA 2Z57B 2YNGB 1CJUA 4A8XA 2IPOB 3BQ2A 1QY7A 2OELA 4I0WA 2W9CA 1QSLA 5D3GA 1YRUA 3CDEA 1CPZA 2UVVA 4DF8A 1AJDA 2KT5A 2Z0GA 3V4IA 2DNRA 1EB0A 4B9VA 4DQPA 3IO1A 2I0XA 2LP4A 5J1EA 2E5LJ 3HO1A 1UMJA 5KT2A 4KQZA 1B64A 1OY6A 1KQKA 3NKRA 1RHRB 3A3NB 2KH9A 2ZWOA 3I4PA 4EUVA 3CJ4A 4P2FA 2UVWA 2EXUA 5L39A 3WQPA 1N6QB 5I4MA 2CJYB 3DDKA 2E9TA 4DLGA 1S1WA 1AJBA 2E5JA 1H2UX 1QDUB 1FK9B 1T9VA 2I8EA 2LEAA 4LT6A 2MGZA 1M5KC 3ILJA 2OPQB 3JTNA 4ZK7M 3RB4A 1N0VC 1X5OA 1SUQA 2GC8A 1GAOA 2GZOA 4L72B 1S0NA 1FXDA 4KHRA 1HNXJ 3IGNA 3HF5A 4YR2A 1U1MA 1S4EA 1X4AA 2W7OA 1EIYB 2H4YB 1SB6A 2OAUA 3TP2A 5DG8A 1MG7A 3UNYA 1P27B 4U95A 4JI7F 1NJIT 2F4VF 4LRDA 3D3BJ 4NLGA 3CULA 3BYRA 1SIWB 2B9EA 2W2PP 8RUCA 4OI4A 3G86A 3AB2B 1JK9B 1M5SA 1GEHA 1ZM3A 3GZ7A 3NY0A 4M5IA 5I42B 4DR4F 4QU6A 5MLCV 4FDIA 3NNHA 1V5IB 1BGXT 3DPCA 2O1PA 3Q8VA 2YKPA 4HHUA 4ES1A 2CPZA 3NXZA 2BZ2A 2FHOB 1W25A 5HAOA 3VQSA 1X9SA 4DSIA 2KFNA 1ELYA 1VCTA 2QEXS 4JV5F 4H54A 1UA0A 1IR0A 5L1JA 1NHKL 2CQIA 3HHKA 1GNKA 1VHIA 1S59A 4K5RA 1S1XB 3D9BA 1K9MT 1KLMB 3F0NA 1N32J 3ZZYA 1IUJA 2BACA 2V9KA 4QBUA 2VFSA 2V4QA 2ZWPA 3AAWB 1XMOJ 3W5YA 1HI1A 2ZC4A 3GV7B 1B0PA 1SH0A 2QSWA 3HVTB 4WPAA 3MCSA 3BBBA 4U67Q 3V6DB 4F4XA 3M9OB 4F04B 4EEYA 2MKJA 4Y2KA 2NS1B 4MIWA 2MQ8A 2BABA 2DYAA 2NPFA 3MR2A 2X3GA 1LXNA 3ZZPA 2N4CA 2XM3A 4LF6J 5IV3A 1YWXA 4NA1A 1NHUA 5HJXA 2ZOFA 2VC1A 3KLHB 2PI4A 2DGOA 3RTVA 1NJWA 4UY85 2CQ4A 3K17A 3O1LA 1VJWA 2BBEA 1JNRB 4Y65A 2FHJA 2X1AA 3NL0A 4PQUA 4G1IA 3M4XA 4MKBA 2ASDA 3UE2A 2CPIA 2KO1A 4KHMA 2XMAA 2GIFA 3EMTA 3D6TB 3OJUA 2HFSA 5ETTA 2QZUA 5DG7A 2IM0A 2FVRA 2V4JB 3FEYB 3MDFA 4PXBA 2AKWB 1FRJA 2QLBB 3KLIA 1ZYQA 3HT0A 1T02A 4RUBA 2ZH4A 1RBOB 4TQSA 4CIOA 1IBKF 2PI5A 4Y2MA 2J0SD 5E3RA 1FSUA 1TELA 2Y8WA 2AEFA 1F2GA 2OD6A 3O6QA 1WKJA 4M5LA 1RCOB 3OL6A 2VBYA 4HR2A 3SFGA 5KT6A 4Q43A 2FLNA 1F3VA 1NDCA 1FX4A 4USKA 2JEFA 4X4UA 2FUG9 4P71A 2J0XA 3HHLB 4H4KA 4C8ZA 4NRTA 1TL4A 3CDWA 1HKAA 4KHPJ 2CQCA 2KVQE 2QJ3A 2YQ1A 4Q7AA 1WG1A 3GQCA 2HK2A 2Y1IA 3SI8A 1U4BA 1BXNA 1KVIA 1NZ8A 1P1LA 3M2VA 3PYGA 2L41A 3IDDA 3CO9A 3M2VB 5D77A 5KFVA 1R3NA 4UZBA 1WEYA 1U1OA 3ZTSA 1H7WA 3MPVA 1CG2A 4PXEA 4DS5A 4GMKA 3MUVP 4IOAQ 4LQ9A 1FWPA 3PO5A 1V3SA 4X4OA 4B9NA 3DLKA 4CM2A 2W5SA 4OHYA 1XNQF 3P5TL 3I32A 4YDXA 3G8SA 1Y9OA 4JI5F 3NMAA 5EUHA 3NGUA 4DX8H 1FRMA 1VGYA 1S1VA 1RP5A 3DM2A 3VR1A 4DQSA 1WSVA 2E5LF 3JSBA 4CLYA 2V2QA 3H2LA 4I4BA 2GMLA 2ZITA 1FF2A 4HHHA 1I3OB 3I56S 2W9BB 4FS1A 2ASJA 1Y5NB 2AQ4A 1NDLA 4YOEA 4UPHA 1KVJA 3NS5A 1A7GE 3EXYA 2EK6A 2AJ2A 3CO0P 3FVYA 1T05A 2J6TA 3J80Y 4IFYA 2LXFA 3TR5A 2AJ1A 1FJGF 2CAJA 2F4FA 2KI2A 4GKJJ 3PVXA 4ELTA 2AWZA 3R97A 1HW8A 2QMWA 2XCPA 1YJNS 4LF4J 3OL9A 1BWVA 4NRUA 2CG4A 3W9IA 2F8EX 1HHSA 3T6JA 4DL7A 1FJEB 4U7CA 1LEOA 5IS2A 3IA0A 5HQLA 3MOZA 4YB1P 2HHQA 2GVZB 1X0PA 2HSEB 2E5HA 1JJHA 5KFTA 1K8AT 1VQ9S 1NCLA 5M2RA 3VGUA 4ELUA 4JI0J 3KD8A 4C8MA 4J9SA 1ED9A 1WF2A 2RHSB 1NK5A 3EX7B 3M1VB 2WK4A 1CJTB 1HMVA 4MT1A 2HQDA 1BC6A 2HMIB 1RHUB 2AZ1A 2EPIA 1RWUA 2YXLA 2RQKA 1Y0HA 4UQGA 1FKOA 2NYIA 3D0GE 3EJMA 4O0NA 1FFWB 4Q0BA 1UVKA 1OPZA 2MSTA 3MCNA 3IWXA 3CMAS 4Q8EA 5KFKA 2HBYB 4XDCA 2UUAJ 2NZ4A 2L9NA 3QAUA 4Y2CA 5KFJA 3OUYA 2XO7A 2DRDA 1IBKJ 4JUZA 3J80U 1AUSL 2W4CA 4B3RF 4ZKAA 2OIHA 4FBUA 2JX2A 5CD4H 1HPZB 2GFFA 3LAMA 1LFPA 1TVRA 2XI3A 1WKLA 2DGWA 5DS7A 3ZNJ1 1U1RA 1HL6A 3ZC4A 2DCUB 4ED2A 3LXQA 1D1UA 4E0DA 3Q8YA 4DPYA 4PCQA 4RW9B 2AJ4A 4TY8A 1ZEFA 2DNNA 1UJ4A 4U8VA 5AXMA 4CTAA 5J1PA 2ZDOA 4DS4A 1NUEA 4LF5J
chains in the Genus database with same CATH topology
5TJ3A 4N7TA 3TWZA 3UN5A 5L0KA 4UOPA 3NKMA 5LRMA 4LRAA 3E2DA 2D1GA 3TX0A 1P49A 1ELZA 1FSUA 4UORA 3WAVA 4UPIA 5L0EA 1EQJA 5DLVA 4NWXA 5GRRA 5L0BA 4KM4A 2RH6A 3NKNA 4NWJA 4MY4A 5IJSA 1O98A 1ANIA 2VQRA 3TG0A 2W8DA 1ELXA 3SZZA 5DLWA 4KJDA 3BDHA 5IJQA 2ANHA 1ALHA 2W8SA 1AJDA 1ZEBA 3WAWA 3IDDA 3M8YA 4UOOA 3M8WA 1HQAA 1AUKA 3NKRA 5KXAA 2ZKTA 3T00A 1ANJA 3A52A 4LQYA 4LR8A 1AJCA 2W5TA 4LREA 3UN2A 2W5SA 4KAVA 1E3CP 1AJBA 2XR9A 3IGYB 1KHJA 3MK0A 2GSNA 1URAA 1B8JA 4CXSA 1ALIA 1EI6A 4ZG9A 5LIAA 1AJAA 1Y7AA 3DYCA 4LR7A 5GOVA 3T02A 4CYRA 1ALKA 4UPHA 1HJKA 3UNYA 2GSUA 5INHA 3M7VA 4LRFA 4CYSA 4KJGA 1ALJA 1EW9A 1HDHA 4LRDA 1EW8A 4UPLA 4GTZA 1URBA 3BDFA 3NKOA 4MIVA 4ZG7A 3B5QA 4FDIA 4GTXA 3ED4A 3DPCA 5DLTA 1ED8A 2GSOA 4CXUA 1EJJA 3BDGA 4GTWA 3OT9A 1ELYA 4B56A 5LRNA 2W5WA 4LRBA 5K4PA 3NVLA 1KHNA 3KD8A 3WAYA 1KHKA 4CXKA 1E2SP 3UN3A 1E33P 3M8ZA 1N2LA 4LR2A 1ED9A 2W5VA 2IFYA 2X98A 3Q3QA 4FDJA 4MHXA 1KH7A 1SHQA 3WBHA 4LR9A 4ZG6A 2W5RA 2G9YA 1SHNA 1Y6VA 1KH5A 3MK2A 1KH9A 3T01A 2IUCA 5LQQA 1KHLA 5C66A 2XRGA 2GA3A 2W5XA 4KAYA 2W5QA 5HRTA 1N2KA 5EGHA 3CMRA 3SZYA 4GTYA 3MK1A 3NKQA 4LRCA 1KH4A 3BDGB 1O99A 4UPKA 4TN0A 1EW2A 3UO0A 1ZEDA 4YR1A 5AJ9A 3NKPA 3LXQA 3IGZB 1E1ZP 1ZEFA 4ZGAA 1K7HA 2GLQA 4QAXA 2IUCB 3WAXA 5EGEA 2QZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJ3 A;  4N7T A;  3TWZ A;  3UN5 A;  5L0K A;  4UOP A;  3NKM A;  5LRM A;  4LRA A;  3E2D A;  2D1G A;  3TX0 A;  1P49 A;  1ELZ A;  1FSU A;  4UOR A;  3WAV A;  4UPI A;  5L0E A;  1EQJ A;  5DLV A;  4NWX A;  5GRR A;  5L0B A;  4KM4 A;  2RH6 A;  3NKN A;  4NWJ A;  4MY4 A;  5IJS A;  1O98 A;  1ANI A;  2VQR A;  3TG0 A;  2W8D A;  1ELX A;  3SZZ A;  5DLW A;  4KJD A;  3BDH A;  5IJQ A;  2ANH A;  1ALH A;  2W8S A;  1AJD A;  1ZEB A;  3WAW A;  3IDD A;  3M8Y A;  4UOO A;  3M8W A;  1HQA A;  1AUK A;  3NKR A;  5KXA A;  2ZKT A;  3T00 A;  1ANJ A;  3A52 A;  4LQY A;  4LR8 A;  1AJC A;  2W5T A;  4LRE A;  3UN2 A;  2W5S A;  4KAV A;  1E3C P;  1AJB A;  2XR9 A;  3IGY B;  1KHJ A;  3MK0 A;  2GSN A;  1URA A;  1B8J A;  4CXS A;  1ALI A;  1EI6 A;  4ZG9 A;  5LIA A;  1AJA A;  1Y7A A;  3DYC A;  4LR7 A;  5GOV A;  3T02 A;  4CYR A;  1ALK A;  4UPH A;  1HJK A;  3UNY A;  2GSU A;  5INH A;  3M7V A;  4LRF A;  4CYS A;  4KJG A;  1ALJ A;  1EW9 A;  1HDH A;  4LRD A;  1EW8 A;  4UPL A;  4GTZ A;  1URB A;  3BDF A;  3NKO A;  4MIV A;  4ZG7 A;  3B5Q A;  4FDI A;  4GTX A;  3ED4 A;  3DPC A;  5DLT A;  1ED8 A;  2GSO A;  4CXU A;  1EJJ A;  3BDG A;  4GTW A;  3OT9 A;  1ELY A;  4B56 A;  5LRN A;  2W5W A;  4LRB A;  5K4P A;  3NVL A;  1KHN A;  3KD8 A;  3WAY A;  1KHK A;  4CXK A;  1E2S P;  3UN3 A;  1E33 P;  3M8Z A;  1N2L A;  4LR2 A;  1ED9 A;  2W5V A;  2IFY A;  2X98 A;  3Q3Q A;  4FDJ A;  4MHX A;  1KH7 A;  1SHQ A;  3WBH A;  4LR9 A;  4ZG6 A;  2W5R A;  2G9Y A;  1SHN A;  1Y6V A;  1KH5 A;  3MK2 A;  1KH9 A;  3T01 A;  2IUC A;  5LQQ A;  1KHL A;  5C66 A;  2XRG A;  2GA3 A;  2W5X A;  4KAY A;  2W5Q A;  5HRT A;  1N2K A;  5EGH A;  3CMR A;  3SZY A;  4GTY A;  3MK1 A;  3NKQ A;  4LRC A;  1KH4 A;  3BDG B;  1O99 A;  4UPK A;  4TN0 A;  1EW2 A;  3UO0 A;  1ZED A;  4YR1 A;  5AJ9 A;  3NKP A;  3LXQ A;  3IGZ B;  1E1Z P;  1ZEF A;  4ZGA A;  1K7H A;  2GLQ A;  4QAX A;  2IUC B;  3WAX A;  5EGE A;  2QZU A; 
#chains in the Genus database with same CATH topology
