4LRBA

Phosphopentomutase s154g variant soaked with 2,3-dideoxyribose 5-phosphate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTGADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 146
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrbA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrbA01
1EW8A 4UOOA 4LQYA 1ANIA 3M8YA 4CXSA 1O98A 4MIVA 4QAXA 4ZG7A 1N2KA 4NWJA 3WAWA 4FDJA 3T01A 3TX0A 3DPCA 4CXUA 3BDHA 1Y6VA 4CXKA 3DYCA 1KH7A 3TG0A 5DLWA 5DLTA 1ALHA 4KAVA 3SZZA 5L0BA 1FSUA 1ED9A 3UN3A 1ELZA 2IUCA 3MK0A 3BDFA 3BDGB 4LRDA 4LR7A 3WAYA 3LXQA 4MHXA 4UPHA 4UPLA 2GLQA 1URBA 3BDGA 2W5RA 4ZGAA 1EW9A 3Q3QA 4CYSA 5K4PA 4LRFA 1ED8A 2G9YA 5EGHA 1KH4A 2GSOA 1KH9A 3WBHA 3KD8A 5C66A 4LRCA 4GTXA 1EQJA 1URAA 4LR2A 4UPKA 3ED4A 1AUKA 1K7HA 4LR8A 4UORA 3UN2A 2ANHA 2W8SA 4B56A 1AJCA 3IGYB 1ALKA 4ZG9A 3IDDA 4KM4A 4KAYA 1AJAA 3NKOA 2QZUA 3IGZB 5LQQA 2W5XA 1KHLA 3A52A 5HRTA 2W5VA 4LR9A 3MK2A 4KJGA 1N2LA 3NKQA 1AJBA 4KJDA 3M7VA 4GTZA 5DLVA 1ANJA 2XRGA 1KHKA 4CYRA 1ZEBA 4GTWA 3WAVA 5LIAA 1HDHA 4ZG6A 3E2DA 4LRBA 1E2SP 1B8JA 2XR9A 1AJDA 2X98A 4FDIA 4UOPA 4UPIA 4N7TA 3T00A 4NWXA 4YR1A 1Y7AA 1EJJA 1EI6A 2D1GA 3OT9A 2W5TA 5LRNA 5L0EA 2IUCB 2W5QA 3SZYA 3TWZA 1E1ZP 1ELXA 1EW2A 1SHNA 3UO0A 5GRRA 5IJQA 3UNYA 1HJKA 1ELYA 2ZKTA 3WAXA 1ALIA 1O99A 3M8ZA 1HQAA 5INHA 5TJ3A 5LRMA 2W5SA 4TN0A 5IJSA 2IFYA 5L0KA 3NKRA 3NKMA 1E33P 5GOVA 5EGEA 3UN5A 1KHNA 1KHJA 2W5WA 1SHQA 3MK1A 2W8DA 4LREA 3NKNA 2GSUA 3NVLA 3B5QA 5AJ9A 1KH5A 1P49A 2RH6A 2GA3A 5KXAA 1E3CP 3M8WA 2GSNA 4GTYA 4MY4A 1ALJA 3CMRA 1ZEFA 1ZEDA 3T02A 3NKPA 4LRAA 2VQRA
chains in the Genus database with same CATH superfamily
1TAUA 3UCZP 2QJ3A 3EM1A 5GAGU 3S8SA 4B3MJ 2KFNA 4K0KF 4OI3A 4J9VA 3HI9A 1RLDA 4NXNJ 4ED6A 1EHWA 2XMMA 4MIVA 4QAXA 2D9PA 1NH8A 1SI9A 4H4KA 1IKVB 3MWBA 1TFWA 1JLFA 3WAWA 1YDLA 2KJVA 4NLWA 5IWAF 1VGYA 1YGYA 5M2UA 2K2PA 2DHXA 3CCES 1N48A 1I94F 3CWJA 4PXCA 1RTDB 4FF4A 1RWWB 2QX0A 4TQSA 3H25A 2D9OA 2GCFA 3FCWA 3KHHA 1UEVA 2G2ZA 3TJ9A 1V3ZA 3RJMB 4IO1A 2FJDB 3OXLA 4NLYA 1O51A 2FY1A 1D9DA 5LJ5Y 4X4UA 4O4GB 3MOZA 4QR2A 3K5MA 3C3LA 3LGMA 2R7QA 3IRXB 3TJ8A 4B3OA 2XMWA 3LO3A 1TK8A 3PX0A 1U0HA 3BR9A 4DX5A 4OI1A 1PBAA 3CJ4A 2M52A 1TZ0A 4OZ3A 3I5CA 1RAOA 3W5ZA 4A8XA 4BCAA 5IQ6A 2X1AA 3NRBA 1JQGA 4Z7YA 1NSQA 1O0PA 2X7IA 4JI6F 2GHWA 4Q2MA 1ITPA 2CQGA 4B9VA 4DWIA 3MR6A 4EO6A 1ZTTA 1UPMB 5E41A 2I0XA 5LSOA 1JJ2R 2E5GA 1T3OA 4DV1F 2ALZA 2YNHB 5AE3A 1FWPA 1HD0A 3MM8B 3N28A 4ITSA 1FRHA 5A76A 1EETB 1QTNB 4ECWA 1JXLA 2RNEA 2RUSA 1D9FA 2QA2A 4OI4A 3SMZA 3HM9A 4ILMA 3JQJA 2R9LA 3GJQB 5IWAJ 2HZCA 2V4JA 3BO3A 1N4LA 3CC4S 3JB9k 4WK1A 2HLUA 2V69A 4WFNQ 2C22A 3NMRA 2DH7A 4DEZA 4I67A 4I6WA 2RQMA 2E1PA 1M5HA 1NJZA 2RRBA 2G0JA 2HVIA 1XR5A 3IM8A 2MQQA 4DFJA 2YTCA 4OYIA 5LIAA 3ITHA 4LT6A 2PFDA 1JJCB 3PFOA 3VGVA 4DG1A 1F9FA 1XMBA 5G0RA 3RAMA 3TX8A 3ZZ0A 2ZOMA 1BD6A 4CNYA 3T41A 3HHLB 3M6XA 3AD8C 3CCQS 3PEJA 4IUFA 3PHTA 2C2DA 5BJRA 2E1MC 5EHHA 1S9EA 2IJFA 4BWMA 1MMNA 1XIQA 2W01A 3JAMY 3QZ7A 4FPIA 4BWJA 4KE5A 1RAJA 2BYCA 1U1KA 4AUKA 3GFYA 2AQ4A 1S99A 4N76A 1QDUB 3CJSA 3H4BA 1WKLA 2CNLB 2LQ8A 3M05A 3QLHA 1SQFA 2CUYA 3UWTA 2F3JA 1UVJA 2VQEJ 3JSBA 1R6VA 2C3MA 2QO3A 2ZWOA 2QL5B 3D68A 4PG4A 5J2MA 2FVQA 4LMZA 3H98A 3CC2S 4ZHRB 1QVGR 2Y8YA 3EGVA 4NZ0A 3OV7A 1UWBA 1RU2A 3PG9A 2R8JA 1F1BB 1H72C 3E2EA 1U6FA 2QLBB 2BR0A 1R8AA 4LF6F 4X4NA 4FDJA 2BOPA 4FZVA 3VR1A 3V6DB 3MPDA 1NK5A 4X62F 5IC4B 2BE2A 5CCMA 1H98A 3Q86A 1T9XA 4YY3F 3UD5A 3Q0AA 2AJ0A 4L3KA 5C25B 1UJ4A 2XZTB 3W7BA 3B4MA 1LXNA 1XTZA 4QWAA 4PUOB 2RH6A 4QYZJ 1X9MA 3Q8YA 1BXNA 3OW2R 1HWUA 2HFZA 1APSA 2UXBF 1P27B 2L9DA 3C6UB 5HL7Q 3FEXB 1J5OB 3AD9C 5L8RC 2NXNA 4V19J 5L9XA 2FHJA 4UOHA 3H2VE 3NS5A 2M4MA 4LIRA 1IJEB 1BHNA 2BANA 2HVEA 3EXCX 2V2KA 4K2JA 1JLAA 5EGYA 2CZ4A 1EKSA 2CJKA 1Y6VA 3BDHA 3KLVA 4ZCMA 1FKOB 3NLCA 1S1XA 1QAJA 3ILJA 3OVBA 2HW3A 4HLBA 4XPEA 5HP1A 1IR0A 2B4VA 1C2PA 1R7IA 2PEHA 3NGDA 4URGA 2IAJB 1SPBP 4ZPBA 1DBDA 4J9KA 2LVWA 1W2IA 2CQIA 2KG1A 1SUQB 2MDAA 1VBXA 2VIHA 4DUYF 2LYVA 4GKJJ 1RT3A 4N77A 2RQ4A 3Q8PB 1JNRB 5FDLA 5BR8J 2F4VJ 1JLEB 3FZ2A 3FK4A 4Y65A 3WQPA 2VC0A 4MHXA 1WC4A 4P2SA 2FPHX 3NGRA 1PG5B 4WBFA 5IV3A 4ED3A 1TV6B 4BHQA 2J0QD 1K1SA 4KHPF 1RAAB 3HSJA 2WVFA 2AEJA 5KT4A 1PBUA 2OPSB 3A3NB 5B7WA 3V4IA 4CYSA 3KK1A 4ZJQA 2DISA 2V2QA 5DRKA 4K4YA 5F41A 4A8YA 2GSOA 1U0SA 2QYGA 7AT1B 1F5CA 3MEKA 2C3UA 4IH7A 4PQAA 3R5DA 4CLYA 1TTHB 4IH5A 2V4JB 1Q5VA 2YWHA 2QLFB 3OPKA 4ZVTB 5DDRC 1IKXB 2OFHX 1LFPA 2DR6A 2W9CB 3G9CA 2NYIA 1PYOB 3Q22A 3I87A 4GO5X 4NXMJ 4JYAJ 2HRYA 2GO8A 1U2RA 5DQIA 4LFAJ 4ZPCA 2XY6A 4K59A 3GFHA 1RU1A 1GEHA 1UKUA 3MM8A 2VICA 2HMIB 2W25A 2YKOA 5F0WA 1RTDA 3AXKA 5GAGI 3JSRA 4O3PA 1CPZA 3NGSA 3RB0A 4TLRA 1UMJA 2DVIA 4LF7F 4X4VA 3D7SB 1S76D 2O66A 4X66F 4FBUA 2DBBA 4IG0B 5DDQC 2AEFA 2V0NA 1PGZA 2FZKB 4ES3A 1EX8A 2FJVA 4Y34A 4F67A 3W8GA 4QW9A 4HACB 3AAWB 3EZ5A 3MMBB 2HSEB 1WOOA 3PYGA 1EJ7L 2HHPA 2HQCA 5HMXA 1U0HB 3DGVA 4OLOA 2RKIB 3BSOA 2XO6A 1D0EA 3QJLA 3L9ZA 2HHVA 1FF2A 1VJQA 2CQ4A 3OQ2A 2FGOA 5HBMA 4ZVEA 4WTOB 3BF4A 4OYWA 3TYTA 5SZTA 1RA6A 3H7HB 2DHHA 3MMCB 3R6GB 1HI8A 3MEEB 2I38A 1ELYA 2Z2YB 2KJWA 3W63A 1VQSA 