 2GHP A;  4YHH F;  2UXC J;  2HFV A;  3TAM B;  1T9W A;  1X60 A;  5T7L A;  3NOC A;  2C2O B;  1RAC B;  3KLE B;  4ECR A;  4UOP A;  4GVB A;  1Y5L B;  4TQR A;  1WEZ A;  4LFA F;  1KNZ A;  3M6V A;  3TEG A;  3VAG A;  2HZA A;  4KGM A;  3PNI A;  1EQJ A;  4PR6 A;  4RW4 B;  3BSA A;  2XSJ A;  5KFY A;  4AFF A;  5ETQ A;  4F8R A;  3NKN A;  1FNO A;  3CJ3 A;  1MNE A;  2KZM A;  3EZU A;  2R9L A;  4DL4 A;  2UUC F;  2C3U A;  1C1C B;  3A4T A;  2C2N A;  1JLG A;  2NZC A;  4G1Q A;  2AD9 A;  3KUE A;  2IYG A;  2FJA B;  1JLG B;  3D0I E;  3I55 S;  5KFZ A;  5DLF A;  3NS7 B;  3OTE A;  2QG9 B;  4KH0 B;  4CLZ A;  4W90 B;  3W5X A;  3QQC D;  3KG4 A;  2KRR A;  7FDR A;  2OPP B;  1UEV A;  1HMV B;  4AQY J;  5J2N A;  1N33 F;  4F4W A;  3BR8 A;  1FDD A;  3NGK A;  1W26 A;  1JJ2 R;  2V50 A;  3M8Q A;  1U24 A;  5HL7 Q;  4X65 J;  4LR8 A;  4DR1 J;  1R8C A;  2Q3P A;  5KFE A;  4DL6 A;  2C3M A;  3NGT A;  2P9G A;  3GII A;  4KPY A;  3D5M A;  2GAH C;  2W24 A;  1Q8I A;  3NG8 A;  4JI4 J;  1RZM A;  3OLB A;  2VIC A;  3HI9 A;  3KJF B;  4LIW A;  4G6V B;  3W2V B;  4WFA Q;  1P6T A;  2LQ8 A;  2IM3 A;  2A3J A;  4Y2I A;  4C3K A;  1J2V A;  2KKH A;  4CO3 A;  4E98 A;  5HN0 A;  1U0H A;  4KC5 A;  4OHX A;  3H7H B;  4WK1 A;  4IH6 A;  5LIA A;  5EX0 A;  3IBW A;  4DSK A;  3HK2 A;  2QTW A;  5KAK A;  1FDA A;  2OLW A;  1YQH A;  2PA8 D;  4LVO P;  2B3T B;  1SKU B;  3HFK A;  3M7V A;  5LMU F;  3TAR A;  2O01 C;  3AOD A;  3RB6 A;  1N54 B;  4NCG B;  5AJ3 J;  3IFE A;  2VF3 A;  1T0T V;  3DMJ A;  2F1F A;  4MK7 A;  3DNC A;  1AB8 A;  3WHI A;  1KTQ A;  1S1T A;  5DGA A;  1F5A A;  2ZZM A;  1CJV B;  2JEI A;  3JXO A;  1FKP B;  2BA9 A;  5T7L B;  5BYQ A;  5BR8 F;  2JLF A;  4IH7 A;  1XTZ A;  2XGP A;  3GIL A;  4ECZ A;  4B9S A;  2R7O A;  1F6T A;  2YWG A;  1QE1 B;  3TO8 A;  2DNO A;  1UJ6 A;  2U1A A;  4NXM J;  4LUB A;  2OMO A;  4WE1 A;  3NAI A;  3VAF A;  1BLU A;  1KDN A;  4ZP9 A;  4F7V A;  2GMH A;  3D28 A;  3MEC B;  1UEK A;  1SQF A;  2JC0 A;  2DIV A;  3BF4 A;  2F7V A;  2QX0 A;  3OBI A;  4K50 A;  3EPG A;  5C2G A;  4U7U D;  1U02 A;  4RNO A;  2RSQ A;  1LWX A;  3NRB A;  1FRL A;  3ETM A;  2X3D A;  2GVD B;  2LQJ A;  4OJ3 A;  4F3O A;  3KG1 A;  3W8G A;  1UWA A;  1MWY A;  1S9F A;  1KHL A;  3RAX A;  2XRG A;  2W5X A;  4NYO A;  5IM0 A;  1HI8 A;  2LEP A;  2VPW B;  1I94 F;  1SKW A;  3I9V 9;  2DRB A;  2CQP A;  1C0U B;  3C6T A;  3R1H A;  3J7A N;  2MZR A;  1MMN A;  5H9E J;  1Q86 T;  3TI0 A;  3D54 A;  3VVU A;  3VVT A;  1QUP A;  2XTJ P;  4K5S A;  3CJ2 A;  2H1Y A;  2XSJ B;  4CDI A;  5GAE I;  1FVQ A;  3TUZ C;  1HQU A;  2I2Y A;  3VV2 B;  1S9E A;  2K7K A;  4B17 A;  4DN9 A;  5KFN A;  4KR0 B;  2UUB J;  1CC8 A;  1R0A A;  1FRI A;  1LW2 A;  2PMW A;  3R5G A;  5K8N A;  2VJU A;  4B3T F;  4IRD A;  2G13 A;  3W3S A;  3SDE A;  1IQZ A;  1CQM A;  1TU0 B;  3QGI A;  2G0J A;  2DB1 A;  3ENA A;  4P75 A;  4DR5 J;  1PC5 A;  1N0U A;  2D9O A;  1F0X A;  1Z4U A;  1VBK A;  2AP6 A;  3HHL D;  1JXE A;  2QYG A;  3MMA A;  3QO9 B;  1YVF A;  3TJA A;  3RG6 A;  2W8L A;  1SH3 A;  2IC3 A;  5A0Y A;  1YX2 A;  3M32 B;  2DY1 A;  5ETK A;  4ES2 A;  5JVH Q;  3GPA A;  1H7X A;  3PEH A;  1YJU A;  4OZ1 A;  2RU3 A;  1H38 A;  4DN0 A;  3LP0 A;  2XHC A;  3FKB A;  1Q79 A;  3LPE A;  4KO0 B;  1RTI A;  2HHP A;  2HFZ A;  2ROP A;  2HFU A;  3FQK A;  4PEO A;  4YB6 A;  4DV4 J;  2E29 A;  4IR1 A;  3R2D J;  4NWX A;  2XYH B;  2DGQ A;  3FNN A;  3M8R A;  3L7O A;  2OPS B;  5FII A;  2BJ9 A;  2R7Q A;  3MPW A;  2HNZ B;  3D2W A;  1LNQ A;  4CO2 A;  1NSK L;  4IR9 A;  4C9D A;  4P74 A;  1XIQ A;  4X4P A;  4A46 A;  2KG1 A;  1TKX A;  1FJ7 A;  4ZJQ A;  2C2E A;  4C8L A;  1HYS B;  4MIA A;  2R3V A;  2DNG A;  3SCL E;  3UPF A;  2ZBC A;  3KLV A;  3LPY A;  2ANH A;  1YKW A;  4DPU A;  1WTF A;  2ZH9 A;  2AYG A;  3HLU A;  2HWH A;  4OQJ A;  2UUA F;  4A8F A;  3R7N B;  3KNG A;  2AU0 A;  4UOO A;  3G6Y A;  1HNX F;  3OL8 A;  5MAO A;  2NPI A;  4RWW A;  2W8K A;  2FVS A;  2V68 A;  1W2I A;  1KLN A;  2NXJ A;  4MAK A;  1F1B B;  4X4T A;  3C19 A;  2YPY A;  4UY8 T;  5CHC B;  2O3D A;  3T00 A;  4CT9 A;  4OYM A;  1CJV A;  1RYS A;  3KOA A;  2AYE A;  2XB2 D;  5IT9 Y;  3W1Y C;  4ECV A;  3R5B A;  2R8I A;  5LT5 A;  3MK0 A;  3CSK A;  2B9W A;  3ISZ A;  3ELH A;  5F8L A;  3EVW A;  3PO4 A;  4CCH A;  4CXS A;  1B7Y B;  3UFC X;  1LK5 A;  2CJX B;  4ECX A;  4OMF G;  3KK2 B;  2IVM A;  4NLV A;  3EIC A;  4HT5 A;  3TAP A;  1VQS A;  5I3Q A;  1RT7 A;  3CD7 A;  4TNO A;  1L3S A;  2ZH6 A;  3BO4 A;  2XUL A;  2LDI A;  4CYS A;  4IOB A;  2YX1 A;  4M5M A;  2H4W B;  2HBQ B;  3I5C A;  3KJQ B;  2HS0 A;  1PYS B;  5KFF A;  4RW8 B;  3FZ2 A;  4H4M B;  3I9Z A;  2VH7 A;  4B3M J;  3KNA A;  1OMS A;  4HTI A;  5C2C A;  2PD1 A;  2DT9 A;  4ZPV R;  3Q0A A;  3DN9 A;  2FZG B;  3QIP B;  4RW7 B;  3VHQ A;  4Q5V A;  1BY9 A;  4F0M A;  1VQM S;  1JJ4 A;  2B5J A;  5KFX A;  3OXG A;  1SUQ B;  3CCQ S;  2C2R A;  2IMW P;  5KFG A;  2QL9 B;  2FJE B;  3ZZO A;  2AGP A;  1T3N A;  4CH7 A;  3EDR B;  1KHN A;  3A8I A;  1QAX A;  3HX9 A;  4KIA A;  1RIS A;  1Y3J A;  2WW8 A;  2W4D A;  3CD0 A;  1WHX A;  2IAJ A;  5CXT A;  2IAJ B;  3K0J A;  3MD3 A;  3G87 A;  3R1L A;  4OLP A;  1BE4 A;  1MN7 A;  4LR9 A;  4WFX A;  3UD4 P;  2J0Q D;  2U2F A;  1OSC A;  3SCK E;  4NLQ A;  5DLG A;  2DD8 S;  2PO4 A;  2WZ1 A;  1H6K X;  1HWU A;  3GV5 B;  4DV0 J;  5HRT A;  3QLH A;  4A8Q A;  1D0E A;  3M8S A;  3CMR A;  1ZM4 A;  2DK2 A;  3N9U C;  2LFV A;  2B4V A;  4IG0 B;  5KTQ A;  4A8S A;  4JI3 F;  4LBI A;  2BUN A;  3KYL A;  3BDG B;  2I6W A;  2DGV A;  3T9N A;  1N34 J;  4UPK A;  1TK8 A;  1ROF A;  2EBE A;  4ILR A;  2HG4 A;  3L9Z A;  3RB3 A;  1GMW A;  4NZ6 A;  2ALY B;  1WC6 A;  2CVI A;  4K2J A;  5E3Q A;  5DM7 Q;  1Q82 T;  2DNY A;  2DPJ A;  2FHM A;  1CJU B;  3CXC R;  3CE8 A;  3JSM A;  4W4M A;  3C14 B;  3KLF A;  5THW A;  2IY5 B;  3PM9 A;  1R89 A;  2DR6 A;  4KJI A;  3PW2 A;  4PG4 A;  3EGW B;  3POT A;  3GR1 A;  1YJ9 S;  1IXK A;  2R4F A;  3LO3 A;  5T14 A;  3QSY B;  1OQ6 A;  2ZBI A;  4I2P B;  2D3O 1;  3G82 B;  3AHP A;  3KXD A;  1KFS A;  1REG X;  3QT8 A;  4NLD A;  4P10 A;  3G82 A;  4WFB Q;  4LFB J;  3FQL A;  1EP4 A;  4KPC A;  5I3U B;  1RWO B;  3N0V A;  3EUN A;  3KLH A;  1IJE B;  1HD0 A;  1KR4 A;  2DHH A;  4DV6 J;  4A8Y A;  5DLV A;  5L0B A;  3MI7 X;  1MML A;  3QWU A;  4ZP7 A;  1Q53 A;  5E3C A;  1RT3 B;  1TL1 A;  5HBM B;  2ZHA A;  4AQY F;  4FDF A;  5KFQ A;  2D3O R;  2B5J B;  2ZJP Q;  1UA1 A;  4WU3 A;  1VQ7 S;  1HNI A;  2X7I A;  1QJH A;  2XS7 A;  2BAN A;  3QJP A;  1IBM F;  5A8K A;  1T03 B;  3FBC A;  4J9U E;  4OX6 A;  1TKD A;  3D7S B;  1JJC B;  2Y3Y A;  3DRS B;  4R5P B;  1TKT B;  2OFG X;  2FZK B;  3A3O B;  3DLE A;  1QTM A;  4ZP8 A;  4DQI A;  1SCJ B;  4HTJ A;  1C1B B;  5LXY A;  2DRA A;  3MXH P;  4Q8F A;  5DGB A;  3ISN D;  4KB7 A;  2OSR A;  4HH1 A;  4F4Z A;  2Q1L A;  3GMG A;  3QRQ A;  2CPH A;  2DIU A;  3MR6 A;  1L3V A;  4ZVU B;  1BQN B;  4MH8 A;  5H9F J;  3GU0 A;  4JI8 F;  4A8O A;  1CUL B;  4IOC Q;  2B9Y A;  5DRK A;  2GIQ A;  3PEJ A;  2GJI A;  1SJF A;  1RTJ B;  4DV5 J;  1C0T B;  1RTZ A;  2GJF A;  2MLX A;  1RT4 B;  4KRW A;  4L74 A;  4X84 A;  4RNN A;  1B3T A;  2VG7 A;  2HNY B;  5KFB A;  3BKT A;  1EKR A;  2MZQ A;  3LP2 A;  3LGN A;  3G71 S;  1ALI A;  1OS5 A;  3NBP A;  4ZG9 A;  3IG1 A;  1GT8 A;  3AJD A;  5M2U A;  2J6S A;  2GO9 A;  4CYR A;  1C4A A;  1DQ9 A;  1T95 A;  4IRC A;  1LXJ A;  1TMM A;  4WTO B;  1PC4 A;  1YZ6 A;  4DL5 A;  2ZZN A;  4ZHR A;  1T05 B;  2W7A A;  2XMW A;  1IWG A;  4WF9 Q;  4EO8 A;  4GTZ A;  2MZS A;  4O3N A;  2JVR A;  3DLK B;  4KFB B;  3IR7 B;  3SCI E;  3QLH B;  3CCJ S;  2FJW A;  2RUS A;  4FN5 A;  4PG5 A;  2CFX A;  2VC0 A;  3NNA A;  2GQC A;  2MZ1 A;  3KLG B;  1ED8 A;  1DHM A;  1RBL A;  1NND A;  3OT9 A;  4NAS A;  1QLN A;  4M95 A;  2WB4 A;  2KDO A;  5F8I A;  5HRO A;  5I3U A;  3DI6 A;  5K5M A;  3CDB A;  2JFD A;  5EWE A;  4DUT A;  3T1Y J;  4DSE A;  2QA4 S;  2QV6 A;  2MPU A;  3TX8 A;  2J8A A;  2M52 A;  1FD8 A;  2ZC3 A;  1VQL S;  1CS4 B;  3KK1 A;  4ZVR B;  4AD6 A;  4OYX A;  2W5R A;  3F56 A;  2UVU A;  1NJY A;  4C4W A;  1KH9 A;  2HIY A;  3MMB B;  1RA7 A;  4DR3 F;  3MTK A;  1T03 A;  2MKS A;  3CME S;  2B56 A;  4EFA C;  3T19 A;  1H3D A;  1WC5 A;  2CA9 A;  5CH7 B;  1KHW A;  5KT4 A;  1SH2 A;  4OHW A;  4DWI A;  3GIM A;  4A8K A;  2JZ5 A;  3OL7 A;  3DHX A;  2VKZ G;  4GO7 X;  2GVZ A;  3VAM A;  5K14 A;  3KK3 B;  1PBA A;  1YZ7 A;  3CJS A;  1M1K T;  1UVI A;  2NUU G;  4LFB F;  1S0M A;  2J9C A;  5F0W A;  2R2T A;  4TN0 A;  2UU9 F;  3D1O A;  4CT8 A;  1RAE B;  3ILO A;  1DLO B;  2CAD A;  3Q22 A;  2KL8 A;  2HGL A;  3OFE A;  4TYA A;  4Y3C A;  1AYE A;  3I31 A;  3H2U B;  5GVQ A;  4NZ0 A;  2YKO A;  4DMZ A;  4JV2 A;  3TUJ C;  4RNF A;  5AE2 A;  3CD6 S;  1E1Z P;  4MTP A;  3HKW A;  3QJJ A;  4HHJ A;  2OI2 A;  1SL2 A;  3BGU A;  2IUC B;  2GQQ A;  2ASY A;  4MKA A;  3AD9 C;  1TL7 A;  2D69 A;  1RT5 A;  2UZA A;  2D41 A;  3ISN C;  1NDK A;  3CDU A;  3BYP A;  4A8M P;  1C4C A;  1TFY A;  3NNC A;  2Y0S D;  3CED A;  3UVJ B;  1KEK A;  5DQG A;  2EWH A;  3K5P A;  2R7U A;  2PFD A;  2KRB A;  2DNZ A;  2P8I A;  2BE2 B;  2OPR A;  3VF0 B;  3WBZ A;  1AZS A;  5KFM A;  1HHT P;  2VPX B;  1MW7 A;  1QVG R;  2MKH A;  4UPI A;  1S6P A;  2B0G A;  2O5D A;  5E2Q A;  1FNM A;  5F9N A;  4KM4 A;  1DAR A;  1RTJ A;  3VTI A;  1O98 A;  2BJ8 A;  2XWY A;  3LP1 B;  1Q16 B;  3Q8P B;  3EGZ A;  4K4Z A;  2EEY A;  3BH6 B;  2N7Y A;  4O44 B;  3RUB L;  4RUC A;  4R8U B;  2C2D A;  3OPK A;  3A8J A;  4ZPT R;  4ED8 A;  3TAM A;  3PX4 A;  4C2M A;  1ZEB A;  2QRR A;  4TN2 A;  2MY8 A;  4G1P A;  1GMV A;  2VQE J;  4BS2 A;  1PKU A;  5IFM A;  4FF2 A;  1RWN B;  4FF4 A;  2FB0 A;  5KXA A;  3L95 X;  1PIL A;  1IKX A;  3QYY A;  5B0C A;  2BQU A;  4XPC A;  1RT2 A;  1ZPW X;  4PXD A;  3G6V A;  1XC9 A;  3IR6 B;  2CJ9 A;  4ZCK A;  2HVI A;  1MLA A;  2CNO B;  2EVZ A;  4M5D B;  3UN2 A;  3HVA A;  1X0F A;  1S48 A;  2M2B A;  2BM1 A;  3CCW A;  3ZTR A;  3GWC A;  2XNQ A;  3OLA A;  2KM8 C;  3RR8 A;  1YJW S;  1IKV B;  2EFP A;  1WC1 A;  1FVS A;  4B3M F;  2F3J A;  4M5J A;  1NK6 A;  1AJA A;  3QPI A;  2G1D A;  1ZBT A;  4NEZ A;  4NLW A;  1YGY A;  4LR7 A;  4TYB A;  2AX0 A;  5AXK A;  5KFO A;  4K2X A;  4X66 J;  3Q23 A;  3IS9 A;  3PIO Q;  3D1Q A;  1XR6 A;  3D3C J;  1FI4 A;  4QOT A;  5KFP A;  4KE5 A;  3N6M A;  2I5J B;  2VJV A;  2VU5 A;  3BR9 A;  3KDO A;  3MMB A;  2HMI A;  4LF4 F;  4WYW A;  4TY8 B;  1RTI B;  4UPL A;  2FLP A;  2CNN B;  2HHX A;  2IDL A;  1VOM A;  4BCA A;  1F9F A;  2MDA A;  3MHY A;  5GAD I;  4DV1 J;  1FKP A;  2W25 A;  3OR2 B;  3EZ5 A;  3BGR A;  2OP5 A;  4NXM F;  3LW5 C;  4V19 J;  5ETP A;  2ZZT A;  1IBM J;  2E1C A;  1QTN B;  1X4B A;  4YB7 A;  1A0O B;  3SQO P;  5F8G A;  1CQN A;  2ZH2 A;  1X9W A;  1SXL A;  1MU2 A;  2LYV A;  3CD5 A;  4ZMM A;  4ED6 A;  4ZPW R;  3HJF A;  3NKY A;  2AYM A;  2DCL A;  2EFQ A;  2LCW A;  1E33 P;  3R3T A;  1Q5Y A;  1K0T A;  4ITS A;  1RE1 B;  3MM9 A;  3CCL S;  2OML A;  2AHO B;  2IA0 A;  1E6Y A;  3LP1 A;  4FPI A;  1U1K A;  1VQ8 S;  1KH7 A;  2IYI A;  4U7U K;  1VHF A;  2CPD A;  3PKY A;  5DDR C;  4FNH A;  1TUG B;  4I6W A;  5D8H B;  1S1W B;  3DXB A;  2ZVS A;  5DQI A;  3C6T B;  2BEF A;  2Q6B A;  4GVB B;  4DV5 F;  3MF5 A;  5DZ7 A;  2KFZ A;  3MMC B;  3P5B P;  1D3W A;  1KSP A;  2Q79 A;  5A8W B;  1EQ0 A;  1YTY A;  4HI2 A;  2D3Z A;  3MED B;  1WHY A;  5J2N B;  4ZVH A;  3NKQ A;  4AYB D;  1QVF R;  4QU7 A;  2YWH A;  4Q44 A;  3CCS S;  4UQT A;  4ZIT A;  2G4B A;  2WB1 D;  5KFR A;  2XY7 A;  2RRA A;  4LFC F;  1MN9 A;  1U48 A;  2XWX A;  1DTT A;  2QA4 G;  4NPO A;  1VYA A;  2IMO A;  3EDQ B;  3PZP A;  2CIM A;  4EMD A;  1VBX A;  5ETR A;  5IC4 B;  1RAI B;  5I42 A;  5A76 A;  4H4M A;  1W2B R;  4NLX A;  3N01 A;  3PV8 A;  5L8R C;  3IWL A;  3FUY A;  3HHN B;  3ZZR A;  4DV0 F;  3QIP A;  4OV1 A;  2JJ4 D;  4RW7 A;  3ZTQ A;  4C3L A;  2RQC A;  4B3S J;  3ILL A;  2GO8 A;  4L75 A;  2H54 B;  5G0R B;  2VG5 A;  3WC0 A;  1NH7 A;  4Z2X A;  4CLU A;  3FFI B;  3LWL A;  3TX0 A;  1B0T A;  1K1S A;  3GG1 A;  4C97 A;  2AYB A;  5KFS A;  3TEH B;  1HBU A;  5KG7 A;  5HP1 A;  5D0E A;  5HVF A;  2ZH3 A;  1FTR A;  1ZA2 B;  5K9F A;  3D67 A;  4NI2 A;  5A8R A;  1WJ9 A;  2OD4 A;  3VAK A;  3BPD A;  4MY4 A;  1BUX A;  1FEE A;  1VRU B;  2UUW A;  2FGC A;  2K1R B;  3NCQ A;  1YRX A;  3MGJ A;  3UWT A;  1M5H A;  1V9O A;  4DR6 J;  2YKA A;  4FP9 A;  5IXU A;  4K4U A;  2ZH5 A;  3FCW A;  4PRF A;  2MSS A;  4FXV A;  1LKZ A;  2YBV A;  1NSA A;  2AX1 A;  3QO9 A;  4FYW B;  4ZPD A;  4BWJ A;  2M9K A;  2ABY A;  3ZTO A;  3DLG A;  4DDF A;  3V6D A;  3JS9 A;  3MR7 A;  1HBN B;  4PWW A;  3W7B A;  3W64 A;  4NCG A;  2QIF A;  2RRN A;  1EQM A;  2DH8 A;  2G0I A;  5BXI A;  5L1K A;  3V4I B;  3RRG A;  2UV8 G;  3LP0 B;  3OFG A;  4KO0 A;  4NYP A;  3PFE A;  3CMQ A;  3TYT A;  1UCN A;  1E6V A;  4UOF A;  4CNZ A;  3SBM A;  3TRG A;  4Q2M A;  3KHG A;  4MIB A;  1J5E J;  5CYJ A;  4DV6 F;  1HI0 P;  4URG A;  4EGL A;  1S76 D;  4B3O A;  2BE9 B;  2FJD B;  2HQF A;  2UV8 A;  2JL9 A;  2FLO A;  3BGL A;  3MEE B;  2XNR A;  3Q2S C;  1FKA F;  2C3P A;  3JSM B;  2NXU A;  1WOS A;  4DR4 J;  2IRU A;  1HYS A;  1TV6 B;  1KWM A;  2RRB A;  2L08 A;  1RT1 A;  4WWS A;  1U7L A;  2V8H A;  4KYZ A;  3TQE A;  3HSZ A;  5AE3 A;  3KJV A;  1O8B A;  1MWQ A;  3R8Y A;  2ZHB A;  1NKE A;  2GHW A;  2FVQ A;  4FNI A;  4OYO A;  3GG0 A;  5J1E B;  3CCU S;  3N5B A;  2H9Z A;  2XMV A;  3EZO A;  4KV8 B;  4OV6 A;  4WP8 A;  3OSN A;  4TXS A;  2JOQ A;  2DIT A;  3C6U A;  1N88 A;  4KV8 A;  3SFU A;  4ECU A;  4MYU A;  3L09 A;  4QYR A;  1R43 A;  5D4O A;  3C15 A;  1IWA A;  1N6Q A;  1R8P A;  5GMK a;  3CDA A;  2GGP B;  2Z2Y B;  3UQS A;  3BDF A;  2CRL A;  2VOD A;  4OL8 A;  4DU8 A;  3MMC A;  2W9B A;  2X1G A;  4I2Q B;  2V94 A;  1RAD B;  4USI A;  4J9O A;  2HKE A;  1ZM2 A;  2IRX A;  5F8H A;  4J9K A;  1ZTT A;  2GSO A;  3CTR A;  4WIQ A;  1EJ7 L;  4WFZ A;  1S5Z A;  1X8D A;  2OPQ A;  2EG1 A;  3C66 A;  2KT3 A;  3QNW B;  1PBU A;  1HBU B;  2HAF A;  5HP1 B;  4V19 X;  2UU9 J;  2JEJ A;  3FMW A;  2HRU A;  2FJB B;  2IFY A;  1RT6 B;  1SQG A;  4OYI A;  3M8P B;  4DU7 A;  4XO0 A;  3LAN A;  4NEY A;  5KFA A;  2VBZ A;  5HJY A;  1GXU A;  2Y1R I;  3HSG A;  4RW8 A;  2CJK A;  2QFI A;  2J7W A;  1MWZ A;  2AZ3 A;  2C2Z B;  3A13 A;  3RRK A;  4YR3 A;  1SHN A;  2HPU A;  2K3I A;  3R5J B;  1Y6V A;  3T01 A;  3AD8 C;  1FEH A;  1NU4 A;  1TK5 A;  4HDG A;  4D3G A;  1KN6 A;  2N3O A;  1GK8 A;  4Y0F A;  2Z8Q A;  1NO8 A;  1S6U A;  4LF2 A;  4USH A;  1U2C A;  5HMW A;  4LRC A;  1XNR J;  2EG2 A;  5HLF A;  1HNW F;  4NI2 B;  5A8R B;  4X66 F;  1RHM B;  4DUY J;  4RBU A;  2WSF C;  3M30 B;  4PYD A;  6AT1 B;  5A6W A;  4F0K A;  4QIG A;  5B0G A;  3H0P A;  3V5R A;  2W2N P;  3MEG A;  1GX6 A;  3OXL A;  2CPX A;  4ID5 B;  1HR0 J;  2R8K A;  4OX9 J;  1XJW B;  2P5V A;  2M88 A;  5EX3 A;  4HH0 