1JMTA 2WRMA 4H54A 2GMJA 3MEEA 2VBYA 1SL2A 1RWXB 3EZUA 2CQDA 2L3MA 2W4CA 3VF0B 1ZS6A 3OL9A 4YOEA 3PRDA 2MTLA 2CPIA 3Q8VA 5HBMB 2CXEA 4DX7A 3FMBA 1S9FA 3LQVA 3RR8A 2J0SD 2GX8A 2HPUA 2J9DA 4GMKA 5KFFA 2J0XA 2RKIA 5LMUJ 1KP6A 1IBLJ 2N3LA 3J81U 4UY85 1HFEL 2RHSB 1FKAF 3DI6B 4N56A 2A6OA 2CIMA 3OTOJ 4QWDA 4ELTA 1FA0A 1YQHA 1KH5A 5DZ7A 2Y0BB 1Y00A 1NKCA 1WORA 3KG4A 1KQKA 4XPCA 3J7ZT 1WC3A 2R2RA 2IBKA 2IJNA 1NK7A 2BKPA 1RTHA 1NO8A 1HBNB 4F25A 3LTOA 3W1YC 1B0TA 3ILLA 5L9NA 3KMQA 2HURA 4H4OB 3PX6A 4YR2A 4NL5A 2QFJA 1FESA 1YK9A 2FVPA 3BQ0A 3M30A 3M8RA 1XERA 2F9DA 2XHWA 2WCXA 3ENWA 4HT5A 4ID8A 1U49A 2ZD1A 3MAHA 4YB7A 1RCXB 5GADI 4MY4A 1KONA 4LBHA 4PQUB 3TEHB 1EP4A 4LJMA 5KFCA 5I3QA 1X9WA 2BJ1A 4BC7A 2ACMA 2KN4A 3FSYA 4MAKA 5ETNA 4ZOSA 4IOCQ 1CBKA 2ZZMA 2XI3A 4CYUA 4G65A 3ENAA 1LK7A 1N0VC 1Z2ZA 2OPSA 3C15B 3KK1B 3E01A 2C2RA 3UN3A 1T3NA 2M5YA 3EDRB 3FUYA 1ZZNA 4MYTA 2IUCA 2H3EB 4R5PA 4QIEA 3VVUA 1F2GA 2ZDOA 1H2TZ 4I2QB 4OHYA 3WAYA 4P9SA 2ZH4A 4DS5A 3IXQA 3VTIA 2POKA 2KZZA 1CJUB 2Z57B 2C2EA 4JI1J 1URBA 2OPQA 3LGNA 4ZGAA 1U6BA 1XJWB 3MR3A 4PQUA 5A6PA 3OTBA 5GAHI 1Q79A 4XTTA 3SBMA 3QJJA 5DM7Q 1NU4A 4MJKA 1KTQA 3MUVP 2NUUG 2WW8A 3J80Y 3OHBA 4J7CA 4A8QA 4UPKA 1HNIA 3FFIA 4USWA 2EEYA 1FKOA 3SSSA 2JLFA 2B7CB 1DQAA 1RABB 4E8UA 4JI4F 3UD4P 1L3UA 4LF9J 2Z56B 4EUVA 2VUGA 2A3JA 5LXYA 1X7VA 3HVWA 5C2GA 4K4ZA 1RWUA 3IM9A 2EG2A 4DR6J 3MK2A 1REVA 3CDAA 4U8VA 2OIHA 5I3PA 4A48A 2R2SA 1SXLA 3W60A 1TKZB 1DQ9A 2DR5A 2OTJS 1VOMA 4GKKF 4U7CA 1ZEBA 2ZM6F 3T1YJ 4ECTA 1SB6A 2EWHA 5B0CA 1QSSA 1SJQA 3IAS9 2BE2B 3MEGB 4LFCF 2HNYB 4J9NA 1MMDA 2NXEA 5KFOA 4KQZA 1RT5A 3HCXA 4RW6B 5CABA 2IM3A 4OYOA 2KHCA 1N34J 1PILA 1HI0P 3A8KA 4EGLA 4DR5J 1S0VA 2JRSA 2HLTA 5D4LA 2JC0A 1S77D 1HNXF 3DLGB 2VASA 4LSZB 3HSZA 4M5LA 4RBUA 2XQCA 2K3KA 1KRPA 2PMHA 5J2MB 1EQMA 4LBPA 3M8QA 5H9FJ 1BQMB 2BVZA 2ZZTA 4H4KC 2YNGB 1YTYA 1UW9A 2EKYA 5B0EA 1RBLA 1F3FA 2V94A 1RA7A 4IG3A 3M8ZA 3F73A 1S1TA 3WC2A 2Y0SD 3DLLQ 3DLGA 4X65F 1WELA 2N7YA 5IT0A 3OXFA 2ASLA 3I0RB 3QWPA 3HSGA 4ED8A 2DRDA 3PNIA 4RW6A 1NEEA 3ISZA 4ZVRB 4NI2B 5C42A 5J2PB 5JUMA 2ZBCA 1NJXA 3W8PA 2R7VA 2HNYA 1A9NB 2YQ3A 3CDBA 1J2VA 3P4UB 2GSUA 4JV5J 2YPZA 3B5QA 1Y11A 4A8FA 1H7WA 3R5AA 2V63A 3GPAA 4XK8C 2BMBA 3HHLD 2RQKA 1LW0A 3M8WA 1ZPWX 5CYMA 3MFHA 1RT2B 4A8MP 2FTRA 3TQ1A 5FD1A 4MIWA 1TKTB 3BGLA 5E2QA 4ATNA 3IGVA 3I9V9 2CFXA 1UTAA 2LU2A 1A0OB 5CAAA 4MTPA 2I1RA 1RXOB 3K17A 3S7RA 3GIKA 5KFVA 2JH3A 3I0RA 4H4MA 2Z0GA 4CO0A 2JEFA 1O8BA 2KM8C 4E2FB 2WSCC 4KFBB 1FX2A 2YXLA 2E9RX 4RL1A 3P5TL 3KNAA 3PXGa 4GVBB 4RWXA 4C48A 3M6UA 2WSFC 1KWMA 1TL3B 4KHMA 3US5A 2KM8B 2U1AA 3UR3C 3PJWA 2BRLA 3OLAA 2CDQA 4C9DA 4NLPA 1RCOB 3AJDA 5K8NA 3CO9A 1EW8A 3GYNA 3FRZA 2M2BA 3M2VB 3MK0A 4K50A 1ZA1B 1CJUA 2JLEA 2KRRA 1T9VA 5ETMA 2GW8A 4CLZA 5DETA 4JI0F 9RUBA 4CLUA 4UPLA 1VIXA 1SH2A 2V8GA 3IFEA 1OYDA 2WHOA 4I2QA 4M5NA 3KLEB 2G4BA 4V1Ak 1I51B 3ZFVA 2W5RA 2E5LJ 2K1RB 3MEGA 1QUVA 1JJ4A 4DSLA 4DR5F 4ZK7M 1IJFB 1BLUA 1YJRA 1FDDA 3QAUA 5HQ8A 1Q81T 1UL3A 5C5JA 4FYWB 2CQCA 1KFDA 3EX7B 1BQNB 3KLHA 1URAA 2BJ8A 3KHGA 2MLZA 1RAIB 1CJTA 2XMTA 4RPFA 2AIRB 5HMWA 4YP3A 1REVB 2Z4PA 3OJSA 4DV7J 1VQOS 2AHOB 1T9UA 4FN5A 2LMIA 4DX8H 1TKDA 3U7JA 2G0CA 3L3CA 1WOPA 1C0UA 1IKVA 1PCAA 2FZGB 2GIQA 2OI2A 5HO4A 2UP1A 4EEYA 1LW2A 1M1GA 1V3SA 3AFGA 4KO0A 5KAKA 1QAIA 5C7PA 1GTHA 1V9OA 1OQ6A 4ZLNA 1D8ZA 1FRXA 3LUYA 1TP7A 1NRKA 3K5PA 2VF3A 1ANJA 1S6QB 1HMVA 1URRA 4MIBA 4RW7A 3M32B 4HDGA 1OIAA 4UUXA 3HXMA 2QGFB 4WF9Q 1VBZA 3MM6B 2DGXA 3EE3A 1CQMA 1QUPA 4LRBA 2WW4A 1AJDA 2A18A 3DM2B 3TUZC 4K4UA 2X98A 4OX6A 2J8AA 5K5MA 4UOPA 4PG8A 2VDHA 1QVFR 3IC1A 2XNRA 5LRNA 3N6MA 4DSFA 2IA0A 1MROB 2E5LF 3E01B 2ZZNA 4ES1A 5I4MA 1ELXA 1K44A 2J7WA 2QA4G 2NXCA 2BEFA 2WSEC 4WU3A 5SUHA 3I55S 3MR5A 1Q16B 1TUVA 3W61A 2EK1A 4B17A 1VHIA 5J1EB 1TL1A 3K89A 1VMBA 2NSCA 4ES2A 2ZKTA 4DV3J 5EN1A 4W92B 4YFUA 1DQ8A 2QA4S 3QATA 5L1LA 4IR9A 3MMCA 2G0IA 4HVZA 1JLGB 3LP2B 5ETKA 4PEOA 4IOAQ 4AFFA 2KZMA 1S59A 4X64J 2OEMA 4XAKA 4TN0A 1Q8BA 2HEKA 2BXJA 4O4RA 4C11A 5IJSA 3AOBA 3DDNA 5KFRA 3PIOQ 3GQCA 2DIVA 3QZ8A 2FLLA 3T6BA 4KB7A 1Q53A 4RW9B 1MN9A 3U27A 2D3O1 2M88A 5A8WB 3RAXA 1ALHA 1S49A 2DGVA 5HJYA 5KG7A 2P5VA 3KLGA 3MMBA 5ETLA 3RRGA 3K8VA 5KFPA 3PO5A 2W5WA 4LF6J 2VG7B 5ETOA 3GFZA 3NVLA 5D4PA 1Y9OA 1X9SA 1HYSB 1WG4A 2I6WA 2OTLS 3H5XA 3UNGC 4M94A 1U6ZA 2HBRB 4WFZA 1RP5A 2AYEA 3TUIC 3LANA 5KFBA 4NLSA 4ZPAA 4XIUA 4LRAA 1SJ3P 3FQLA 1QY7A 3KG0A 4OJHA 1QTMA 5HLFA 2JLGA 2HHWA 4NA3A 2AX1A 3CC7S 4RUBA 1WNEA 3Q23A 5H9EJ 1VQ8S 3CJQA 4PXEA 3M4XA 4M5DA 3NMAA 1HQEA 4MK7A 1N52B 2CJ9A 2GIFA 2W9CA 2DEJA 3IS9B 4M5MA 1VCTA 3W9JA 3OL6A 2UV8A 2W4DA 2J6SA 4IOBA 2RS8A 1F2HA 1ZM2A 5DGAA 2MZJA 4QOTA 1E6VA 1XMQJ 4ZLPA 2F63A 1FJEB 4B3RF 3MR2A 1SJ1A 1T03A 2MSTA 3I5BA 2JHEA 3L7UA 1X4CA 3W3SA 3HDSA 4Q0BB 2CYYA 2GJIA 1NKBA 3P5BP 3DHXA 1HNVB 1V3RA 5E3CA 3RBEA 3D9BA 2HHXA 2XHCA 3ONQA 1NJYA 4DV4J 1KC8T 3GYXB 5F9NA 2VC1A 4OV1A 1K1QA 2HS4A 3WZ0A 3V6JA 4PABA 1RT3B 1CC7A 4DR7J 2ADBA 1FFWB 2E1CA 2MZ1A 2BDPA 2MQNA 3ZZTA 4DR2F 4M5KA 3R7NB 1B7YB 2CPDA 1R8PA 4K4WA 4DR4F 1VIOA 2IA6A 3I9ZA 4HYKA 4CQ1A 1NCLA 1FK9B 1VRUA 1S1XB 5T41A 4YS2A 1AUKA 