A;  4TKT A;  2BX6 A;  4I64 A;  2GNK A;  1WD6 A;  4FZV A;  5LMN F;  4J91 A;  1R27 B;  3W2W A;  4MFB B;  1G1X A;  4WKR A;  2DJW A;  4EYH B;  4NLS A;  4USM A;  4MFB A;  2BE7 D;  1PJ5 A;  1TTH B;  2CWX A;  2H5J B;  3H4B A;  3TWZ A;  1NK7 A;  3WDO A;  3HPO A;  1YJR A;  1FRX A;  4IG0 A;  4ZVF A;  1KTV A;  1UJ5 A;  5GAG U;  2MMY A;  2WVC A;  3PY8 A;  4RPF A;  4JI0 F;  2ZNY A;  2O67 A;  1ELZ A;  2PN6 A;  1FNX H;  1ZAX A;  1DAX A;  1VDH A;  3DI6 B;  4NX9 A;  1VC5 A;  2VD3 A;  1APS A;  4NCA A;  1RT3 A;  1TL1 B;  1BD6 A;  1KVK A;  1K73 T;  2DXE A;  2HHV A;  1N5T A;  3J7Z T;  2W01 A;  1RWP B;  3W9J A;  2VQR A;  3OTC A;  1D8Z A;  1WF1 A;  3TA2 A;  3OVS A;  1L3K A;  4ANE A;  3M2R B;  5CAA A;  4ZP6 A;  3MR5 A;  3OW2 R;  3SYZ A;  4XAK A;  4KGZ B;  2GV1 A;  5A8K B;  1WDD A;  5IT4 A;  3J7Z 5;  4I56 A;  3W61 A;  3TAN A;  3R5C A;  2R8J A;  3GJQ B;  4GVL A;  3G6E S;  1GFW B;  2ZBQ A;  3CCE S;  3TZW A;  3POT B;  4LVN P;  4FBT A;  1WF0 A;  4UZC A;  3UW1 A;  1XR5 A;  1VIX A;  3DRS A;  2FD2 A;  3CUN A;  4YQW A;  5KFD A;  1RT7 B;  3M8W A;  4QWC A;  1RT6 A;  2QA2 A;  3KUH A;  5ITH A;  1TFW A;  1HQA A;  3GCW P;  5KT7 A;  5K14 B;  3KK3 A;  3T5K A;  4QR2 A;  1EP4 B;  2ACM A;  4AL7 A;  3CC7 S;  3FMB A;  3CB4 A;  1RAF B;  2WVD A;  3X3U A;  2V5H G;  4OLO A;  2B51 A;  4PZV A;  2GIR A;  3EPI A;  1XMQ J;  4LRE A;  4KGX B;  3CJK A;  3ET6 A;  1RKI A;  5JUM A;  2B4P A;  1RT4 A;  4DX6 A;  1URA A;  3SZZ A;  2YKN A;  1SI9 A;  4ZLJ A;  4CTA B;  4LF5 F;  2R2S A;  2MQL A;  2CZV C;  3IG1 B;  1I6J A;  2KYZ A;  1NDP A;  2RJZ A;  2R8G A;  3QZ7 A;  1M0S A;  4DR7 F;  1R8B A;  1XMB A;  4Z7C A;  1DZ5 A;  1CSJ A;  1GTH A;  3P8B B;  2VG6 A;  4CO4 A;  3MFH A;  2CQ3 A;  2JWN A;  1JLE B;  3D0H E;  3THV A;  4F2S A;  3DOM A;  5KG3 A;  1YBA A;  3TA0 A;  4ZHR B;  1VQO S;  1WHV A;  1S4F A;  1VLO A;  3WIU A;  1N8R T;  2HWI A;  3TZY A;  1HW9 A;  4IKA A;  2F8M A;  1NJX A;  3NKO A;  4KGV B;  4QR1 A;  4KBI A;  1JXL A;  3PYD A;  4ZPB A;  4DPW A;  4CLT A;  3BDP A;  1NBE B;  1R6Y A;  4LF7 J;  3MPY A;  3ZZT A;  2MYF A;  3HKZ D;  1T8E A;  4QZV B;  1SL0 A;  4F4K A;  3T3F A;  3MZI A;  3SCJ E;  5EWF A;  2CQ2 A;  3PW4 A;  4Q2L A;  3LOU A;  3Q24 A;  1RA6 A;  3V2U C;  4GC6 A;  3FCV A;  5HLF B;  4KY3 A;  5EHH A;  4RW6 A;  4DX7 A;  1TP7 A;  2HZC A;  4I6Y A;  4O3Q A;  5ETV A;  4O3R A;  4X62 J;  4PUO B;  3I96 A;  2W5V A;  2X98 A;  2OPP A;  3OHA A;  3AT1 B;  3GFH A;  3AY0 A;  1S1U B;  3BM7 A;  4DL2 A;  2CQG A;  2L9W A;  1S7H A;  2DXD A;  2RAQ A;  4IFY B;  3J81 U;  1S1U A;  1E2S P;  1FWL A;  1KH5 A;  4F02 A;  2FGO A;  3KHL A;  4N8O A;  4KT0 C;  4ZN1 A;  1T7P A;  3CCZ A;  2IFX A;  3HHL C;  2A10 A;  3FSI A;  1S97 A;  4EBC A;  2ZH8 A;  4RJV A;  2UVR A;  3FK4 A;  1RTD A;  3QFH A;  4D3H A;  5HI7 A;  1VC0 A;  3H42 A;  1VK3 A;  4ZJL A;  1FA0 A;  3HM9 A;  4P2S A;  1AFJ A;  3UR0 A;  4OZN A;  4C11 B;  4DFJ A;  2IM2 A;  3GCX P;  3NCP A;  4N56 A;  3T5L A;  4EZ9 A;  1JQG A;  2DR9 A;  5AJ9 A;  3E01 A;  1RHJ B;  1FE0 A;  5FDL B;  1RK8 A;  4JI8 J;  3PW7 A;  1NME B;  1PG5 B;  4RBT A;  3PW5 A;  1X31 C;  2N7C A;  4L3K A;  1QM9 A;  2CQD A;  2RVJ A;  3NOG A;  1TZ0 A;  2ASL A;  2HQI A;  2HQG A;  2X1B A;  3M05 A;  3QT6 A;  2ZE2 A;  2BRK A;  5EWG A;  2VG7 B;  3WAX A;  1TMJ A;  4CYU A;  5D4P A;  2ERR A;  4USV A;  2DGX A;  4ED5 A;  3A8E A;  2UUC J;  3JB9 k;  2NR0 A;  1VQY A;  1R8H A;  3HVW A;  4MKV A;  2XC9 A;  3OUY B;  3QGG A;  1NK8 A;  1HNV A;  2FJX A;  5ETO A;  1VQN S;  2D1G A;  1LFW A;  1OPI A;  1HNV B;  1WUU A;  1VK8 A;  4CNY A;  2BR0 A;  3IGV A;  2E7W A;  4NLT A;  2CDR B;  1TUW A;  3T1H J;  4FKX A;  1S6P B;  4A8W A;  4UTG A;  2JFK A;  3IAS 9;  1WOR A;  2MHN A;  1G3O A;  2VFV A;  4RW9 A;  2F65 A;  2RD5 C;  4QYZ J;  5GMD A;  4U9R A;  3MUR P;  1VBY A;  3NBP B;  1G6B A;  3US5 A;  2CWK A;  2W8D A;  5IT0 A;  1NB7 A;  2CZ4 A;  2HNY A;  1ICE B;  4O4G B;  4N5S A;  4OZL A;  5IM0 B;  2H48 B;  3I82 A;  1UFK A;  1JLC B;  4OJ1 A;  5J2Q B;  3LA0 A;  2FQQ B;  1H73 A;  1RU1 A;  1VFJ A;  3M8Y A;  4A48 A;  1IM4 A;  3IBF B;  1Y3K A;  2GAG C;  2AV5 A;  3KHR A;  1I1G A;  1NH8 A;  3CCR S;  3DU6 A;  3GLJ A;  3MCM A;  1HNZ J;  2CQ0 A;  2YKM B;  5SZT A;  1Y11 A;  1VRT B;  2XI2 A;  5JMN A;  1XNQ J;  1ANJ A;  5DO2 A;  2HQC A;  3PRD A;  3J81 j;  1G7C B;  3BRE A;  3HUL A;  4P72 A;  4JP8 A;  1T3O A;  2NCK L;  1E3C P;  3I87 A;  4QW8 A;  3G8Q A;  3IN5 A;  1SC4 B;  2KG0 A;  3F44 A;  2QLJ B;  3OJS A;  1U47 A;  2LXU A;  3V81 A;  4R8U A;  3GIR A;  4CM0 A;  3OFH A;  4ICL A;  2FY1 A;  3SSS A;  1V3Z A;  5KT3 A;  1NZA A;  3C16 B;  4JOU A;  8AT1 B;  2OKQ A;  4F2R A;  4AL5 A;  5BR8 J;  2KB2 A;  2NSB A;  4P7T A;  4YY3 J;  2HW3 A;  1H72 C;  1VQ4 S;  2KJW A;  4O3S A;  2F4V J;  4NLO A;  3E01 B;  5FDL A;  1LQ9 A;  4OYA A;  1UVL A;  5ETL A;  5IOL A;  3DRP A;  4EYI B;  2IJR A;  2FIU A;  2ZBP A;  4QWA A;  3QRR A;  1VJQ A;  3H2V E;  3O3L A;  1VIS A;  2DH7 A;  3M8Q B;  4GC7 A;  4PWD A;  1B7F A;  4M94 A;  4M5D A;  2XLI A;  1VQ6 S;  4PAA A;  3HFZ B;  2OHD A;  3IBC B;  1NK4 A;  1VRU A;  2VFU A;  4RNM A;  2RKI A;  1FE4 A;  1IKV A;  2LU2 A;  1RI7 A;  2ATC B;  3BEG B;  4ID8 A;  1X4H A;  4U96 A;  4BC9 A;  4JYA J;  2PT0 A;  4DV2 F;  5JJB A;  4NMX A;  3RAQ A;  2ATL A;  4GTW A;  3CJ5 A;  2W5W A;  1QE1 A;  1BMQ B;  3CC2 S;  1HNW J;  1AZS B;  2W9A A;  2ZH7 A;  2Q6C A;  2E7X A;  3AQP A;  4KSE B;  4DUY F;  2WOM B;  1JMT A;  1HQ2 A;  2DEJ A;  4J9N A;  3T1Y F;  5CYM B;  4DR7 J;  1SJ4 P;  4LSL A;  3Q3Q A;  3MMJ A;  1WC3 A;  2OEJ A;  3H25 A;  4O4R A;  5HVG A;  3J7Y I;  4CO5 A;  1SHQ A;  4P2X A;  3DMJ B;  2XY5 A;  1ARO P;  2AJ0 A;  1TL7 B;  1X5P A;  3KWM A;  3RAM A;  3TNV A;  1S79 A;  4AL6 A;  1M90 T;  2YKQ A;  3LGM A;  4NXN J;  2IUC A;  9ATC B;  3D6F B;  4O4G A;  5AXN A;  2WTF A;  2R7S A;  4UOC A;  3M2U A;  3ULH A;  2CQH A;  2MQP A;  4K4X A;  2Y1J A;  4YB5 A;  1OO0 B;  1DTQ B;  1U8S A;  2H5I B;  4ZG6 A;  3AQO A;  3UVJ A;  3H4D A;  1FCA A;  5LSR A;  4OZ0 A;  2IA6 A;  3THT A;  1MU2 B;  5DLW A;  2E1A A;  2MLY A;  1O0P A;  5F3Z A;  3U27 A;  3GYN A;  4LSN A;  2CZ9 A;  4ZVS B;  3SV4 A;  4IUF A;  3MM8 A;  2YNF B;  3JQM A;  4EZ6 A;  4F26 A;  4RW4 A;  1EHW A;  2R7W A;  3UD3 P;  5HAN A;  2ZHO A;  2YQ3 A;  1NLK L;  1M5P C;  4LF8 J;  2BJ1 A;  2E5G A;  5KOX A;  3O44 A;  4ZVP B;  3EYZ A;  1ZM9 A;  2HWT A;  1DTT B;  1PAU B;  1T9U A;  2PA3 A;  3OTD A;  1X4E A;  5CA5 A;  4QW9 A;  2DVI A;  3DDI A;  3C2P A;  2ZOM A;  1D8Y A;  4ED1 A;  2MTL A;  1JLC A;  3Q8R B;  3DGP A;  1SKS A;  1SC1 B;  3MUT P;  1YLX A;  2C2K B;  1J27 A;  1RAB B;  1TKZ B;  2B7C B;  4U6P A;  4DF4 A;  2XMU A;  3PYF A;  3AOB A;  4YME A;  2EK1 A;  4AT1 B;  5A8W A;  3G96 A;  2COL A;  4WTY A;  1IKX B;  2K2P A;  4Y34 A;  1T11 A;  2HFO A;  3BB5 A;  4ZA1 A;  1B70 B;  5HMZ A;  2MJN A;  3OR1 B;  2IIH A;  2HEK A;  1Q7Y T;  4ED7 A;  4QQB A;  4KKO A;  1KQS R;  2EFO A;  2CPY A;  1X7V A;  1HR0 F;  3QGP A;  2XEX A;  4IQX A;  1OSD A;  3FGV A;  2P9C A;  4HL9 A;  2OSQ A;  3U1L A;  4B3R J;  2EKY A;  2V67 A;  4E2F B;  3BBF A;  2QE5 A;  4F3M A;  3H20 A;  2RT3 A;  1TL3 B;  4TU9 A;  1EAY C;  1V5V A;  4ZPC A;  4F36 A;  2ALZ A;  3TW0 A;  2KTQ A;  5RUB A;  1MRO A;  5CD4 A;  1CEZ A;  3DLH A;  1UET A;  3BDH A;  1HBN A;  1OYD A;  2DGT A;  2JH3 A;  1NK0 A;  2MKK A;  4P6Q A;  3T6B A;  3D4J A;  5DJB A;  1CBK A;  2LEC A;  1LK7 A;  2NLW A;  1KKH A;  1S99 A;  4DFK A;  1VR6 A;  4R25 A;  1ULR A;  2PGC A;  2HBR B;  1RAH B;  1S1T B;  2YQ0 A;  2CKW A;  3DDN A;  1OYE A;  4C0O C;  1FRK A;  2WSE C;  5A2Q U;  4OI2 A;  4YFU A;  2K8G A;  2QZ8 A;  4F3Q A;  2WSC C;  3ZXW A;  2M3D A;  3HJV A;  3QT5 A;  4DX5 A;  2KYX A;  2XMT A;  1O51 A;  1WHW A;  3OHB A;  1N36 F;  3TJ9 A;  5E41 A;  2KFY A;  4WZQ A;  2J9D E;  4FYY B;  4ED4 A;  2HHT A;  3AA9 A;  1AXQ A;  3B4D A;  3HD1 A;  4C8N A;  3W2W B;  1WI6 A;  3KJN B;  2UXD J;  1Y7A A;  1TKX B;  5DDO C;  5CYM A;  1KON A;  1VIO A;  2LQB A;  4YUD A;  5D78 A;  2ADC A;  3SQG A;  2VBX A;  2AF6 A;  3CJ8 A;  4DI6 A;  4F4A A;  1X4F A;  3G2X A;  1Q8B A;  1U1P A;  3ZFV A;  1YK9 A;  3QMQ A;  3MAQ A;  2P9E A;  4DV1 F;  2DEI A;  2DHX A;  2N82 B;  1PIE A;  4QJV A;  1YI2 S;  3PJ9 A;  3R6G B;  1C0U A;  4WJB A;  3ED4 A;  2QT7 A;  2XHW A;  3OV7 A;  2DO4 A;  1YBU A;  3NLC A;  3VZH A;  2IRY A;  4I1T A;  4CXU A;  1J5O B;  1J5O A;  2LQ9 A;  4LSN B;  3MED A;  5IWA F;  5KFU A;  1V3R A;  1IR2 A;  2DKO B;  3NVL A;  1UW4 A;  1LWC A;  4BHQ A;  1JB0 C;  2DXF A;  4R5P A;  4RO0 A;  4J90 A;  2BW7 A;  1HBM A;  4X4S A;  3GV8 B;  4FYD A;  5A2Q Y;  1LW2 B;  2AEJ A;  2EFN A;  4HT7 A;  1PJ6 A;  1Q5V A;  4RLE A;  5E0O A;  3HP6 A;  1QAJ A;  1JWW A;  3GE9 A;  1GQE A;  2VFT A;  3HT3 A;  5CZX A;  2G9Y A;  1FO1 A;  1RUS A;  1VMB A;  2GJ2 A;  4C6A A;  1QAI A;  2RF2 B;  4CI0 B;  5EDW A;  2BXJ A;  1U26 A;  3IM8 A;  1QUV A;  2W5Q A;  3FBF A;  2OO4 A;  4YN3 B;  1N2K A;  2E7V A;  2YH1 A;  3UCU P;  4MK8 A;  5IV4 A;  2HVD A;  1FRH A;  2YWE A;  3CCT A;  2ZVI A;  3K8W A;  3ONQ A;  5C25 B;  7FD1 A;  1N5Y A;  2DR7 A;  2J6U A;  3CIZ A;  4LF6 F;  2OTJ S;  5C25 A;  2CPF A;  2VG6 B;  3X1L B;  3R5D A;  3F41 A;  3QID A;  1HBO B;  1K44 A;  2EFG A;  3THP A;  2BKO A;  2UUT A;  1AUD A;  3I6P A;  1JKH A;  3JYT B;  3WZ0 A;  1SKR A;  4O23 A;  4ZJO A;  3PAC A;  4CRJ A;  5DQH A;  4QWE A;  3GFX A;  3H5S A;  4JI4 F;  3M6U A;  1TV6 A;  2CNL B;  4UOR A;  5EGE A;  3NGS A;  2QLW A;  3B8H A;  1HQE A;  2RU9 A;  4NZ7 A;  1FX2 A;  1HWJ A;  5LJ5 Y;  3KHH A;  4FXD A;  3SQG B;  1HAR A;  5HAT A;  5DG9 A;  2JDJ A;  2I38 A;  3MM5 B;  3KLG A;  2EC2 A;  5KFL A;  5D0R A;  5B0B A;  1D09 B;  1E6V B;  1KBR A;  2PMZ D;  4R0E A;  5D0H A;  3BSN A;  3DLL Q;  3VAH A;  4WXW A;  5E7O B;  2BQR A;  3J7Y U;  3TUP A;  3OFF A;  5J2M A;  3PTW A;  3H5X A;  1SC6 A;  4C0B A;  4JV5 J;  2C42 A;  3W65 A;  2JLE A;  4HEA 9;  5B7W A;  2MGZ B;  2KVI A;  3J7A 1;  4OYB A;  1BWE A;  3FJ2 A;  1CJK B;  1WG5 A;  4PWU A;  3LH2 S;  4JV0 A;  3MR3 A;  3TG0 A;  5IQ6 A;  1QD1 A;  4MYT A;  1XMQ F;  1RT1 B;  2E5I A;  1R6V A;  1X4C A;  3M2R A;  1ELX A;  3GSD A;  4DFM A;  2YVS A;  4IQM A;  3R7B B;  4ER8 A;  4FVC A;  3BDG A;  4LF1 A;  1S6Q B;  2CXE A;  3G8T A;  1SBR A;  3H5U A;  5GAE U;  3A12 A;  1XBW A;  2JEG A;  2QL7 B;  3C6U B;  3ZO7 A;  3EWG A;  3FBE A;  5B0D A;  4B9M A;  4QCL A;  2HVH A;  3M8P A;  4QIE A;  4HAC A;  3AXM A;  1TR0 A;  4LBP A;  3U1N A;  2CNK B;  4I2P A;  1UTA A;  5CZV A;  3CF5 Q;  1JLQ A;  1Y5I B;  1M5O C;  2WON B;  2HHW A;  1RCX B;  3RYL A;  4OI1 A;  2F9D A;  3DOK A;  3TVZ A;  2VIH A;  1N33 J;  1YJV A;  2LXI A;  4USJ C;  1U1N A;  2IHR 1;  4N8N A;  5HBM A;  1ZZF A;  3IXQ A;  1YJ7 A;  5F3T A;  4M5G A;  4EO6 A;  4KAV A;  3MAH A;  2HHS A;  1U1L A;  3BSO A;  2E66 A;  3OTO J;  2BQ3 A;  3EGV A;  2UP1 A;  4ZLP A;  3FC9 A;  1T9X A;  4CO0 A;  4YHH J;  2DNH A;  3LAK A;  1OJ4 A;  2HVZ A;  4CLW A;  1N5Q A;  1RBA A;  5ADZ A;  1NAQ A;  4B3S F;  2J76 E;  2VV5 A;  1G4C A;  3MCO A;  2GSU A;  1RWV B;  2BDP A;  5M2P A;  4N77 A;  5INH A;  4O3O A;  3OQ2 A;  5DM6 Q;  4EBE A;  2FTR A;  1HHQ A;  1TKT A;  2YNH B;  3I0R A;  2LA6 A;  1YSJ A;  1Y00 A;  3UR3 C;  2YNH A;  4X64 F;  3P3D A;  4QWB A;  1JLA A;  3CJT A;  1NPK A;  1WEX A;  4M1K A;  2EKN A;  1BQN A;  2NYH A;  4CLL A;  3ENV A;  1CC7 A;  3KMS A;  4LMZ A;  1H2V Z;  4NA3 A;  4ZG7 A;  3TA1 A;  4EBD A;  5J2P A;  1P1T A;  4DSJ A;  3K2Y A;  4DR5 F;  2WBR A;  1IKW B;  3ZTP A;  4JI2 J;  3QRP A;  3BSC A;  1UZH A;  4ANC A;  1YRT A;  3DM2 B;  2B6A A;  4DG1 A;  4WP9 A;  3K59 A;  3RBD A;  2R7V A;  1C0T A;  4J5O A;  3M30 A;  4B02 A;  4DR2 F;  2KZZ A;  1SJQ A;  4ZVG A;  1NPP A;  4FYX B;  2W1B A;  3W62 A;  5F8M A;  4RR5 A;  1B0V A;  3CIM A;  4PG7 A;  3NAH A;  3UN3 A;  2AW0 A;  2DGS A;  2ZOG A;  1N2L A;  3I5A A;  4KAI A;  4ID5 A;  2QL5 B;  3IRX B;  3L4B C;  3WX4 A;  4PQU B;  4MHX A;  2FHK A;  3CWJ A;  5JXS A;  5HQM A;  2Y0B B;  3BN4 A;  3FSX A;  4P7V A;  4DR1 F;  3IGY B;  1Q0N A;  1HQE B;  1UFW A;  2ZBR A;  3AOA A;  1I94 J;  2NXN A;  3PJW A;  4LF8 F;  2WAQ D;  1LWE B;  2DNP A;  2OFH X;  4YDD B;  4KAY A;  1WOP A;  3P96 A;  3V6K A;  3PX6 A;  5B08 A;  1TL5 A;  2LU1 A;  4RUA A;  4OIX A;  2Z2M A;  3H8Y A;  3N5F A;  3V81 B;  1S7I A;  5CCL A;  2EW9 A;  2RDJ A;  1Q81 T;  4C11 A;  3UNG C;  1N32 F;  3B4M A;  4DXL A;  3B82 A;  2IDE A;  4Z7Y A;  1I5O B;  5KT5 A;  4J9Q A;  1SJ3 P;  3DFE A;  3QAT A;  3H40 A;  3DOK B;  3BKF A;  2CDQ A;  3M1V A;  4FXW A;  4J9V A;  1VQK S;  3WC2 A;  3Q2T C;  3O5T B;  2J9D A;  3IGZ B;  3PG9 A;  2CUY A;  1KOO A;  3T5H A;  4DSF A;  5D15 A;  4Q0B B;  5IT9 U;  1K7H A;  2GLQ A;  4PPD A;  2MHE A;  1P9Y A;  1S6Q A;  3R5A A;  3DLE B;  1PJ7 A;  3KDN A;  3MPU B;  4PPZ A;  2H5E A;  5LJ3 Y;  3K5M A;  3UCZ P;  1Y10 A;  3PDN A;  3IC1 A;  4UT4 A;  1RTD B;  3C46 A;  1FTC A;  4ECW A;  2J0W A;  5L9N A;  3NKM A;  2QLX A;  2BW2 A;  2PEB A;  1YJT A;  2EC0 A;  2A1B A;  3B5Q A;  3UDV A;  4A4J A;  1HPZ A;  2WOM A;  3E3X A;  3JSY A;  1DLO A;  3F73 A;  3PR4 A;  4W98 A;  1X9M A;  3M6X A;  4JI1 J;  2DR8 A;  1CUL A;  4IO9 Q;  3LF0 A;  3CJK B;  3B6B A;  5GME A;  4RZR A;  2AIR B;  2G0C A;  2RIJ A;  4F0H A;  3OTO F;  5EN1 A;  1NHV A;  4OHZ A;  3KKF A;  2K3K A;  1S72 S;  1P8G A;  2FY8 A;  3S01 A;  1U45 A;  1XN9 A;  4B9T A;  1RHQ B;  3GIJ A;  3CCM S;  1X5S A;  2FHJ D;  1ALH A;  2DO0 A;  2WBM A;  3I0R B;  3D6M B;  1U6F A;  3DRX A;  5HSP A;  4WYL A;  3ZZU A;  2PMH A;  1AUK A;  3TQ1 A;  3PJX A;  3GR0 A;  2LQ5 A;  2FVC A;  3MWB A;  5ETN A;  2XZD B;  1ZAV A;  2ROG A;  5J2P B;  4LQY A;  2XS5 A;  3DLJ A;  3T9Z A;  4I69 A;  4O0I A;  3DOL B;  2JVO A;  3E8O A;  4KTQ A;  3N6L A;  4EI2 A;  2POK A;  2B6A B;  2MZT A;  4V1A k;  3T5J A;  3DLB A;  2PE8 A;  3NP5 A;  1X5T A;  2V69 A;  2WRM A;  3DRR B;  1Q1K A;  1P9Q C;  3CJR A;  2OJ3 A;  2FC8 A;  4O44 A;  1N48 A;  4I6A A;  4B9L A;  4IO1 A;  4P52 A;  4UUW A;  4M63 A;  2YX7 A;  3OXF A;  2QSF A;  2R42 A;  3BGO P;  3UDE A;  4TU7 A;  2QMU B;  1VQ5 S;  4XTT A;  2HZV A;  1ZZN A;  3WAY A;  2YTC A;  4RWX A;  2KXF A;  3GON A;  4DV4 F;  2V0N A;  3UCG A;  2VPZ B;  1CJT A;  2A6M A;  4ZIV A;  4K4T A;  1Z2L A;  4OX7 A;  1VRT A;  4J9R A;  4JI5 J;  6FD1 A;  2DNK A;  2E1M C;  1LW0 B;  4ERD A;  2HND B;  4UW2 A;  3P49 B;  1LW0 A;  2CJA A;  3NMR A;  2AT1 B;  2D9P A;  2BVZ A;  3IP0 A;  3NGD A;  2WCX A;  1N36 J;  4ILL A;  