4USUA 2K7KA 2VG5A 2XSJA 4B56A 4NLQA 3IDDA 2DR9A 3I31A 1R89A 1SC6A 2BANB 5G4DA 2UVRA 2ZE2B 1NJIT 1TL4A 4DMZA 3E3XA 2J7UA 2VPWB 4P72A 1GX5A 3C6UA 2RT3A 1IKXA 3TR5A 1BC6A 3MAAB 2XCPA 1Q95G 2B9XA 1C4AA 2N4DA 1N2LA 1QSYA 2EW9A 2CPEA 1GMWD 2YNIB 1XQIA 2VPZB 1KOOA 3MM7B 2P2CB 3IA0A 4ZJOA 4Q44A 2H5JB 2LFVA 4NASA 1N0UA 3TARA 4JI4J 3HSDA 5DO2A 4LF9F 1ZAVA 3SCLE 3FEZA 2OMLA 3PO4A 2JEJA 2HQIA 4J9MA 3TOQA 4DV3F 3GE9A 3MUMP 2IVFB 3V6DA 2GSNA 1R6YA 1X60A 4P2MA 1VQ5S 2ZFHA 1DAXA 3P96A 3QNWB 5IOLA 3C6TA 1QE1B 2BX6A 1ZZFA 2H9ZA 4Y2CA 1IKWB 3SV4A 5D3GB 2CVEA 2AYGA 2UVUA 3O6QA 3GU0A 3I0SB 4AL7A 3PM9A 2GS8A 2IRUA 3CSKA 4I2PA 5ETTA 3JSMB 3RB6A 4ZVOB 3VQTA 1VQ4S 4UQGA 1U09A 3MDFA 4F4YA 1CS4A 1JLBA 2W9BB 2CA9A 1LWEA 3A3PB 3N5BA 3QAEA 5F8GA 3HJFA 4FPRA 1LWEB 2A0FB 2V2VA 2ZHAA 3CW2C 4F4AA 5KG1A 3DDIA 3KFWX 5B08A 3NS6A 4QWEA 1YLXA 4NI2A 3M9MB 1HNZJ 5H9FK 1WF2A 4RUCA 4K8RA 4ANDA 3V81A 5I3UA 3NKRA 2B6AB 5ETRA 3C6TB 3D0GE 3EVOA 4NZ7A 3M2RB 4DPUA 3NKMA 2CQ2A 3MM5B 5DJBA 4RU9A 1UVLA 2FD2A 5DG7A 4YN3B 5HI7A 1U1PA 1FFSB 1FVSA 1YZ7A 2EFPA 3GJRB 2LEBA 1OPZA 1H38A 2QFIA 4QBUA 2KG0A 5IC6B 1WSRA 4Y0FA 5FLXU 5D0RA 2ZH8A 2UV8G 2UXBJ 1WEZA 2QTWA 1S97A 4ID5B 2CPZA 2HQDA 4DV0F 5E3RA 2YWFA 1U02A 4KPYA 1NDKA 1S5ZA 2Z8QA 3JSYA 5KT3A 5HMZA 2X3DA 3MUTP 2EFGA 3BGRB 4K7QA 3OVAA 2MKCA 1HQUA 3MAAA 3GIIA 4G1IA 3OTOF 4DPWA 1FD2A 2VZ9A 4CZCA 4C97A 3SSRA 4O0NA 2C2KB 3WDOA 3NCRA 4DQIA 4K4XA 2GHVC 1X5OA 2X1GA 4OX8A 3E51A 3KJNB 3WX4A 3MAQA 2FJXA 2B5JB 4M63A 1H0HB 3CJ3A 5AXKA 3R7SB 3DXBA 3MECA 1NSKL 2HRUA 4IRKA 2R42A 4BC9A 5DLTA 2LDIA 2VG6A 1T8EA 1JKHB 2EFOA 2XSFA 2UZAA 2FHOB 3WC0A 4EWTA 4AE5A 2RS2A 2WOMB 2HQFA 4ZN3A 1N36J 3I4PA 3BM7A 4DU8A 3QT7A 5KFIA 5JMNA 1P49A 5DQHA 1SJRA 1KSPA 3LAKA 4RUHA 5KOXA 1NSAA 3LXQA 1WTFA 4B3OB 1XMQF 3ISND 3R97A 3HMJG 5F8LA 3T9NA 4USHA 5J2NB 2E7WA 4EYHB 3CCSS 2XEXA 2V4QA 4RBTA 5KT7A 5GAEU 4JI7F 3ITHB 1GTEA 4JBCA 4K2XA 5K14B 5K4PA 4DSIA 3UW1A 1Q4RA 4QIFA 3M8SA 2QL7B 1X4EA 1M5SA 3BO4A 3VAMA 5J2QB 1VQMS 2J7KA 4L6V3 3HK2A 4FKXA 1WC0A 2NYHA 2YH0A 3CD7A 4ZPVR 1JLQA 2KYZA 2ZJQQ 2HHQA 4MT1A 3G86A 3I32A 3AA8A 1FHTA 4A8SA 4EBEA 3DRRB 4B9SA 2IY5B 1RK8A 1SVDA 5KG4A 4DF8A 1IKYA 2WB1D 5T7LA 2AV5A 3NKOA 4URQU 5CD4A 2PT0A 4ECZA 3KXDA 1DJ0A 3R6LB 3G8TA 3J80U 4JV1A 4P10A 2Y1LB 1KHLA 2W5VA 4YQWA 4KHRA 1KDNA 3CD5A 1M90T 4X2BA 2D1CA 3T5JA 4RW4B 4F3QA 4LFAF 3AXMA 4Y6IA 1KQGB 3PCOB 1R0AB 2XRGA 3D0HE 4EFAC 2RIJA 2CZVC 1I5OB 2J8SA 2YNFA 3POTB 1HDHA 3N6NA 1LQ9A 3DFEA 4B9MA 2HS3A 1F60B 1KQFB 2YKNB 3DKDA 4DLEA 4ELVA 2HYIB 1RQ0A 2MKYA 4NPOA 1EIYB 4M95A 1S6PB 2Y9HA 4NWXA 3U1NA 2BJEA 2K8GA 4UUWA 5L46A 4U9RA 3DYAB 1T05A 4RKUC 5HJXA 4AL6A 1BE4A 3BSAA 3R2CJ 4IFVA 4DPTA 2GQQA 4R8UA 4PKDB 2JVOA 3LPYA 1OY6A 2V2ZA 3IG1A 3DCAA 3W2VA 5GRRA 4Q43A 1SIWB 1IVZA 3KHRA 1HJKA 4U7UK 2NXUA 2M3DA 1OQ3A 3OUYA 3AJ2A 1TL1B 4DDFA 4TKTA 2GZOA 3RW7A 4ZPWR 1UZDA 4JI2F 5IV4A 4JI8F 2CWKA 3JQMA 2O1PA 4USKA 1GXUA 1VISA 2WAQD 3Q8QB 2FLPA 3NNCA 2XI2A 1KR4A 2MZRA 3N01A 3RB4A 1QD1A 3JXOA 2Z2MA 1FFGB 3PIPQ 1JX4A 1PKUA 3FKBA 5DG8A 3RTVA 1QSLA 3HHDA 5CH7B 4WYWA 1WEXA 4YEAA 1PYSB 3TVYA 2F8MA 2VJVA 4K5RA 2HGMA 5BYQA 5M2RA 5RUBA 3P6YC 3GIMA 3DRPA 1QM9A 2F4FA 3EGNA 2HGLA 4NLDA 4NXNF 2IYIA 1HLWA 1FWLA 2ZHOA 3U1LA 4CH1A 3VAGA 2MZTA 2OPPB 1FJCA 5KXAA 2ZH5A 1KOHA 2JEGA 2GQ2A 1N33J 4I69A 1NDCA 2ZH1A 4Q8EA 1TKXB 1JWWA 3T02A 2Q6BA 3OTCA 1H74A 1FRLA 1F5BA 1M0SA 1UVIA 2LQ9A 2NZCA 3W5XA 3TAPA 3QO9B 4LQYA 1JIHA 4NEZA 3Q8SB 4QU6A 2RILA 2N82B 1DRZA 1NNDA 2BE9B 3NG8A 2VDIA 3RAQA 1N5YA 1MSWD 1S4FA 5D0GA 1N2KA 5HN0A 2DCLA 5J1PA 3SFGA 1S7IA 4EYIB 2KVIA 1R27B 2AYBA 3NCQA 3EPGA 2BJ3A 3KMSA 2VKRA 2GQCA 3PJ9A 2DYAA 4X4SA 1X4DA 3B82A 3BQ1A 1WHWA 2AJ2A 2V68A 2OJ3A 2HNDA 3GCXP 5INHA 2J9CA 4I0WA 3SQGA 1FSUA 2QRRA 2FVCA 2OPRA 1WACA 4LFBF 3R8YA 3M6WA 1TU0B 2YX4A 1UJ6A 4HI2A 1IXKA 3OR1B 4J5OA 2D3OR 4ALZA 4ETZA 2FJBB 1T05B 1P9QC 2PD1A 1HW8A 1Y3JA 2ZVSA 4CO3A 3PRBA 4WKYA 4MKBA 1D8YA 3ISNC 2RUGA 4JI3F 1Y0HA 5AXNA 4N47A 2ZH9A 2CQ3A 1N5VA 2A10A 2PA3A 3Q83A 3EUNA 3FSXA 4NCBA 3C16B 3I4HX 3SDEB 5KFNA 1TL5A 4OYAA 3KJQB 1S1UA 1S1WB 4ZP8A 1YRUA 2DD8S 4FS1A 5EGHA 3CDEA 1IWAA 2R4FA 3QBCA 2BJ7A 3ICLA 4MK9A 3BH6B 3ELHA 3QFWA 5IFMA 3GV5B 1NK9A 2W2PP 5A8KA 3Q8RB 1KQSR 4Q7AA 2AWZA 1VRTB 1UCNA 1EKRA 3RRKA 2HVZA 3MPUB 1S4EA 3JAMU 1RGVA 4KFBA 3VZHA 2ZC4A 2IMWP 3IGZB 1AB8A 3H42A 2W5XA 3BYRA 1FDAA 4H4MB 2CJBA 1WI8A 1TK5A 4E98A 4DR4J 2MQ8A 3GLJA 5LMUF 4F26A 3PZPA 4KJDA 4JP8A 3BKFA 3BGFA 3PJXA 2VBXA 3SQOP 3PW0A 2LEPA 2KO1A 3ILIA 3M2UB 2YBVA 1UWAA 4DXLA 4YUDA 1NKEA 4QU7A 4DSEA 5EX0A 3G87A 1KVKA 4LVOP 3K5OA 2HIQA 5K14A 1AUDA 3QJPA 4QYZK 2VFSA 1AFIA 4ED0A 1RT7A 3GWCA 4KR0B 5EX3A 5KFZA 5EDWA 2XGQA 4X65J 1E2SP 5D78A 3T00A 4UPIA 1MWZA 4OJ1A 4DL7A 1GXTA 1NDPA 1WSVA 3BH7B 2V50A 2YWGA 3BSNA 5L0EA 3T5KA 1NZ8A 4M5HA 5HROB 4Q5VA 1N88A 2QMWA 1IQTA 3UFCX 2NPIA 1NLKL 3GP9A 3DLEB 5KFTA 3OR2B 2KRBA 2HFSA 2J9DE 1AT1B 1JKHA 1M1HA 5HK4A 4LVNP 1O5JA 2AJFE 3JTPA 2LXFA 2W2OP 1PAEX 3HJVA 1EARA 5E3PA 1I3OB 1YI2S 1OJ4A 3W66A 2ASJA 3C46A 4I56A 2OSRA 2ATCB 2MEWA 2CNNB 4O3OA 3QGIA 3CJ0A 2KXNB 1EZZB 1GNKA 2QZ8A 2KT5A 4FXVA 2H4YB 2YWKA 4TXSA 3ZXWA 2RRNA 2ZEJA 2R7OA 3BSCA 