5DDQ C;  2K1R A;  2V4J A;  3QGH A;  3O2I A;  2M4M A;  4L3N A;  3R9L A;  2B9X A;  2VOO A;  3KTQ A;  2ROE A;  4A47 A;  1FFS B;  3IR5 B;  4MMO A;  2UXD F;  2F63 A;  4IG3 A;  2GX8 A;  2A0F B;  4ALZ A;  2HYI B;  4AXI A;  2ILZ A;  3DLG B;  4WKY A;  3VAL A;  4ED3 A;  1EET A;  1KQG B;  1RWW B;  4B08 A;  4LSL B;  1RLC L;  4F25 A;  2RHQ B;  2FVP A;  2W8S A;  1TVR B;  2QC3 A;  4QR0 A;  4Y2A A;  1AT1 B;  3HZG A;  4K59 A;  2HHH J;  2EFV A;  1Q95 G;  2F8H A;  3B78 A;  4ZOS A;  5IQQ A;  1UWB A;  4OYP A;  4UUX A;  2R7T A;  3JAM Y;  1UWB B;  1VRQ C;  4JBC A;  4ED0 A;  2AGQ A;  2ZNZ A;  2I9S A;  2LDY A;  5LQQ A;  5C66 A;  3GJR B;  3PKM A;  3BGR B;  3CJ0 A;  3ITH A;  4DR2 J;  2XS2 A;  2RKI B;  3M2U B;  2GA3 A;  3BBC A;  3NGR A;  4NLP A;  4CO1 A;  4ZS6 A;  1YIJ S;  5EGH A;  4OJH A;  1URR A;  1JLF A;  1NB2 A;  3Q83 A;  1ZPV A;  3A3P B;  4H4O B;  3VCD A;  4DV3 F;  4WE1 B;  1FJC A;  3MM8 B;  1W7W A;  4DL0 C;  2XZT B;  2RQM A;  1UZD A;  3GIK A;  3C8Y A;  2XCA A;  3SZ2 A;  2ZUA A;  4ZLL A;  2Y8Y A;  1NXI A;  1X4D A;  3BDE A;  4IDK A;  4M8L A;  1DFD A;  1I51 B;  3FZB A;  2M8H A;  3DCA A;  1T94 A;  3L3C A;  4LIR A;  2VA2 A;  3C15 B;  2KM8 B;  1WG4 A;  3DRR A;  2DH9 A;  4NL5 A;  2H51 B;  5LM7 E;  4LBH A;  2M70 A;  4DCJ B;  4JI6 F;  5C5J A;  1JNZ B;  3O8W A;  4C48 A;  2CG8 A;  1F9H A;  3N6N A;  2BJ7 A;  3UN5 A;  2BOA A;  1IKY B;  1WAC A;  1URN A;  5DET A;  2ZJR Q;  2ZEJ A;  2XLJ A;  1JLB A;  1OWX A;  7AT1 B;  2VG5 B;  4OX8 A;  1TAU A;  3GFY A;  2PSZ A;  2PDA A;  1PCA A;  2VUG A;  4WFY A;  4XK8 C;  5BYR A;  5LL6 d;  3OD2 A;  2AJF E;  2YNF A;  8ATC B;  2ZM6 J;  2G9O A;  1L3U A;  3BV8 A;  3SSR A;  2NRE A;  2DNM A;  3JAM U;  2MKI A;  4KKO B;  4C98 A;  1UFL A;  2Z30 B;  1RDR A;  3H90 A;  1PO6 A;  2B8Q A;  1J5E F;  4KGK A;  4RU2 A;  2V8D A;  2GW8 A;  3AOC A;  3QFW A;  2A2D A;  3K7R A;  4FVM A;  5KG0 A;  2VQF F;  2QMX A;  4BDP A;  1K0V A;  3GYG A;  3VAI A;  5ETS A;  4ICL B;  1XEZ A;  2VDI A;  3I0S A;  1TKZ A;  1U0H B;  4J9M A;  4IYQ A;  3BN7 A;  2Z2Z A;  4YP3 A;  1BHN A;  3LTO A;  4LFA J;  2NUH A;  3MMA B;  2V2Z A;  5J1N A;  1S49 A;  5DDP C;  5T41 A;  1D9A A;  3CCV S;  5KG4 A;  2AEM A;  2A6O A;  2BJ3 A;  3ADA C;  2ZKT A;  4TVA B;  1EAR A;  3A1Y G;  3JTP A;  5H1S V;  1S0V A;  2NXE A;  2MQQ A;  1FT8 A;  1RTH B;  4ZIW A;  2W7P A;  2HBZ B;  2LEB A;  3VWS A;  4RL1 A;  3ITH B;  3LAL A;  2AGO A;  3PXG a;  3RW6 A;  2XR9 A;  1ZOT A;  3U7J A;  3PYE A;  1S12 A;  2JSX A;  1YIT S;  1C2P A;  1UVN A;  1TL3 A;  3HSJ A;  5D3G B;  2X1F A;  4U8Y A;  5CCM A;  4CH0 S;  2Z2L A;  5GOV A;  3MM9 B;  3NCR A;  2XBP A;  1TUV A;  2RDD A;  4ATN A;  2ADB A;  3MM5 A;  3D68 A;  2L9D A;  3HMJ G;  2C3O A;  3DRY A;  1FER A;  2HHH F;  4LRF A;  4X4N A;  5FLX U;  1SQE A;  4KJG A;  1DUR A;  1ALJ A;  1EW9 A;  2GVD A;  4OZ3 A;  4EU0 A;  1NKB A;  4HKQ A;  3T1H F;  5KG6 A;  2W2Q P;  2ILY A;  4CQ1 A;  5GAH I;  4FF1 A;  2HFN A;  2RDI A;  3SXL A;  4M5H A;  4DPO A;  4WBF A;  2MQO A;  1CJK A;  4DV2 J;  1UPP A;  3CGI A;  4OI6 A;  1PYO B;  2QGF B;  3E2E A;  3NS6 A;  2L48 A;  4DEZ A;  5DLT A;  3KLE A;  2J7K A;  4C7Q A;  1FK9 A;  1S57 A;  1S10 A;  4DJB A;  4DV3 J;  4C8O A;  4LRB A;  5K4P A;  3QT7 A;  3PRV A;  4OI0 A;  1KP6 A;  1WC4 A;  2LVW A;  3KJV B;  1KHK A;  2XG8 A;  1VC6 A;  1V6H A;  1R31 A;  5CYQ A;  4CXK A;  4LQ3 A;  2VON A;  4LR2 A;  1F5B A;  2YPZ A;  5CYQ B;  1CLF A;  3KFW X;  2ZD1 A;  3AJ1 A;  4DV7 F;  1ZAW A;  4OYZ A;  1FHT A;  5CAB A;  4DQR A;  3MOJ B;  2R2U A;  4AND A;  3WBH A;  4LSZ B;  4EK2 A;  2G1H A;  3HHE A;  1JIH A;  4DBQ A;  3IM9 A;  4E8U A;  4WK3 A;  3MM7 A;  4JI2 F;  3JTO A;  4BWM A;  5F8J A;  4L6V 3;  4ZN3 A;  5HO4 A;  3V6H A;  5A0Y B;  3AB4 B;  3FEX B;  4USU A;  5G0R A;  1T9Y A;  1IJF B;  2EBG A;  2MEW A;  3GFZ A;  1N5Y B;  3MK1 A;  2E1R A;  3HD2 A;  5SUH A;  2ZM6 F;  3RBE A;  5FLX Y;  4K0K F;  1S9E B;  5LSL A;  1SIZ A;  4HVZ A;  2JC1 A;  4CLF A;  1EZZ B;  4QIV A;  3BQ0 A;  2VB6 A;  1KLM A;  1SPB P;  4ES3 A;  5C7P A;  2OGU A;  3QBC A;  2IBK A;  5HQ8 A;  1A9N B;  3CNQ P;  3R2C J;  4ZCI A;  4X64 J;  2V6A A;  3NWR A;  3A8K A;  3R27 A;  4OYW A;  4FS2 A;  4CWB A;  5LXR A;  1YBT A;  2LMI A;  3FDS A;  2F9J A;  4I68 A;  4CLS A;  2ZH1 A;  1KD1 T;  3SMZ A;  4ZCL A;  4G3I A;  2Z58 B;  1UVJ A;  4IRK A;  5KG2 A;  4ZGA A;  4AXJ A;  3UDC A;  4I7F A;  4OFZ A;  3L7U A;  4RX6 A;  5LMU J;  5K8P A;  3TAQ A;  1KRP A;  1IBL J;  2D74 B;  4I7F B;  3RGI A;  4GRS A;  4K4Y A;  2V63 A;  2XZW A;  3MAA A;  4X4V A;  4NWB A;  3L7P A;  2IJF A;  3ENQ A;  3U1M A;  2RH6 A;  4NWJ A;  1NSP A;  4K8R A;  4QPT A;  2XY6 A;  5E3A A;  4WU2 A;  1GMW D;  3RZA A;  3VZI A;  5IZH A;  4ECQ A;  5L1I A;  3ZNU A;  4GKK J;  2QYC A;  2VKR A;  4C3M A;  4DQQ A;  5L9X A;  1FDN A;  3D1H A;  2W2O P;  5G4D A;  1R0B G;  2W2M P;  4HI1 A;  5KG5 A;  4QIF A;  3BJY A;  4KJD A;  5IJQ A;  1TQL A;  1PGZ A;  2UXC F;  4URS A;  4IFV B;  2UXB J;  5B0F A;  3N79 A;  2LKZ A;  2ZJQ Q;  2E9R X;  2W4P A;  4IFV A;  2ZUG A;  3UD5 A;  4O3P A;  2R7R A;  2VL1 A;  2DTJ A;  2AJQ A;  3HFV A;  2MKY A;  3W60 A;  1JLQ B;  4WP3 A;  1NM2 A;  5KFH A;  2FLL A;  2VQF J;  4NML A;  2FC9 A;  2PII A;  1Q7L B;  4DUZ F;  4JI1 F;  1HD1 A;  1AJC A;  2I1R A;  1U2R A;  2D1C A;  2FPH X;  3FEZ A;  5HVH A;  1WKK A;  2V8V A;  2KXN B;  4UOG A;  2DPI A;  2E1P A;  2RH3 A;  3MM6 B;  4DCP B;  1B8J A;  2BAN B;  3FCH A;  2N4D A;  4JI6 J;  2PC6 A;  1BQM B;  1EI6 A;  1HBM B;  1UP1 A;  3DYC A;  1HWL A;  5B0A A;  1LWC B;  4N47 A;  2X51 A;  2B7B B;  1REV A;  4DPT A;  1T9T A;  1HJK A;  2VHG A;  4X4Q A;  1VLY A;  5BJR A;  3PHT A;  4HAC B;  3Q89 A;  4ZLN A;  2QA1 A;  1JLE A;  4ZVE A;  4Y00 A;  1HWI A;  3V6J A;  3IWN C;  3QWP A;  4B3T J;  1URB A;  1RKJ A;  4NXN F;  4GKJ F;  1TK0 A;  1IKW A;  3ICL A;  4PYA A;  1OY8 A;  4C8Y A;  1GH8 A;  3Q8S B;  3M9M B;  2YKN B;  1VQP S;  1HA1 A;  1S0O A;  3H98 A;  1SC3 B;  5KFI A;  2WVF A;  3PRB A;  2XYG B;  4JB8 B;  3VGS A;  3JSR A;  3E51 A;  4PKD B;  5E5N A;  4RKU C;  4DHV A;  1U25 A;  3UDL A;  2R8H A;  3VAJ A;  2VQE F;  2QN6 B;  5J2M B;  3IAM 9;  2KHD A;  5J2Q A;  2P2C B;  2RQ4 A;  3JQK A;  1JKH B;  3JYT A;  4YEA A;  1U49 A;  2XLK A;  1HNZ F;  1HBO A;  4FDJ A;  1NKC A;  3M6W A;  5H9E K;  3H5Y A;  2HLU A;  3HVT A;  3K8V A;  1IN0 A;  2HUR A;  1Z2Z A;  1KC8 T;  2W9C B;  2YX4 A;  3RU0 A;  5B0E A;  4F67 A;  4HDH A;  4X2B A;  4KFB A;  2F5G A;  2RS8 A;  3S1T A;  4P9S A;  2D7S A;  1U09 A;  2KHC A;  2IVY A;  3S7R A;  3SZY A;  2NSC A;  4UF4 A;  1S1V B;  3KLI B;  2VZ9 A;  4LF9 J;  4K4V A;  1RHK B;  4GTY A;  4YY3 F;  5HRO B;  2HHU A;  4RW6 B;  1BQX A;  3W5Z A;  2G2Z A;  3MEK A;  4FYV B;  3HZE A;  5F0U A;  1K47 A;  5LSO A;  1SJ1 A;  1VS3 A;  3CT9 A;  1WNE A;  3IRX A;  3OVB A;  3ETO A;  2B4U A;  5GAH U;  4Y6I A;  5LMN J;  4LFC J;  1RU2 A;  2CJQ A;  2J5A A;  1R0C B;  4XIU A;  4NE9 C;  4YS2 A;  5K8O A;  1FES A;  3TOQ A;  1BQM A;  1KFD A;  3DC2 A;  3GTY X;  2GS8 A;  1DQ8 A;  3RRH A;  3TZX A;  3TVK A;  4ZVO B;  3DKD A;  4XDD A;  4N7T A;  3RB0 A;  1REV B;  5TJ3 A;  4WFN Q;  3M9N B;  2WHO A;  3OSP A;  2Q66 A;  2E44 A;  1WWH A;  2GQ2 A;  5LRM A;  2V9W A;  2R7X A;  2MQN A;  5F41 A;  2WON A;  4RU9 A;  2HGM A;  2DNL A;  1L5U A;  1KHV A;  4IG3 B;  1JLA B;  1N5S A;  2VBW A;  5B09 A;  3WAV A;  2YH0 A;  4W92 B;  1DQA A;  2J9E A;  1GXT A;  1UPM B;  2DHA A;  1NK9 A;  2UUB F;  3CPW R;  1UL3 A;  1KQF B;  1GXL A;  1U2F A;  2BKN A;  2F40 A;  2PEH A;  2OEM A;  1RJJ A;  2BYC A;  2HS4 A;  2M5Y A;  3ET6 B;  1HNI B;  4L76 A;  2ZE2 B;  4CH1 A;  2A2C A;  2HK3 A;  1ZTW A;  5GAD U;  2M8D B;  4DR6 F;  3AH6 A;  2OEK A;  3Q8U A;  3V4M A;  2C28 A;  1NJZ A;  5LOQ A;  1Q78 A;  3HHL A;  4MJK A;  5E33 A;  2HVE A;  1U0S A;  3GJS B;  1QSS A;  1FKO B;  4MKY A;  1A6L A;  2WW4 A;  2JRS A;  3WAW A;  1RT5 B;  1C1B A;  2ACY A;  2D3U A;  3DOM B;  1X4G A;  1HIY A;  5CQG A;  3TVY A;  2V2K A;  4I67 A;  4ETZ A;  1DTQ A;  2SXL A;  2K7J A;  2IVF B;  4N41 A;  1KOH A;  5FJ4 A;  4RNH A;  1Q4R A;  2KJV A;  2KN4 A;  3WIV A;  4DFP A;  1FDB A;  1U1Q A;  2FZC B;  2HAI A;  2BE2 A;  2OPR B;  2YNI B;  1H74 A;  4OJG A;  2W5T A;  1UEU A;  3BS9 A;  3BO2 A;  1LV5 A;  4GO5 X;  1ZH5 A;  1ZA1 B;  1OQ3 A;  3K57 A;  5E3P A;  4CP5 A;  4DG1 B;  1KHJ A;  2Y1L B;  1O5J A;  2C2M B;  3ILI A;  2DHS A;  3PFO A;  5C24 B;  3DU5 A;  1WDT A;  2YWK A;  4NYZ A;  3PW0 A;  1HLW A;  3G9C A;  5EGY A;  4TY9 A;  3GJT B;  1RQ0 A;  4G1Q B;  1F9E B;  1WC0 A;  2HQ3 A;  3TUI C;  4ZCM A;  3T02 A;  4PUO A;  1SVD A;  3BO3 A;  2MB0 B;  1M1G A;  2DNQ A;  1N34 F;  4NCB A;  5D4N A;  1IKY A;  1OIA A;  2N3L A;  4X4R A;  2APO A;  4DV7 J;  2E9Z A;  4DL3 A;  4DUZ J;  3DGV A;  2KXH A;  2BOP A;  2FJV A;  1HDH A;  1XMO F;  1U8W A;  1B99 A;  2HS3 A;  2Z56 B;  3QJL A;  2RNE A;  3Q8Q B;  4DLE A;  1EW8 A;  5AJ3 F;  1GMU A;  3EM1 A;  5KG1 A;  4J37 A;  3KLF B;  2VA3 A;  1H0H B;  2H3E B;  2BV3 A;  2QLF B;  2YKM A;  4QIW D;  4LF7 F;  4PWD B;  1PSD A;  1UKU A;  4R0J A;  2V8P A;  1LWE A;  4NOH A;  5H9F K;  5F8N A;  4URQ U;  3CW2 C;  2J7U A;  3HXM A;  3K58 A;  4G65 A;  4B56 A;  1ZET A;  5LRN A;  2MJU A;  1PYT A;  2LLZ A;  3I0S B;  3MTJ A;  1FFG B;  2K06 A;  2B8P A;  3VGV A;  3K5N A;  1LWF B;  1DBD A;  3JQJ A;  2V2V A;  3C16 A;  5IWA J;  3D6H B;  1RWM B;  3M8Z A;  3TJ8 A;  3RR7 A;  2CPJ A;  2XMM A;  2YWF A;  5I3P A;  4K0K J;  2Q43 A;  2ZDP A;  2GHV C;  2OUG A;  4OZ2 A;  3CVK A;  2CVE A;  4CYU B;  3MK2 A;  1VI7 A;  3DRP B;  4QYZ K;  2IBO A;  4DOZ A;  4IH5 A;  1F60 B;  2V8G A;  2RML A;  5U47 A;  2JLG A;  4ILM A;  5A6P A;  1S9G B;  1WTB A;  1MSW D;  4N76 A;  1KS2 A;  4FPR A;  2RB7 A;  1IM6 A;  1XER A;  1JLF B;  3OR2 A;  2LA4 A;  2JNJ A;  4M5K A;  4RBV A;  1IBC B;  4OHV A;  4PQA A;  2XQC A;  4F50 A;  3FRY A;  4KH1 B;  1N5V A;  3VGT A;  3G4S S;  2R2R A;  2CQ1 A;  2PFF B;  1SV5 B;  1ZS6 A;  2FDN A;  3MD1 A;  4L73 A;  4NA2 A;  1EW2 A;  1FXL A;  1ZED A;  3MUM P;  2YNI A;  2CQB A;  3EXC X;  1IBL F;  3MPD A;  1UW9 A;  2NXC A;  1RAA B;  3BGF A;  3DOL A;  3N4W A;  3NWG A;  5KOW A;  3W63 A;  3IRW P;  3K5L A;  4DR3 J;  2IM1 A;  1Q8L A;  3KG0 A;  3LQV A;  3GYX B;  2YWW A;  4USW A;  4OX9 F;  2B4O A;  4TLR A;  2FYX A;  4J9L A;  1JX4 A;  2ZKU A;  1AW0 A;  4BC7 A;  2DBB A;  2H65 B;  2XYP B;  3LP2 B;  4UST A;  2IJN A;  5L46 A;  9RUB A;  1IR1 A;  4DZD A;  2L3M A;  3UI3 A;  2VOP A;  4B9U A;  3DGP B;  3GB0 A;  5KFW A;  1N4L A;  1YG0 A;  2BJD A;  5F9L A;  5L0K A;  2QO3 A;  1JLB B;  1NEE A;  2CYY A;  3RBX A;  3VQT A;  2OH2 A;  2V34 A;  5D6G A;  4JI7 J;  4JI3 J;  1Z1Z A;  2RE1 A;  1HWK A;  5HMX A;  3P45 B;  1H2T Z;  1XR7 A;  5DZ6 A;  1K1Q A;  2G2O A;  1HQU B;  2UXB F;  3SSQ A;  1IVZ A;  1VBZ A;  3P6Y C;  1D9F A;  4FF3 A;  5L0E A;  5GRR A;  2BM0 A;  1ACM B;  2HGN A;  4Q45 A;  2YY3 A;  1QAY A;  1S77 D;  5IJS A;  2HLT A;  1NPR A;  5C24 A;  1ANI A;  4WXO A;  1YDL A;  1WOO A;  3FRZ A;  2JHE A;  3I5B A;  2P6S A;  1B4S A;  3CJQ A;  1C1C A;  2DIS A;  3CC4 S;  3N28 A;  1JXV A;  1IQT A;  5K20 B;  3LUY A;  1H98 A;  1LWF A;  4J7C A;  2IC3 B;  3D66 A;  5D4L A;  1PAE X;  4TLQ A;  4ZVQ B;  4ECT A;  3GSI A;  4LF9 F;  2I5J A;  3DHW C;  3W9H A;  2KT2 A;  3ZZ0 A;  3C3L A;  1XNR F;  3EGN A;  2BMB A;  3H59 A;  4K7Q A;  4CZC A;  4X62 F;  4YR0 A;  1U6B A;  1CS4 A;  4MK9 A;  3KK1 B;  3OR1 A;  1RT2 B;  1F2H A;  2HRY A;  3FFI A;  1RTH A;  2HND A;  2C22 A;  5L38 A;  1AA1 B;  2VAS A;  3GP9 A;  3S6E A;  1HFE L;  5AE1 A;  2XSF A;  3A52 A;  3Q86 A;  3W66 A;  4PAB A;  1FXR A;  2GCF A;  1M1H A;  3W8P A;  1S9G A;  2XMK A;  3PIP Q;  1R0A B;  1RGV A;  2HIQ A;  4ELV A;  4KHP F;  3J81 Y;  1RSC A;  3EVO A;  2V4R A;  3KMQ A;  4WZM A;  4PG6 A;  4RUH A;  1D9D A;  2GSN A;  3WX8 A;  4DSL A;  4WII A;  3PCO B;  4DPX A;  4H4O A;  3DYA A;  3EVM A;  5KFC A;  1EET B;  4ZDN A;  3PR5 B;  4FKY A;  2YNG A;  1XWL A;  2MZJ A;  3HDS A;  2C3Y A;  2Z4P A;  4C8K A;  1RAJ A;  2GA7 A;  4OZJ A;  4CLK A;  1ALK A;  4NLR A;  1EX8 A;  3K89 A;  4AUK A;  2OTL S;  1N52 B;  4IDK B;  3R7S B;  3S8S A;  3AJ2 A;  4OZ5 A;  4BBY A;  4HLB A;  2M7S A;  1RWX B;  1O6X A;  2MXY A;  4Z37 A;  1E6Y B;  5K8M A;  4XPE A;  5JVG Q;  4ECY A;  4HYK A;  2Y9H A;  3T41 A;  2P6T A;  2EI5 A;  1RXO B;  1EKS A;  3T1A A;  1S6O A;  3DXS X;  6FDR A;  1CVJ A;  4MIV A;  4S0M A;  3BZQ A;  1DY3 A;  4GTX A;  2O66 A;  3ZZZ A;  1Q8K A;  2VPY B;  4JYA F;  2AMC B;  1DJ0 A;  2J8S A;  1O99 A;  1NRK A;  2DGU A;  4ECS A;  1F3F A;  2A18 A;  1EJJ A;  2VDH A;  5C42 B;  1SV5 A;  1L3T A;  3OTB A;  4K4S A;  1RYR A;  4Y28 C;  4NLU A;  5C42 A;  3IMQ J;  3AA8 A;  4DCO B;  3HVR A;  1SL1 A;  2BRL A;  3AXK A;  3AD7 C;  3MEC A;  2DY9 A;  2B43 A;  4P2M A;  5D0G A;  3NEK A;  3KK2 A;  5GAG I;  5BYS A;  4EWT A;  2RIL A;  2QFJ A;  4UOH A;  2WVB A;  3K5O A;  1RAO A;  4QWD A;  5ETM A;  2G2Y A;  5AXL A;  3HCX A;  2RUG A;  1UAW A;  4OI3 A;  1WI8 A;  4C0H A;  3QZ8 A;  1WEL A;  4ZVT B;  2BKP A;  1FJG J;  1MMD A;  1Y4Z B;  5FD1 A;  3RW7 A;  5L1L A;  4JV1 A;  4PG8 A;  3MFI A;  3PX0 A;  2XGQ A;  1FD2 A;  3LWM A;  1XQI A;  1R8A A;  4I2Q A;  4M5N A;  2RS2 A;  3FBB A;  3I4H X;  2MQM A;  2GGP A;  2GMJ A;  3HHD A;  1NSQ A;  3RBZ A;  4K4W A;  1F5C A;  3R6L B;  2M0G B;  3M32 A;  3MM6 A;  5HK4 A;  2HRT A;  1FWK A;  4WCE Q;  1LOU A;  4ZPA A;  1M5V C;  1UVM A;  2NQP A;  3B54 A;  1KH4 A;  1RLD A;  1ELO A;  4ENO A;  1TAQ A;  3UO0 A;  2XMJ A;  4J9P A;  3LGH A;  3SV3 A;  3BH7 B;  4YR1 A;  3NKP A;  1XK8 A;  2ZD1 B;  4CLP A;  3BQ1 A;  1RB0 A;  1S1X A;  1WSR A;  1RWK B;  5AT1 B;  2VFR A;  5IC6 B;  3SDE B;  3U02 A;  3P4U B;  2HNZ A;  1GTE A;  1DRZ A;  1QSY A;  2MY7 A;  3W2V A;  3SEO A;  3BKU A;  4QAX A;  2RF2 A;  1N56 A;  1GX5 A;  3DYA B;  3MM7 B;  3BPS P;  2CPE A;  4QPX A;  5HMY A;  2XO6 A;  1MRO B;  4AE5 A;  3FSY A;  4DZ6 A;  3HSD A;  4ETX A;  2DR5 A;  3IS9 B;  4GKK F;  1G2E A;  4P73 A;  4LRA A;  4LJM A;  3OVA A;  3E2D A;  1U6Z A;  3PHE A;  3RJM B;  4F4Y A;  1OY9 A;  1P49 A;  2C1E B;  1SJR A;  1Y7P A;  3EE3 A;  2BJE A;  3SIP B;  1ITP A;  4TU8 A;  2WVE A;  1R7I A;  3G6X A;  3KUG A;  3MEG B;  4X65 F;  1RAG B;  2MLZ A;  2OPS A;  3MAA B;  4PXC A;  2MKC A;  2ZFH A;  3MEE A;  3QAE A;  3QSI A;  4B3O B;  2DHG A;  2KU7 A;  3ENW A;  1YHQ S;  4H4K C;  1AFI A;  4NLY A;  4BLG A;  3TZZ A;  3AFG A;  3C14 A;  2CJB A;  2Z57 B;  2YNG B;  1CJU A;  4A8X A;  2IPO B;  