2ZH7A 1M5OC 3DGPA 5DLFA 3FEYB 2QL9B 5A2QY 1HQUB 4N8NA 4OZ5A 1CJKA 2ACYA 3OVSA 5GOVA 2HFVA 1NDLA 4EU0A 2R8HA 2VQFF 3HVTB 1RDRA 1RWPB 4WYLA 1N5QA 3DLJA 3ET6B 4O44A 3DLKA 4O3NA 3VAIA 3QRRA 2HAFA 3NKNA 4P2XA 1S79A 5AJ9A 1KFSA 4ICLA 2ZUGA 1JB0C 2OHDA 3R2DJ 2D1GA 4EMDA 5KTQA 2GA3A 3BPSP 1DY3A 1FERA 1RT1B 3CCVS 4OZLA 4ECRA 1TKZA 1YX2A 1B64A 2YX1A 3MM5A 5AE2A 3TZXA 1JXVA 3M2RA 2GMHA 2W7OA 1ZEDA 1RKJA 2HFNA 4IH6A 4A47A 3KLFB 4MFBA 2QSFA 3R9LA 3E8OA 3THPA 3FNNA 4CXSA 2ATLA 1JK9B 2EC2A 1IBKF 5DZ6A 3BPDA 4M1KA 4RW8A 2PA8D 2CJXB 2CJAA 2J5AA 5HAOA 2ZOFA 1W2BR 4EZ9A 2ZBIA 1ELOA 2B0GA 1DLOB 1UVNA 1RHMB 1Y3KA 4QPXA 2C3PA 2N3OA 5BR8F 1RADB 2F4VF 2BUNA 4RNHA 4CP5A 2G2YA 1HNIB 2W9BA 2JDJA 1CS4B 1BGXT 1LKZA 1DHMA 1E6YB 3D6HB 3KLIB 3TZWA 1RHRB 3M1VB 8AT1B 1Y5LB 5B0DA 1T95A 4HH1A 1T7PA 1IKWA 1WOSA 4QR0A 4LRDA 1RLCL 1QE1A 2E9TA 3BDFA 3BEGB 3GZ7A 4TNOA 3CGIA 4CT9A 1FRKA 2DR8A 5C24A 1CLFA 2OP5A 2IDEA 3D67A 1ZETA 4DFPA 1VQYA 3KG1A 5HQMA 1G1XA 5AJ3F 1EW9A 1HWJA 1U2CA 3AA9A 3R3TA 2HIYA 4KGKA 3W2WA 4YDDB 1PYTA 3HT0A 1LK5A 3BO2A 1VQ7S 4DZDA 2C3OA 4PG7A 3QQCD 3ZNJ1 4YHHJ 4U96A 1UFWA 4F4ZA 1WUUA 2KFZA 1B70B 2DJWA 3EGWB 3SCIE 4Z2XA 1JJHA 2GO9A 2NR0A 5CZXA 3MD3A 2RD5C 4UPHA 2UUBF 1UEKA 2LA4A 4R25A 4UOFA 1FJ7A 2XTJP 5HRTA 3HFZB 4Z37A 4Y2AA 2HVHA 3NKQA 3R5CA 3EICA 3A12A 1DTQA 3HX9A 4QYRA 1FK9A 1VRUB 3Q2SC 2XYPB 1Q8LA 2YKMA 2Q1LA 3HKZD 1CULB 4RX6A 1IR2A 2U2FA 2R7XA 1NPKA 2CNOB 4CLLA 1KVJA 5A6WA 3F0NA 2VV5A 3UDVA 4DPXA 3GV7B 3E2DA 1FKPA 3I6PA 4I6YA 1LXJA 2HHHJ 5HSPA 1JLCA 1VJWA 2JC1A 1AUSL 1C1BB 4LIWA 3CIZA 3CCMS 3T1HJ 1RYRA 1TUGB 2LXIA 1QLNA 2W5TA 1FRIA 2LEAA 3OT9A 1FJGJ 3NNHA 3CTRA 2E66A 2J9EA 1TK0A 3MTJA 3RW6A 1MNEA 4HT7A 9ATCB 4DR7F 1UZHA 4DPYA 2UU9F 1U1OA 3P49B 4OYMA 1D09B 4LBIA 5KFEA 3A8EA 3BKTA 2RQCA 4NLUA 3BQ2A 4DL2A 1E6VB 4P52A 1KTVA 3VALA 3KYLA 4C8YA 4C3MA 1RWMB 2GVZA 1N36F 1SV5B 4KGMA 1A7GE 2IPOB 3R27A 1WC1A 3KK2B 2XMVA 1ZM9A 1YRXA 1YJNS 1HQEB 4EBDA 1WWHA 5K9FA 4M5DB 3RBZA 1X5TA 2RAQA 3PACA 4TU7A 2MHNA 2ZBQA 4CLPA 2ZHBA 4ZPDA 1SQGA 4UY8T 2IFYA 3OTEA 1R8CA 1K47A 1TR0A 1ZA2B 4OV6A 2R7RA 1VHFA 5KFGA 5ETVA 2D3ZA 2DH9A 2RSQA 2FQQB 2VFTA 4HTJA 4WU2A 4KH1B 4XDCA 3TEGA 1KHJA 1RTJA 3J7Z5 1DURA 1FKPB 1TVRA 3JYTB 3FBFA 3PDNA 4LF8J 1FWKA 5LSRA 2A1BA 1TVRB 3JYTA 3RRHA 2DNHA 1RTJB 2DNKA 2YKMB 1BMQB 1O6XA 2H54B 3CCLS 2AU0A 1YIJS 2B9WA 4JYAF 4CH0S 2WVDA 1DTQB 1L3TA 2VQRA 5IM0B 2ABYA 2EFNA 4C8KA 5CA5A 2OELA 8ATCB 3CPWR 4DX6A 3WHIA 4OZJA 2EC0A 3HFKA 2UUWA 3FBBA 3MCOA 5F8HA 4UW2A 2G9OA 3N9UC 4ZJLA 3NY0A 4DV0J 4J9RA 3T01A 4C0HA 5GAEI 3D66A 3O5TB 1IM6A 4A4JA 3KK2A 4D3HA 3GILA 2R7TA 2KH9A 1UAWA 2FC8A 3ZTRA 5H9EK 1HBOB 2B9YA 3T5LA 1RHJB 2IRYA 2WBMA 3LA0A 4NLOA 2IVMA 3QFHA 1HW9A 4BBYA 3LP0A 3G6YA 2VFUA 3RB3A 2KKHA 1HNZF 2DNNA 5L0BA 2CPJA 2VPYB 1G6BA 3ILOA 4ZA1A 4WK3A 1C1CA 3BBCA 4HDHA 4O3QA 3KUHA 2H65B 2XLJA 1X4BA 4LR7A 4CLFA 2GC8A 2ZNZA 2ROEA 4ZLJA 1I6JA 5MAOA 4IRDA 1WF1A 1X5SA 2HZAA 2A2DA 4KGZB 3CCTA 1C0TA 3MM6A 3K59A 2HG4A 2YY3A 2BOAA 1NH7A 3LWMA 1RZMA 4ZLLA 3HT3A 4BLGA 3PKMA 5C66A 1AA1B 2V4RA 3VAHA 5CCLA 4DUZF 5HP1B 1HR0F 5DLGA 1H7XA 1KHWA 5JVGQ 4OI2A 2XO7A 4MKVA 1DLOA 2GNKA 4PYAA 4B3MF 4KO0B 1JLAB 2APOA 3PTWA 4GO7X 4OYPA 3A8IA 2QG9B 3B4DA 3U02A 3C8YA 4WWSA 2RE1A 4P7VA 2RU3A 2LQ5A 2X1FA 3NCPA 1OO0B 2H1YA 4KC5A 2ZJRQ 4MFBB 4CO1A 1NAQA 1ZBTA 4IKAA 3KLFA 4ECYA 1P8GA 2DHSA 1CJTB 2HRTA 4EBCA 4LSLA 4OL8A 4Q8FA 4RJVA 1BQNA 1RISA 4FVMA 3KLHB 2BV3A 1T0TV 3PR5B 1RT1A 2RB7A 5KFAA 4DR3J 5I42A 3QWUA 1SKRA 1HI1A 2V8VA 5K8OA 3Q8UA 3CUNA 4G1PA 2VH7A 4ICLB 5CYJA 4DI6A 3HHLC 3CMES 4KGVB 3IBWA 3V4MA 2XMKA 3K7RA 2X3GA 5ADZA 1V5VA 1FNXH 4XDDA 2DNPA 2UVVA 2XZDB 4J9PA 3PW5A 3QMQA 2DHGA 1U45A 2Y1IA 4LF4J 3VAJA 4C3KA 4B9TA 4QW8A 1WF0A 2N7CA 1UWBB 1RWOB 3AOAA 2K3IA 5BXIA 4UT4A 5DQGA 2MQPA 3IWXA 4HHHA 1LV5A 4CCHA 3DGPB 2UXCJ 1Q5YA 4OYXA 3W5YA 2ZH2A 4GRSA 1RHKB 2IM0A 4N41A 5E3AA 3KDNA 4DR2J 2YWEA 1D1UA 4QPTA 2JSXA 3K57A 4JOUA 2DNRA 4C0OC 2Q6CA 2MGZA 2B4PA 3P45B 4ZDNA 4DU7A 4CT8A 3QLHB 4F3MA 1FEEA 3MOJB 2HWTA 2LQJA 2MQLA 4NCAA 3SIPB 5D0EA 3CCZA 4RW8B 4CH7A 4DL0C 1URNA 4U67Q 2XWYA 1WKKA 4EO8A 1VQKS 2KT3A 1IQZA 1S1VA 2L41A 3BKUA 3G82A 3PR4A 4DS4A 2UXDJ 4ECSA 2WVBA 5HQLA 1NHVA 5KG2A 1ZTWA 1F5AA 3VVTA 1SH0A 1K8AT 1V5IB 5D77A 2AP6A 4DN0A 3CJ8A 2G1DA 2L9WA 4JV2A 1KHNA 1VR6A 3CO0P 5G0RB 2B56A 2IYGA 4NLVA 5B09A 5GAHU 2ZC3A 1N6QA 4OLPA 2QEXS 3MMAA 1FJGF 3I5AA 2NCKL 1HPZA 1EB0A 2DK2A 3PHEA 4ANEA 1XNQJ 4WZMA 1T11A 2LQBA 3EMTA 2XULA 3D1QA 1WC5A 3UVJA 2MPUA 4O3SA 3QSYB 1J27A 2HBQB 3F41A 3HVTA 4ED5A 2AJ4A 5KT5A 1CJKB 2Y1JA 4DV1J 2B8PA 2IRXA 5HVFA 4Y00A 4OYZA 3M8YA 2VJUA 3MPWA 2RHQB 4KV8B 1G3OA 4TLQA 2MQOA 1NK0A 2NLWA 5IQQA 3U1MA 3DLHA 3DPCA 6AT1B 1EAYC 3Q24A 4CXUA 2X1BA 3VAFA 3TO8A 2YNGA 3DOKA 2JVRA 3NS7B 4JV0A 3KTQA 1N5TA 3D3CJ 5DLWA 4F50A 3DLBA 3TG0A 3K5NA 3MCNA 1VC6A 4P2FA 2ROGA 3CMAS 3CJ5A 1S1WA 3M6VA 2WB4A 3W62A 2XC9A 4DSJA 4E0DA 1U8WA 4ZCKA 1XMOF 2MZSA 4ZVFA 3HPOA 2VD3A 3ETOA 1Y5IB 3GSIA 1N54B 3N6LA 3VZIA 4C0BA 3BDGB 4ZN1A 2GAGC 1FNOA 2HHTA 4X66J 2H5EA 4J91A 2ILYA 4ZIVA 7FD1A 1RT5B 4QWBA 4C8ZA 1FRJA 4QIVA 5CYQB 2E9ZA 1D9AA 4WJBA 4ED1A 1NXIA 4KY3A 1DTTB 1F3VA 1UVMA 