3BQ2 A;  1QY7 A;  2OEL A;  4I0W A;  2W9C A;  1QSL A;  5D3G A;  1YRU A;  3CDE A;  1CPZ A;  2UVV A;  4DF8 A;  1AJD A;  2KT5 A;  2Z0G A;  3V4I A;  2DNR A;  1EB0 A;  4B9V A;  4DQP A;  3IO1 A;  2I0X A;  2LP4 A;  5J1E A;  2E5L J;  3HO1 A;  1UMJ A;  5KT2 A;  4KQZ A;  1B64 A;  1OY6 A;  1KQK A;  3NKR A;  1RHR B;  3A3N B;  2KH9 A;  2ZWO A;  3I4P A;  4EUV A;  3CJ4 A;  4P2F A;  2UVW A;  2EXU A;  5L39 A;  3WQP A;  1N6Q B;  5I4M A;  2CJY B;  3DDK A;  2E9T A;  4DLG A;  1S1W A;  1AJB A;  2E5J A;  1H2U X;  1QDU B;  1FK9 B;  1T9V A;  2I8E A;  2LEA A;  4LT6 A;  2MGZ A;  1M5K C;  3ILJ A;  2OPQ B;  3JTN A;  4ZK7 M;  3RB4 A;  1N0V C;  1X5O A;  1SUQ A;  2GC8 A;  1GAO A;  2GZO A;  4L72 B;  1S0N A;  1FXD A;  4KHR A;  1HNX J;  3IGN A;  3HF5 A;  4YR2 A;  1U1M A;  1S4E A;  1X4A A;  2W7O A;  1EIY B;  2H4Y B;  1SB6 A;  2OAU A;  3TP2 A;  5DG8 A;  1MG7 A;  3UNY A;  1P27 B;  4U95 A;  4JI7 F;  1NJI T;  2F4V F;  4LRD A;  3D3B J;  4NLG A;  3CUL A;  3BYR A;  1SIW B;  2B9E A;  2W2P P;  8RUC A;  4OI4 A;  3G86 A;  3AB2 B;  1JK9 B;  1M5S A;  1GEH A;  1ZM3 A;  3GZ7 A;  3NY0 A;  4M5I A;  5I42 B;  4DR4 F;  4QU6 A;  5MLC V;  4FDI A;  3NNH A;  1V5I B;  1BGX T;  3DPC A;  2O1P A;  3Q8V A;  2YKP A;  4HHU A;  4ES1 A;  2CPZ A;  3NXZ A;  2BZ2 A;  2FHO B;  1W25 A;  5HAO A;  3VQS A;  1X9S A;  4DSI A;  2KFN A;  1ELY A;  1VCT A;  2QEX S;  4JV5 F;  4H54 A;  1UA0 A;  1IR0 A;  5L1J A;  1NHK L;  2CQI A;  3HHK A;  1GNK A;  1VHI A;  1S59 A;  4K5R A;  1S1X B;  3D9B A;  1K9M T;  1KLM B;  3F0N A;  1N32 J;  3ZZY A;  1IUJ A;  2BAC A;  2V9K A;  4QBU A;  2VFS A;  2V4Q A;  2ZWP A;  3AAW B;  1XMO J;  3W5Y A;  1HI1 A;  2ZC4 A;  3GV7 B;  1B0P A;  1SH0 A;  2QSW A;  3HVT B;  4WPA A;  3MCS A;  3BBB A;  4U67 Q;  3V6D B;  4F4X A;  3M9O B;  4F04 B;  4EEY A;  2MKJ A;  4Y2K A;  2NS1 B;  4MIW A;  2MQ8 A;  2BAB A;  2DYA A;  2NPF A;  3MR2 A;  2X3G A;  1LXN A;  3ZZP A;  2N4C A;  2XM3 A;  4LF6 J;  5IV3 A;  1YWX A;  4NA1 A;  1NHU A;  5HJX A;  2ZOF A;  2VC1 A;  3KLH B;  2PI4 A;  2DGO A;  3RTV A;  1NJW A;  4UY8 5;  2CQ4 A;  3K17 A;  3O1L A;  1VJW A;  2BBE A;  1JNR B;  4Y65 A;  2FHJ A;  2X1A A;  3NL0 A;  4PQU A;  4G1I A;  3M4X A;  4MKB A;  2ASD A;  3UE2 A;  2CPI A;  2KO1 A;  4KHM A;  2XMA A;  2GIF A;  3EMT A;  3D6T B;  3OJU A;  2HFS A;  5ETT A;  2QZU A;  5DG7 A;  2IM0 A;  2FVR A;  2V4J B;  3FEY B;  3MDF A;  4PXB A;  2AKW B;  1FRJ A;  2QLB B;  3KLI A;  1ZYQ A;  3HT0 A;  1T02 A;  4RUB A;  2ZH4 A;  1RBO B;  4TQS A;  4CIO A;  1IBK F;  2PI5 A;  4Y2M A;  2J0S D;  5E3R A;  1FSU A;  1TEL A;  2Y8W A;  2AEF A;  1F2G A;  2OD6 A;  3O6Q A;  1WKJ A;  4M5L A;  1RCO B;  3OL6 A;  2VBY A;  4HR2 A;  3SFG A;  5KT6 A;  4Q43 A;  2FLN A;  1F3V A;  1NDC A;  1FX4 A;  4USK A;  2JEF A;  4X4U A;  2FUG 9;  4P71 A;  2J0X A;  3HHL B;  4H4K A;  4C8Z A;  4NRT A;  1TL4 A;  3CDW A;  1HKA A;  4KHP J;  2CQC A;  2KVQ E;  2QJ3 A;  2YQ1 A;  4Q7A A;  1WG1 A;  3GQC A;  2HK2 A;  2Y1I A;  3SI8 A;  1U4B A;  1BXN A;  1KVI A;  1NZ8 A;  1P1L A;  3M2V A;  3PYG A;  2L41 A;  3IDD A;  3CO9 A;  3M2V B;  5D77 A;  5KFV A;  1R3N A;  4UZB A;  1WEY A;  1U1O A;  3ZTS A;  1H7W A;  3MPV A;  1CG2 A;  4PXE A;  4DS5 A;  4GMK A;  3MUV P;  4IOA Q;  4LQ9 A;  1FWP A;  3PO5 A;  1V3S A;  4X4O A;  4B9N A;  3DLK A;  4CM2 A;  2W5S A;  4OHY A;  1XNQ F;  3P5T L;  3I32 A;  4YDX A;  3G8S A;  1Y9O A;  4JI5 F;  3NMA A;  5EUH A;  3NGU A;  4DX8 H;  1FRM A;  1VGY A;  1S1V A;  1RP5 A;  3DM2 A;  3VR1 A;  4DQS A;  1WSV A;  2E5L F;  3JSB A;  4CLY A;  2V2Q A;  3H2L A;  4I4B A;  2GML A;  2ZIT A;  1FF2 A;  4HHH A;  1I3O B;  3I56 S;  2W9B B;  4FS1 A;  2ASJ A;  1Y5N B;  2AQ4 A;  1NDL A;  4YOE A;  4UPH A;  1KVJ A;  3NS5 A;  1A7G E;  3EXY A;  2EK6 A;  2AJ2 A;  3CO0 P;  3FVY A;  1T05 A;  2J6T A;  3J80 Y;  4IFY A;  2LXF A;  3TR5 A;  2AJ1 A;  1FJG F;  2CAJ A;  2F4F A;  2KI2 A;  4GKJ J;  3PVX A;  4ELT A;  2AWZ A;  3R97 A;  1HW8 A;  2QMW A;  2XCP A;  1YJN S;  4LF4 J;  3OL9 A;  1BWV A;  4NRU A;  2CG4 A;  3W9I A;  2F8E X;  1HHS A;  3T6J A;  4DL7 A;  1FJE B;  4U7C A;  1LEO A;  5IS2 A;  3IA0 A;  5HQL A;  3MOZ A;  4YB1 P;  2HHQ A;  2GVZ B;  1X0P A;  2HSE B;  2E5H A;  1JJH A;  5KFT A;  1K8A T;  1VQ9 S;  1NCL A;  5M2R A;  3VGU A;  4ELU A;  4JI0 J;  3KD8 A;  4C8M A;  4J9S A;  1ED9 A;  1WF2 A;  2RHS B;  1NK5 A;  3EX7 B;  3M1V B;  2WK4 A;  1CJT B;  1HMV A;  4MT1 A;  2HQD A;  1BC6 A;  2HMI B;  1RHU B;  2AZ1 A;  2EPI A;  1RWU A;  2YXL A;  2RQK A;  1Y0H A;  4UQG A;  1FKO A;  2NYI A;  3D0G E;  3EJM A;  4O0N A;  1FFW B;  4Q0B A;  1UVK A;  1OPZ A;  2MST A;  3MCN A;  3IWX A;  3CMA S;  4Q8E A;  5KFK A;  2HBY B;  4XDC A;  2UUA J;  2NZ4 A;  2L9N A;  3QAU A;  4Y2C A;  5KFJ A;  3OUY A;  2XO7 A;  2DRD A;  1IBK J;  4JUZ A;  3J80 U;  1AUS L;  2W4C A;  4B3R F;  4ZKA A;  2OIH A;  4FBU A;  2JX2 A;  5CD4 H;  1HPZ B;  2GFF A;  3LAM A;  1LFP A;  1TVR A;  2XI3 A;  1WKL A;  2DGW A;  5DS7 A;  3ZNJ 1;  1U1R A;  1HL6 A;  3ZC4 A;  2DCU B;  4ED2 A;  3LXQ A;  1D1U A;  4E0D A;  3Q8Y A;  4DPY A;  4PCQ A;  4RW9 B;  2AJ4 A;  4TY8 A;  1ZEF A;  2DNN A;  1UJ4 A;  4U8V A;  5AXM A;  4CTA A;  5J1P A;  2ZDO A;  4DS4 A;  1NUE A;  4LF5 J; 
#chains in the Genus database with same CATH homology
 5TJ3 A;  4N7T A;  3TWZ A;  3UN5 A;  5L0K A;  4UOP A;  3NKM A;  5LRM A;  4LRA A;  3E2D A;  2D1G A;  3TX0 A;  1P49 A;  1ELZ A;  1FSU A;  4UOR A;  3WAV A;  4UPI A;  5L0E A;  1EQJ A;  5DLV A;  4NWX A;  5GRR A;  5L0B A;  4KM4 A;  2RH6 A;  3NKN A;  4NWJ A;  4MY4 A;  5IJS A;  1O98 A;  1ANI A;  2VQR A;  3TG0 A;  2W8D A;  1ELX A;  3SZZ A;  5DLW A;  4KJD A;  3BDH A;  5IJQ A;  2ANH A;  1ALH A;  2W8S A;  1AJD A;  1ZEB A;  3WAW A;  3IDD A;  3M8Y A;  4UOO A;  3M8W A;  1HQA A;  1AUK A;  3NKR A;  5KXA A;  2ZKT A;  3T00 A;  1ANJ A;  3A52 A;  4LQY A;  4LR8 A;  1AJC A;  2W5T A;  4LRE A;  3UN2 A;  2W5S A;  4KAV A;  1E3C P;  1AJB A;  2XR9 A;  3IGY B;  1KHJ A;  3MK0 A;  2GSN A;  1URA A;  1B8J A;  4CXS A;  1ALI A;  1EI6 A;  4ZG9 A;  5LIA A;  1AJA A;  1Y7A A;  3DYC A;  4LR7 A;  5GOV A;  3T02 A;  4CYR A;  1ALK A;  4UPH A;  1HJK A;  3UNY A;  2GSU A;  5INH A;  3M7V A;  4LRF A;  4CYS A;  4KJG A;  1ALJ A;  1EW9 A;  1HDH A;  4LRD A;  1EW8 A;  4UPL A;  4GTZ A;  1URB A;  3BDF A;  3NKO A;  4MIV A;  4ZG7 A;  3B5Q A;  4FDI A;  4GTX A;  3ED4 A;  3DPC A;  5DLT A;  1ED8 A;  2GSO A;  4CXU A;  1EJJ A;  3BDG A;  4GTW A;  3OT9 A;  1ELY A;  4B56 A;  5LRN A;  2W5W A;  4LRB A;  5K4P A;  3NVL A;  1KHN A;  3KD8 A;  3WAY A;  1KHK A;  4CXK A;  1E2S P;  3UN3 A;  1E33 P;  3M8Z A;  1N2L A;  4LR2 A;  1ED9 A;  2W5V A;  2IFY A;  2X98 A;  3Q3Q A;  4FDJ A;  4MHX A;  1KH7 A;  1SHQ A;  3WBH A;  4LR9 A;  4ZG6 A;  2W5R A;  2G9Y A;  1SHN A;  1Y6V A;  1KH5 A;  3MK2 A;  1KH9 A;  3T01 A;  2IUC A;  5LQQ A;  1KHL A;  5C66 A;  2XRG A;  2GA3 A;  2W5X A;  4KAY A;  2W5Q A;  5HRT A;  1N2K A;  5EGH A;  3CMR A;  3SZY A;  4GTY A;  3MK1 A;  3NKQ A;  4LRC A;  1KH4 A;  3BDG B;  1O99 A;  4UPK A;  4TN0 A;  1EW2 A;  3UO0 A;  1ZED A;  4YR1 A;  5AJ9 A;  3NKP A;  3LXQ A;  3IGZ B;  1E1Z P;  1ZEF A;  4ZGA A;  1K7H A;  2GLQ A;  4QAX A;  2IUC B;  3WAX A;  5EGE A;  2QZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...