1MMLA 2ROPA 3EWGA 3SQGB 4J9UE 4ED7A 3QSIA 3T5HA 5H1SV 1DARA 2R7SA 2BABA 4J90A 2ZJPQ 3BGUA 5KT6A 5K20B 5HATA 2EBEA 1IBMF 2UUCF 3CIMA 4NA2A 1RTZA 1H73A 2DGUA 1RT6B 2JFKA 2ZM6J 4A8WA 4PWDB 3NOGA 2Y3YA 1MU2A 2UVWA 2W5SA 3DRSB 2AT1B 3TAQA 1BWEA 3B54A 1RYSA 5ETSA 3JQKA 3BBBA 1MWQA 3ZTPA 3Q89A 3MHYA 1AJBA 3M7VA 4CLSA 5A8KB 4C2MA 1H2VZ 3IR6B 1MWYA 3WX8A 1YSJA 2MKIA 2OEKA 1KD1T 4L75A 2YVSA 3MI7X 1HWKA 3NBPB 3AB2B 4GTWA 3WAVA 2SXLA 4L72B 3SDEA 1YHQS 2OAUA 5BYRA 1C0TB 2BQ3A 1RAHB 2D74B 1GXLA 1PIEA 2P6TA 2OPQB 3D5MA 4USMA 3MURP 4ANCA 3KK3A 4LSNB 2VOOA 2V5HG 1BUXA 2VFVA 5KT2A 4FDIA 2KXFA 4BS2A 2KVQE 4JI2J 4LF1A 2GFFA 3OR1A 1EI6A 3GMGA 3SFUA 3TAMA 3X3UA 2ILZA 3NAIA 3OD2A 4BDPA 3R5JB 4FYDA 1S12A 1L3KA 2BRKA 5AE1A 1SHNA 3B78A 3UO0A 2EG1A 2HNZA 1HYSA 4JI0J 1IUJA 3NWRA 3EPIA 3NNAA 3VCDA 4KPCA 3W64A 4ZCIA 2VHGA 1CG2A 1HBMA 3MD1A 4M5GA 1G7CB 4WE1A 3P8BB 1HHTP 1HBOA 2PN6A 3WAXA 4DR1F 1XR6A 4HHUA 4WE1B 2DGQA 3OFFA 2DO4A 2C2NA 2DKOB 4WXWA 2AGQA 1OWXA 4Y2KA 2AGPA 1AZSB 1HQAA 1VBYA 4C8OA 1R0CB 4NA1A 2BZ2A 2E5JA 3PYDA 2VQEF 2Q3PA 2IC3B 3BN7A 3MEDB 5KFWA 1XMOJ 1KLMB 5ITHA 2XLIA 4LF2A 3BB5A 1HBNA 4MIAA 4X62J 1DZ5A 3UN5A 2XCAA 3QRPA 1PAUB 2CQ1A 2XMJA 1W25A 1OMSA 3DNCA 2ASDA 4CM2A 1Y10A 2YNFB 3MR7A 4TYBA 1XC9A 4B02A 1PC4A 1NUEA 4KAIA 3IN5A 4WPAA 3H90A 2CQBA 2FLNA 1TAQA 4WFYA 2A6MA 2C2MB 4UOOA 2CPHA 3D6MB 4KT0C 4TQRA 5KFYA 1O98A 4ECXA 1Z1ZA 2MY8A 3DRSA 3VV2B 2IM2A 1MU2B 2OUGA 1CVJA 3L7OA 1T9YA 2GJ2A 2HQ3A 5E7OB 3S6EA 2AJQA 3IO1A 2VL1A 2DEIA 1XNQF 5IT9U 3KUEA 4CM0A 4RNMA 1IBLF 2AZ3A 5D6GA 2W8LA 3NWGA 1RBAA 4PR6A 2ZH3A 3MZIA 4RZRA 4FNIA 3OUYB 3HKWA 3CE8A 4QZVB 1RWNB 2N4CA 2HFUA 1YZ6A 3B6BA 2HAIA 4OI6A 3UDCA 3ZZRA 2AD9A 2YKAA 3UDEA 3IG1B 3X1LB 2B9EA 2GVDA 2WVCA 3F44A 1FDNA 4W98A 2LXUA 1B0PA 5J2NA 1G4CA 5CYQA 2IIHA 2BACA 3DYAA 3GSDA 1S57A 2DB1A 2H51B 3H5SA 4OJGA 1D3WA 3ETMA 5FIIA 1SJ4P 4B3SF 4HACA 2CJQA 2R8IA 5F8JA 1CQNA 5L1JA 1X4FA 2QN6B 5F9LA 4CNZA 4ZKAA 3O8WA 3POTA 3KDOA 4JI3J 1N34F 1CULA 4RUAA 1SL1A 2PI5A 3HF5A 4F7VA 5A8RA 4OZNA 1KH4A 4QR1A 3KD8A 3SV3A 2OH2A 3J7YU 3N0VA 3BDPA 4NCGA 1YJUA 2XYHB 4MKAA 4NOHA 4CIOA 2HMIA 3MPYA 2B51A 1E3CP 2W8SA 1HHSA 1ALKA 3IGYB 3GTYX 2XS5A 2ZOGA 2B4UA 2D3UA 1UFLA 2CJYB 2EXUA 2IHR1 4KV8A 3CD6S 1S0NA 2FJEB 1NSPA 4YMEA 3CJ2A 1NK6A 4JI6J 1HQ2A 3FMWA 2QMUB 3NEKA 1NB2A 1VLYA 3DOLB 1RUSA 2GGPA 4IDKB 1JLQB 1AJCA 1FTRA 1NMEB 3UQSA 5K8PA 3UVJB 2PC6A 3IBCB 4U8YA 3T9ZA 1U1NA 5J2QA 3MM9B 4IQXA 4NXMF 2JNJA 1HPZB 4CWBA 3J7YI 2CAJA 2DY9A 3MMAB 3TVKA 3V4IB 3OSPA 4ZG6A 1FXRA 1N6QB 4B3TJ 4OZ0A 3TQEA 4C7QA 1KEKA 5C24B 3HD1A 1I1GA 1XWLA 3LP1B 5KG3A 1F0XA 4TY8B 4J9QA 2AYMA 4Q2LA 3PVXA 3HZGA 4IFYB 3RBDA 4YR1A 5ETPA 2IMOA 1S48A 5I3UB 3KNGA 4RBVA 2EI5A 1Q0NA 3G82B 4ZVGA 4F8RA 1FXLA 1S1VB 2OO4A 1SUQA 3SZYA 2W2MP 4DUZJ 1HA1A 1HR0J 2OEJA 1X5PA 2WOMA 2AJ1A 2CRLA 2G13A 1E6YA 2KI2A 1CSJA 2CPYA 2G2OA 2YQ1A 3AD7C 3EVWA 1X31C 3DDKA 5LOQA 3MMJA 3T1HF 3N5FA 3UNYA 2WBRA 5A0YA 3C14B 3MECB 2MXYA 4CTAA 1U25A 1M5KC 1TQLA 1WEYA 5A0YB 4J9SA 2C1EB 4TU9A 1JLBB 4DJBA 2CQPA 4W90B 1YJVA 5KFSA 3W65A 1PSDA 4Q0BA 2HK3A 2QC3A 2I9SA 1J5OA 3C2PA 2W4PA 3CDWA 5ETQA 3LAMA 3R5BA 1WHVA 2E5HA 2QLWA 4ZP6A 4DLGA 1MN7A 2D69A 4USJC 3CF5Q 1BQXA 3V6HA 1VQNS 3LP1A 3ULHA 2C2OB 4JB8B 2EFVA 4AXJA 1SKWA 2HZVA 1FX4A 1U7LA 2R7WA 1SHQA 3MK1A 4ID5A 5GMEA 1AXQA 1VC0A 2M0GB 3MF5A 3LWLA 1OSCA 3IP0A 3MM9A 4OYBA 3IWNC 3I82A 5I42B 4RNNA 5IT9Y 3ET6A 4O44B 3SEOA 2KHDA 1GMUA 1H6KX 4QIWD 1K0TA 3NKPA 2JFDA 2ZBPA 4IDKA 4LSLB 2AEMA 4P75A 3DOLA 3MGJA 4PXBA 4CI0B 2RDJA 1AROP 1WD6A 1IBCB 1SKSA 2DNZA 1Z4UA 2KL8A 3H4DA 2DTJA 3W9IA 3L4BC 2VFRA 2F65A 2F1FA 2O01C 2V34A 3AH6A 3CJRA 3CMQA 2D41A 3EZOA 3OBIA 3F56A 3TX0A 3RR7A 1PO6A 3EGZA 4LF8F 5GADU 2PE8A 3BV8A 3PYEA 4NYPA 4IO9Q 2VG5B 3BJYA 4F0HA 5KFQA 4A8KA 1WG5A 4UOGA 2V8DA 3AHPA 1P1LA 2BE7D 5C2CA 3OR2A 3PEHA 1DFDA 3DLEA 4DV4F 2AGOA 3GJTB 4FDFA 4OHXA 2XNQA 3HVAA 5KFKA 3LH2S 2Q66A 1FE4A 1S9EB 8RUCA 5KOWA 1S7HA 2BW2A 3ENVA 3FBEA 3FC9A 2HHUA 1KVIA 4IFYA 5KG6A 2P9EA 4TY8A 2HHSA 1KHVA 3CVKA 3D2WA 2GLQA 4NX9A 5IXUA 1WDTA 5FLXY 3HHNB 3LF0A 4PPZA 4C3LA 3TUPA 3Q3QA 2Q79A 2DH8A 4B9UA 2FVSA 3ZZPA 3HZEA 3OFGA 4O0IA 1W7WA 2BKOA 1ED8A 2UU9J 3WBHA 4RWWA 1GMVA 1T03B 3QYYA 3QPIA 3G96A 1AYEA 1PJ7A 3LGHA 3M2UA 4QCLA 4UZBA 2ZH6A 4NLGA 4ZITA 1VDHA 2GGPB 2QT7A 2M7SA 4B3TF 3IR5B 4ZVHA 6FDRA 3BS9A 4WP9A 2F5GA 2GMLA 3TP2A 4ZCLA 3MXHP 3VAKA 3CNQP 2QZUA 1TELA 1WC6A 1ZAWA 2DCUB 4QQBA 2ZE2A 4DV2J 4DV5J 1Q86T 2HHHF 5D4NA 1VI7A 1EETA 2JX2A 2MHEA 2KTQA 3A52A 5KFUA 4KJGA 5HLFB 2WZ1A 5F8MA 2XSJB 2NPFA 2FDNA 1NB7A 4F3OA 1KNZA 2KU7A 4DV2F 4DV5F 2R8KA 3KUGA 2FB0A 2B43A 2L48A 1VLOA 3ZZOA 4Y2MA 3SCKE 1U24A 1KHKA 4DHVA 2R8GA 4USTA 3THTA 1RT4A 2H4WB 1S1UB 2PSZA 4FP9A 2P6SA 3EJMA 4OX7A 4YB1P 2UUAJ 2QYCA 3HULA 3RBXA 4IRCA 2VG7A 1FE0A 2UUBJ 4X64F 5JXSA 2BA9A 2XR9A 3PRVA 2NZ4A 1YG0A 1IR1A 2DNMA 2V6AA 3NKYA 1VFJA 2OKQA 1TL7B 2JZ5A 3IRXA 4I68A 2XLKA 1KLMA 4O4GA 5E0OA 5KFXA 2W5QA 1KS2A 2IC3A 3MEDA 1HNVA 2OPRB 3O1LA 3H59A 4P71A 3SXLA 2FHJD 1Y7PA 4I7FA 3JS9A 2BQRA 1EW2A 2L9NA 4X4PA 1AZSA 2W1BA 1UFKA 1JLGA 5IJQA 2E7VA 2LECA 4P74A 2VONA 3R1LA 4YR3A 1U26A 4P6QA 1N5SA 2DY1A 3CB4A 2OLWA 4F0MA 5AT1B 1XR7A 1WDDA 3IS9A 1XBWA 4C8NA 2RF2A 2DR7A 3H2LA 4EZ6A 2KT2A 2MY7A 1U1MA 1JLFB 1Q8IA 4AYBD 4J9OA 5DM6Q 5TJ3A 2D7SA 2ZITA 4L76A 4DUYJ 4GKJF 2QSWA 2FLOA 1KN6A 5IZHA 4ZP9A 4LFCJ 2LP4A 3N79A 3DM2A 4FYYB 1TKXA 1WKJA 1JLCB 2FJWA 4NEYA 4MKYA 4OHZA 3KK3B 2PEBA 4CO2A 1VYAA 5J1NA 2W8DA 3WBZA 2I2YA 3QIPB 3GCWP 3HLUA 1LWCB 2J0WA 2FHMA 1HBUB 4X84A 3UR0A 2UXDF 2MQMA 4HTIA 3DRPB 2K7JA 3HVRA 1NZAA 2H5IB 1ZEFA 3ED4A 2FC9A 5A8WA 4C98A 4WFBQ 4RW9A 4JI5J 4DPOA 4DN9A 4LF5J 2DRBA 3SCJE 4C11B 5DG9A 2B4OA 3VGUA 1KLNA 4OZ1A 3TI0A 2V67A 1RT6A 4A46A 2PDAA 2YH1A 4PWDA 4OQJA 4KYZA 2XS7A 3HO1A 1GAOA 1GT8A 1YITS 1TUWA 3ZNUA 2UXCF 2Z30B 3R7BB 1S10A 1KH7A 1HBMB 2DNQA 1OS5A 1RTIA 4AXIA 1SL0A 4JI1F 3QT5A 1IM4A 2B7BB 3W2VB 3W2WB 3SZZA 5CZVA 1HNWJ 1U48A 4IFVB 3M9NB 1MROA 3D28A 1VK8A 1BWVA 4P7TA 3DOMB 3TAMB 2VOPA 3KKFA 1HNWF 3ZTSA 1S6OA 3GV8B 3OFHA 4PWUA 4LSNA 2CNKB 2B3TB 5IS2A 3BDGA 2ASYA 1GH8A 1HIYA 3DRYA 5KG5A 2HGNA 2Q43A 5LJ3Y 3O2IA 3M1VA 4Z7CA 3CDUA 3KLIA 1FEHA 1NHUA 2YX7A 3MCSA 3NBPA 4JI5F 5F8IA 3L7PA 1S6QA 2CPXA 5L39A 1R0AA 1W26A 2HKEA 3KJVA 1OSDA 2LDYA 4LR2A 2E5IA 4FNHA 2H48B 3FJ2A 2I5JB 4PRFA 2W7AA 4R0EA 5AXLA 2PIIA 2ZWPA 3A4TA 4ZVQB 1VQ6S 1RHUB 3UDLA 2C42A 4KKOB 5LQQA 3PV8A 4WKRA 1C0UB 3B8HA 3D6FB 2W24A 4X4QA 5T7LB 3CCJS 1ZOTA 3M9OB 2VBWA 1LOUA 2YKPA 3C66A 3DRRA 4V19X 5KFDA 2F40A 2J76E 1QAXA 4U6PA 3J7A1 4GTZA 3ZO7A 2RDIA 3HD2A 1TMJA 3WIUA 1R31A 1HARA 5LMNJ 1RT2A 1SC4B 1YVFA 4RNOA 3UCUP 1LW0B 3AB4B 5CYMB 5GVQA 3G8SA 1B7FA 4CYRA 2W7PA 1FVQA 4ILLA 2UUCJ 2V9WA 2MKJA 1DTTA 4USIA 4EI2A 2OD4A 1L3SA 2K1RA 3THVA 1S9GA 4G1QB 1T9TA 2WTFA 3KLEA 2HVDA 3IRWP 2IM1A 4FVCA 5C42B 4HKQA 4JUZA 2R2UA 1T02A 2DGSA 1ZAXA 2EFQA 3BBFA 5CHCB 4NZ6A 4YDXA 4ERDA 3T6JA 3PX4A 2AMCB 4LUBA 2XS2A 4DQRA 3FZBA 1LWFB 2QLXA 3A1YG 3FGVA 4UQTA 4B3SJ 2EVZA 3R5GA 4ZIWA 5EWGA 3IWLA 4CXKA 1VS3A 3TJAA 3NL0A 1SQEA 1ANIA 1PC5A 5GMKa 4LF5F 5FJ4A 3DOKB 5BYSA 2DHAA 5D15A 3OL8A 4GVBA 2B5JA 3G6XA 5KFLA 3BDEA 4O23A 4NLTA 4PYDA 2UUAF 1O99A 3RU0A 1U4BA 3CD0A 4Y3CA 1RACB 1FTCA 4OIXA 4TVAB 1ULRA 5KFHA 1WTBA 2F8HA 1LWFA 5HROA 3J81j 3H0PA 1RAEB 2VODA 1RBOB 2OGUA 3TA2A 3V5RA 2VPXB 5M2PA 1K73T 3CJTA 2IVYA 3BGRA 3M8PB 4ZVSB 4ER8A 2G1HA 4GKKJ 1AFJA 3AY0A 2ERRA 2RH3A 3OTDA 1UJ5A 3UPFA 4LF7J 1GX6A 4D3GA 3JTOA 4KJIA 3LW5C 2GV1A 1S9GB 2ZNYA 3BZQA 3KJFB 4G1QA 4USVA 1Q1KA 4PWWA 3PW4A 2YKQA 2BJDA 3FQKA 3ZTOA 2DPJA 2DNLA 2LLZA 4FXDA 4GTYA 4NLXA 1Q8KA 4HEA9 3VHQA 5J2PA 4HHJA 1U1RA 2B6AA 2JWNA 2BW7A 1H3DA 2PMWA 1T9WA 1TFYA 3V81B 1PJ5A 2IJRA 4ZPTR 3BN4A 4OZ2A 3QT6A 4M8LA 3SI8A 3EVMA 4KKOA 5D8HB 1NHKL 5KFJA 3OSNA 4FXWA 1M5PC 2Z2ZA 2DXEA 3D4JA 4I6AA 4IG3B 4Y28C 5E5NA 5U47A 4OX9F 2I5JA 4DOZA 2MGZB 5DS7A 2AW0A 3OJUA 4FBTA 3MCMA 1MW7A 3TZYA 1CEZA 1JXEA 2HFOA 1HWLA 5JJBA 3GYGA 3OHAA 2KXHA 3JSMA 4DV7F 2MZQA 4KBIA 4F2SA 2BM0A 3I0SA 3ZZUA 2MB0B 1ELZA 4M5JA 1VK3A 2ALYB 2NXJA 4NRTA 1FNMA 2YPYA 4F4KA 2DITA 2EBGA 3H5UA 3WIVA 4ECVA 3PW7A 4ZVUB 2DNYA 3AOCA 1WJ9A 4R5PB 4OFZA 1Q7LB 2GIRA 2ZKUA 3DXSX 3FDSA 3T3FA 1JNZB 4X4RA 3UD3P 4F36A 3TANA 1C1CB 1R8BA 3C15A 3OFEA 3FSIA 2PI4A 5B0AA 2E1AA 3LALA 2DGOA 4LRFA 4PXDA 2HS0A 4UZCA 1GMWA 3RZAA 1YJWS 1FO1A 3MM7A 3ZC4A 1RTIB 3K8WA 4WZQA 1EQJA 5DDOC 1EP4B 1FDBA 4F4WA 4UORA 2CQ0A 3G2XA 3HHKA 4C8MA 5B0FA 4AL5A 4ZG9A 2HBZB 1OY9A 3IMQJ 4HL9A 3JTNA 4ZP7A 3M30B 5IT4A 4LQ3A 4KAYA 3D1HA 1N5YB 3RGIA 2XM3A 2DGTA 1Q82T 2OSQA 2DPIA 2J6UA 1N32F 1UA1A 4PG5A 4LR9A 3EXYA 3H20A 2FZCB 4OX9J 1AW0A 2COLA 4MMOA 3IAM9 5IM0A 2LCWA 5AJ3J 3FFIB 3PFEA 1VQ9S 1VRQC 4RU2A 4DCPB 4C4WA 1NK4A 2XYGB 4F04B 2FY8A 2OPPA 3H8YA 3GIJA 3BR8A 2CZ9A 5F8NA 5A2QU 4DUTA 4WIIA 5HVGA 5KFMA 1ZM3A 4J9LA 4F02A 1R3NA 4F4XA 3MTKA 2RDDA 3DU6A 2HK2A 1UVKA 2FVRA 3RUBL 5T14A 1RE1B 2IDLA 3KOAA 2YQ0A 4JV5F 2RRAA 2IUCB 4DV6F 5AXMA 4NWBA 1SCJB 3TWZA 4DSKA 4ZS6A 4WFXA 4DCOB 1NBEB 3CCUS 2XZWA 4DCJB 2RF2B 3LP0B 4EK2A 1MG7A 1FXDA 1SV5A 2E7XA 2QE5A 4B9LA 2NS1B 1YJ7A 1Q7YT 2ZD1B 4K4VA 3H2UB 2F9JA 2M8DB 4L74A 2WONA 4PG6A 1F6TA 1F9HA 3CJKA 1ALIA 5B0BA 4TN2A 1C4CA 3GB0A 5EWEA 4I1TA 1SBRA 3PW2A 4I7FB 1S72S 2L08A 4DR1J 5LRMA 2DNOA 4F2RA 5KG0A 4OI0A 2RJZA 2GAHC 4KTQA 2DT9A 5L1IA 4C8LA 3K58A 3K2YA 1TL7A 1U47A 1ZM4A 5CD4H 1VQLS 1S6PA 1T94A 1YRTA 2E44A 4IQMA 1XNRJ 1C1BA 4X4TA 3MFIA 1E33P 4KH0B 3VGTA 5EGEA 1UETA 2C28A 2YKNA 2ADCA 1GFWB 2VQFJ 2QV6A 1VC5A 2NUHA 1YBTA 1Z2LA 2WVEA 2P9GA 4HR2A 4IG0A 3AODA 1B0VA 1RT4B 1X4GA 4QWCA 4W4MA 2XY7A 4IR1A 1K0VA 4FYXB 4B08A 4KIAA 2J6TA 2JOQA 4NYZA 3HHEA 4DL3A 5F3ZA 2QIFA 1LFWA 4CLTA 3T1YF 2M8HA 5LL6d 2O67A 2LA6A 4OHWA 5F3TA 2AKWB 2Z58B 3G4SS 1UP1A 3AT1B 4AQYF 1SC1B 4IYQA 3CEDA 4NWJA 2O5DA 4WTYA 2VA2A 1REGX 2DO0A 3LP2A 1OY8A 1IKYB 3TZZA 3ENQA 1X4HA 2WONB 3CJKB 4DR6F 3DYCA 3TVZA 3CT9A 2GVZB 3T1AA 2MJUA 5EUHA 2HWHA 5MLCV 5K8MA 4U95A 5J1EA 4ZMMA 1K9MT 4RR5A 1RJJA 3A8JA 5JVHQ 3FCVA 1YJTA 4KAVA 1HL6A 1CC8A 4I64A 4FF3A 5DGBA 1WI6A 4B3RJ 1OYEA 3TW0A 2OFGX 4DF4A 1SJFA 2RMLA 3V6KA 4DQPA 4WCEQ 4DFMA 4QIGA 5L38A 2DRAA 1TV6A 1Y4ZB 3J7AN 1NPRA 2CWXA 4UF4A 4CDIA 3A3OB 3KHLA 3PYFA 3QT8A 1JLEA 4F0KA 5LXRA 5FDLB 1PJ6A 2XMAA 2AF6A 3CXCR 1XK8A 3N4WA 4P73A 4WIQA 1HKAA 1RSCA 1WHYA 2PGCA 2C2ZB 3V2UC 5LT5A 4DV6J 4DL6A 4DL4A 1M1KT 2W9AA 1I94J 2E1RA 4YB6A 1LEOA 3I56S 2MMYA 3M32A 3J81Y 1FI4A 1HMVB 2F7VA 3LPEA 4FF1A 3RYLA 4LRCA 2VG6B 2FIUA 4PAAA 3DHWC 2V8HA 3GR0A 7FDRA 1WHXA 3PY8A 2A2CA 2XBPA 1N56A 5LM7E 4R0JA 3UN2A 2ANHA 1B4SA 4CRJA 2GHPA 3GFXA 5L1KA 1IWGA 4DR3F 2DXDA 1LW2B 2NQPA 5GMDA 2KYXA 3D3BJ 1ICEB 4N5SA 2JEIA 4K4SA 1SIZA 3DC2A 3GG1A 4Q45A 1RAGB 2O3DA 5D4OA 2BM1A 4NMXA 3Q2TC 2ZUAA 4NRUA 5DLVA 2EKNA 3EYZA 3SZ2A 1KKHA 4YB5A 4PUOA 3G6VA 1U1LA 4Y2IA 4S0MA 2Y8WA 3ZZZA 4ED2A 1N8RT 1S6UA 2XMUA 5D0HA 1HD1A 2AZ1A 4HI1A 1X0FA 1ZYQA 3KWMA 4ZG7A 2OMOA 3QGHA 1U1QA 2IFXA 4LFBJ 3QRQA 2VBZA 4FF2A 1J5EJ 3D6TB 2HQGA 2V9KA 2GJFA 4N7TA 5E33A 1OPIA 2MYFA 1EJJA 4I4BA 3GR1A 3ZZYA 2BKNA 4QJVA 3M2VA 1IN0A 1UPPA 4RLEA 4RO0A 4ZHRA 3SYZA 3ADAC 1S0MA 2NREA 2IAJA 4WP8A 2C3YA 4GVLA 1P6TA 3UCGA 2QLJB 3G71S 2CVIA 1SC3B 4K4TA 4CLWA 1TL3A 3FVYA 1F9EB 4CTAB 4ECQA 3T19A 5HMYA 1HHQA 3BREA 2MJNA 2K06A 3C14A 1B3TA 4GC6A 2MKHA 2RVJA 3QGGA 4KSEB 2R3VA 4MYUA 4L3NA 4NMLA 4I2PB 1XN9A 4PCQA 3W9HA 1N33F 3ZTQA 4NYOA 4CLKA 1SH3A 2XWXA 3OL7A 3CCRS 5L0KA 5D3GA 2DXFA 1RKIA 4K5SA 1RWKB 3DU5A 4RNFA 1TKTA 3HHLA 1VBKA 2E29A 4DL5A 2XGPA 4U7UD 1IBKJ 4LREA 1RT7B 4DG1B 5C25A 2M70A 2ZDPA 3MPVA 1P9YA 4ZVPB 2CG4A 4CO4A 1IBMJ 4ENOA 1UW4A 4WP3A 2FJAB 1GQEA 3L09A 4X4OA 3DLKB 4AQYJ 4ETXA 4ELUA 1ALJA 3CMRA 2R2TA 2YNIA 2MSSA 3FRYA 3M8PA 5LSLA 4LQ9A 2Y1RI 3FCHA 1BY9A 4WFAQ 3G6ES 4JI8J 2KDOA 1XEZA 4L73A 3NAHA 1ACMB 3VWSA 4FS2A 4GC7A 1S0OA 1L5UA 1U2FA 1X8DA 2JJ4D 4G6VB 3TA0A 1S1TB 4KGXB 3FBCA 6FD1A 3QIDA 3O44A 1VRTA 1GK8A 2YNHA 3GIRA 4UTGA 3NOCA 2PFFB 1RB0A 3S1TA 1X4AA 4NCGB 1BQMA 2MLYA 3L95X 3HP6A 5THWA 3M8QB 1YJ9S 3S01A 3DRXA 2QA1A 2KB2A 4UOCA 4YR0A 5A8RB 2CPFA 4TU8A 1XNRF 2AX0A 4URSA 2NSBA 5F0UA 4AT1B 4N8OA 2ZVIA 1R0BG 1V6HA 2F8EX 2GA7A 5CXTA 2CQHA 4DBQA 1ED9A 4NE9C 3VGSA 1U8SA 2DIUA 3G8QA 4TY9A 2UUTA 1B99A 2OD6A 3DN9A 3NGTA 3SSQA 3I96A 2FHKA 2FUG9 4C6AA 2M9KA 2CDRB 2JL9A 1UA0A 1M5VC 3TRGA 1KBRA 4FKYA 3NGKA 2V8PA 4AD6A 2W2NP 2DNGA 2GVDB 4ED4A 4KHPJ 4MH8A 1L3VA 2G9YA 2EK6A 4G3IA 3K5LA 2HNDB 2EPIA 1KH9A 2VKZG 4GTXA 4DQQA 3GONA 2B8QA 2CKWA 3CULA 3OLBA 3C19A 4LR8A 1NK8A 4K0KJ 1FCAA 2BQUA 1K7HA 4MK8A 3GJSB 1Q78A 3K0JA 4KM4A 1Y5NB 4TYAA 1RAFB 1AJAA 1LWXA 2VA3A 3BYPA 1NM2A 2VU5A 3P3DA 1HWIA 1FT8A 5LMNF 4KRWA 1R8HA 3PKYA 1G2EA 5EWFA 2P9CA 2Z2LA 1YWXA 4JI7J 3UE2A 2W2QP 3GG0A 3KJVB 1YBAA 2FGCA 3OXGA 2MKSA 5HVHA 1FRMA 4WXOA 3NP5A 3TNVA 3C16A 3H5YA 1H2UX 4DQSA 1N32J 2PO4A 4YHHF 1QAYA 2PMZD 4XO0A 1R43A 3KLGB 3H40A 1B8JA 2HBYB 2XB2D 1YKWA 1NPPA 3AQOA 5E3QA 4FYVB 1Y7AA 3VQSA 5DDPC 4M5IA 1SKUB 5CQGA 4YY3J 4PZVA 1UEUA 3D1OA 1YBUA 3DOMA 4DZ6A 2KFYA 1NJWA 4OMFG 2W8KA 2BJ9A 1HNXJ 3LOUA 3AJ1A 1TMMA 1E1ZP 1VQPS 1X0PA 4CYUB 1RHQB 2IBOA 3DMJB 2X51A 2LKZA 2YWWA 4CO5A 2P8IA 3NXZA 3CCWA 1QJHA 1RI7A 2ZBRA 2CG8A 3DMJA 2XG8A 4J37A 2RU9A 4A8OA 2DGWA 2HNZB 1ROFA 3AQPA 3HFVA 3BGOP 3IR7B 1LNQA 4DFKA 4LF4F 1A6LA 4R8UB 1J5EF 3IBFB 4ILRA 4NLRA 1FD8A 2HWIA 2QMXA 3A13A 2WK4A 1MLAA 3D0IE 3QO9A 4H4OA 3R1HA 5HANA 3EDQB 1RTHB 2MLXA 2BBEA 1ZH5A 2LU1A 1CJVB 2VB6A 3TA1A 3TUJC 1ZPVA 1HBUA 1WG1A 2CADA 4OHVA 1LWCA 3QGPA 5B0GA 4OJ3A 4O3RA 2I8EA 2FYXA 3QIPA 4RW7B 3O3LA 3RG6A 1EQ0A 1CJVA 2MKKA 1RWVB 2R7UA 2XY5A 1P1TA 3DI6A 3D54A 4PPDA 4ECUA 4B9NA 4HH0A 3NGUA 3UI3A 4RW4A 3IGNA
chains in the Genus database with same CATH topology
1EW8A 4UOOA 4LQYA 1ANIA 3M8YA 4CXSA 1O98A 4MIVA 4QAXA 4ZG7A 1N2KA 4NWJA 3WAWA 4FDJA 3T01A 3TX0A 3DPCA 4CXUA 3BDHA 1Y6VA 4CXKA 3DYCA 1KH7A 3TG0A 5DLWA 5DLTA 1ALHA 4KAVA 3SZZA 5L0BA 1FSUA 1ED9A 3UN3A 1ELZA 2IUCA 3MK0A 3BDFA 3BDGB 4LRDA 4LR7A 3WAYA 3LXQA 4MHXA 4UPHA 4UPLA 2GLQA 1URBA 3BDGA 2W5RA 4ZGAA 1EW9A 3Q3QA 4CYSA 5K4PA 4LRFA 1ED8A 2G9YA 5EGHA 1KH4A 2GSOA 1KH9A 3WBHA 3KD8A 5C66A 4LRCA 4GTXA 1EQJA 1URAA 4LR2A 4UPKA 3ED4A 1AUKA 1K7HA 4LR8A 4UORA 3UN2A 2ANHA 2W8SA 4B56A 1AJCA 3IGYB 1ALKA 4ZG9A 3IDDA 4KM4A 4KAYA 1AJAA 3NKOA 2QZUA 3IGZB 5LQQA 2W5XA 1KHLA 3A52A 5HRTA 2W5VA 4LR9A 3MK2A 4KJGA 1N2LA 3NKQA 1AJBA 4KJDA 3M7VA 4GTZA 5DLVA 1ANJA 2XRGA 1KHKA 4CYRA 1ZEBA 4GTWA 3WAVA 5LIAA 1HDHA 4ZG6A 3E2DA 4LRBA 1E2SP 1B8JA 2XR9A 1AJDA 2X98A 4FDIA 4UOPA 4UPIA 4N7TA 3T00A 4NWXA 4YR1A 1Y7AA 1EJJA 1EI6A 2D1GA 3OT9A 2W5TA 5LRNA 5L0EA 2IUCB 2W5QA 3SZYA 3TWZA 1E1ZP 1ELXA 1EW2A 1SHNA 3UO0A 5GRRA 5IJQA 3UNYA 1HJKA 1ELYA 2ZKTA 3WAXA 1ALIA 1O99A 3M8ZA 1HQAA 5INHA 5TJ3A 5LRMA 2W5SA 4TN0A 5IJSA 2IFYA 5L0KA 3NKRA 3NKMA 1E33P 5GOVA 5EGEA 3UN5A 1KHNA 1KHJA 2W5WA 1SHQA 3MK1A 2W8DA 4LREA 3NKNA 2GSUA 3NVLA 3B5QA 5AJ9A 1KH5A 1P49A 2RH6A 2GA3A 5KXAA 1E3CP 3M8WA 2GSNA 4GTYA 4MY4A 1ALJA 3CMRA 1ZEFA 1ZEDA 3T02A 3NKPA 4LRAA 2VQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EW8 A;  4UOO A;  4LQY A;  1ANI A;  3M8Y A;  4CXS A;  1O98 A;  4MIV A;  4QAX A;  4ZG7 A;  1N2K A;  4NWJ A;  3WAW A;  4FDJ A;  3T01 A;  3TX0 A;  3DPC A;  4CXU A;  3BDH A;  1Y6V A;  4CXK A;  3DYC A;  1KH7 A;  3TG0 A;  5DLW A;  5DLT A;  1ALH A;  4KAV A;  3SZZ A;  5L0B A;  1FSU A;  1ED9 A;  3UN3 A;  1ELZ A;  2IUC A;  3MK0 A;  3BDF A;  3BDG B;  4LRD A;  4LR7 A;  3WAY A;  3LXQ A;  4MHX A;  4UPH A;  4UPL A;  2GLQ A;  1URB A;  3BDG A;  2W5R A;  4ZGA A;  1EW9 A;  3Q3Q A;  4CYS A;  5K4P A;  4LRF A;  1ED8 A;  2G9Y A;  5EGH A;  1KH4 A;  2GSO A;  1KH9 A;  3WBH A;  3KD8 A;  5C66 A;  4LRC A;  4GTX A;  1EQJ A;  1URA A;  4LR2 A;  4UPK A;  3ED4 A;  1AUK A;  1K7H A;  4LR8 A;  4UOR A;  3UN2 A;  2ANH A;  2W8S A;  4B56 A;  1AJC A;  3IGY B;  1ALK A;  4ZG9 A;  3IDD A;  4KM4 A;  4KAY A;  1AJA A;  3NKO A;  2QZU A;  3IGZ B;  5LQQ A;  2W5X A;  1KHL A;  3A52 A;  5HRT A;  2W5V A;  4LR9 A;  3MK2 A;  4KJG A;  1N2L A;  3NKQ A;  1AJB A;  4KJD A;  3M7V A;  4GTZ A;  5DLV A;  1ANJ A;  2XRG A;  1KHK A;  4CYR A;  1ZEB A;  4GTW A;  3WAV A;  5LIA A;  1HDH A;  4ZG6 A;  3E2D A;  4LRB A;  1E2S P;  1B8J A;  2XR9 A;  1AJD A;  2X98 A;  4FDI A;  4UOP A;  4UPI A;  4N7T A;  3T00 A;  4NWX A;  4YR1 A;  1Y7A A;  1EJJ A;  1EI6 A;  2D1G A;  3OT9 A;  2W5T A;  5LRN A;  5L0E A;  2IUC B;  2W5Q A;  3SZY A;  3TWZ A;  1E1Z P;  1ELX A;  1EW2 A;  1SHN A;  3UO0 A;  5GRR A;  5IJQ A;  3UNY A;  1HJK A;  1ELY A;  2ZKT A;  3WAX A;  1ALI A;  1O99 A;  3M8Z A;  1HQA A;  5INH A;  5TJ3 A;  5LRM A;  2W5S A;  4TN0 A;  5IJS A;  2IFY A;  5L0K A;  3NKR A;  3NKM A;  1E33 P;  5GOV A;  5EGE A;  3UN5 A;  1KHN A;  1KHJ A;  2W5W A;  1SHQ A;  3MK1 A;  2W8D A;  4LRE A;  3NKN A;  2GSU A;  3NVL A;  3B5Q A;  5AJ9 A;  1KH5 A;  1P49 A;  2RH6 A;  2GA3 A;  5KXA A;  1E3C P;  3M8W A;  2GSN A;  4GTY A;  4MY4 A;  1ALJ A;  3CMR A;  1ZEF A;  1ZED A;  3T02 A;  3NKP A;  4LRA A;  2VQR A; 
#chains in the Genus database with same CATH topology
 1TAU A;  3UCZ P;  2QJ3 A;  3EM1 A;  5GAG U;  3S8S A;  4B3M J;  2KFN A;  4K0K F;  4OI3 A;  4J9V A;  3HI9 A;  1RLD A;  4NXN J;  4ED6 A;  1EHW A;  2XMM A;  4MIV A;  4QAX A;  2D9P A;  1NH8 A;  1SI9 A;  4H4K A;  1IKV B;  3MWB A;  1TFW A;  1JLF A;  3WAW A;  1YDL A;  2KJV A;  4NLW A;  5IWA F;  1VGY A;  1YGY A;  5M2U A;  2K2P A;  2DHX A;  3CCE S;  1N48 A;  1I94 F;  3CWJ A;  4PXC A;  1RTD B;  4FF4 A;  1RWW B;  2QX0 A;  4TQS A;  3H25 A;  2D9O A;  2GCF A;  3FCW A;  3KHH A;  1UEV A;  2G2Z A;  3TJ9 A;  1V3Z A;  3RJM B;  4IO1 A;  2FJD B;  3OXL A;  4NLY A;  1O51 A;  2FY1 A;  1D9D A;  5LJ5 Y;  4X4U A;  4O4G B;  3MOZ A;  4QR2 A;  3K5M A;  3C3L A;  3LGM A;  2R7Q A;  3IRX B;  3TJ8 A;  4B3O A;  2XMW A;  3LO3 A;  1TK8 A;  3PX0 A;  1U0H A;  3BR9 A;  4DX5 A;  4OI1 A;  1PBA A;  3CJ4 A;  2M52 A;  1TZ0 A;  4OZ3 A;  3I5C A;  1RAO A;  3W5Z A;  4A8X A;  4BCA A;  5IQ6 A;  2X1A A;  3NRB A;  1JQG A;  4Z7Y A;  1NSQ A;  1O0P A;  2X7I A;  4JI6 F;  2GHW A;  4Q2M A;  1ITP A;  2CQG A;  4B9V A;  4DWI A;  3MR6 A;  4EO6 A;  1ZTT A;  1UPM B;  5E41 A;  2I0X A;  5LSO A;  1JJ2 R;  2E5G A;  1T3O A;  4DV1 F;  2ALZ A;  2YNH B;  5AE3 A;  1FWP A;  1HD0 A;  3MM8 B;  3N28 A;  4ITS A;  1FRH A;  5A76 A;  1EET B;  1QTN B;  4ECW A;  1JXL A;  2RNE A;  2RUS A;  1D9F A;  2QA2 A;  4OI4 A;  3SMZ A;  3HM9 A;  4ILM A;  3JQJ A;  2R9L A;  3GJQ B;  5IWA J;  2HZC A;  2V4J A;  3BO3 A;  1N4L A;  3CC4 S;  3JB9 k;  4WK1 A;  2HLU A;  2V69 A;  4WFN Q;  2C22 A;  3NMR A;  2DH7 A;  4DEZ A;  4I67 A;  4I6W A;  2RQM A;  2E1P A;  1M5H A;  1NJZ A;  2RRB A;  2G0J A;  2HVI A;  1XR5 A;  3IM8 A;  2MQQ A;  4DFJ A;  2YTC A;  4OYI A;  5LIA A;  3ITH A;  4LT6 A;  2PFD A;  1JJC B;  3PFO A;  3VGV A;  4DG1 A;  1F9F A;  1XMB A;  5G0R A;  3RAM A;  3TX8 A;  3ZZ0 A;  2ZOM A;  1BD6 A;  4CNY A;  3T41 A;  3HHL B;  3M6X A;  3AD8 C;  3CCQ S;  3PEJ A;  4IUF A;  3PHT A;  2C2D A;  5BJR A;  2E1M C;  5EHH A;  1S9E A;  2IJF A;  4BWM A;  1MMN A;  1XIQ A;  2W01 A;  3JAM Y;  3QZ7 A;  4FPI A;  4BWJ A;  4KE5 A;  1RAJ A;  2BYC A;  1U1K A;  4AUK A;  3GFY A;  2AQ4 A;  1S99 A;  4N76 A;  1QDU B;  3CJS A;  3H4B A;  1WKL A;  2CNL B;  2LQ8 A;  3M05 A;  3QLH A;  1SQF A;  2CUY A;  3UWT A;  2F3J A;  1UVJ A;  2VQE J;  3JSB A;  1R6V A;  2C3M A;  2QO3 A;  2ZWO A;  2QL5 B;  3D68 A;  4PG4 A;  5J2M A;  2FVQ A;  4LMZ A;  3H98 A;  3CC2 S;  4ZHR B;  1QVG R;  2Y8Y A;  3EGV A;  4NZ0 A;  3OV7 A;  1UWB A;  1RU2 A;  3PG9 A;  2R8J A;  1F1B B;  1H72 C;  3E2E A;  1U6F A;  2QLB B;  2BR0 A;  1R8A A;  4LF6 F;  4X4N A;  4FDJ A;  2BOP A;  4FZV A;  3VR1 A;  3V6D B;  3MPD A;  1NK5 A;  4X62 F;  5IC4 B;  2BE2 A;  5CCM A;  1H98 A;  3Q86 A;  1T9X A;  4YY3 F;  3UD5 A;  3Q0A A;  2AJ0 A;  4L3K A;  5C25 B;  1UJ4 A;  2XZT B;  3W7B A;  3B4M A;  1LXN A;  1XTZ A;  4QWA A;  4PUO B;  2RH6 A;  4QYZ J;  1X9M A;  3Q8Y A;  1BXN A;  3OW2 R;  1HWU A;  2HFZ A;  1APS A;  2UXB F;  1P27 B;  2L9D A;  3C6U B;  5HL7 Q;  3FEX B;  1J5O B;  3AD9 C;  5L8R C;  2NXN A;  4V19 J;  5L9X A;  2FHJ A;  4UOH A;  3H2V E;  3NS5 A;  2M4M A;  4LIR A;  1IJE B;  1BHN A;  2BAN A;  2HVE A;  3EXC X;  2V2K A;  4K2J A;  1JLA A;  5EGY A;  2CZ4 A;  1EKS A;  2CJK A;  1Y6V A;  3BDH A;  3KLV A;  4ZCM A;  1FKO B;  3NLC A;  1S1X A;  1QAJ A;  3ILJ A;  3OVB A;  2HW3 A;  4HLB A;  4XPE A;  5HP1 A;  1IR0 A;  2B4V A;  1C2P A;  1R7I A;  2PEH A;  3NGD A;  4URG A;  2IAJ B;  1SPB P;  4ZPB A;  1DBD A;  4J9K A;  2LVW A;  1W2I A;  2CQI A;  2KG1 A;  1SUQ B;  2MDA A;  1VBX A;  2VIH A;  4DUY F;  2LYV A;  4GKJ J;  1RT3 A;  4N77 A;  2RQ4 A;  3Q8P B;  1JNR B;  5FDL A;  5BR8 J;  2F4V J;  1JLE B;  3FZ2 A;  3FK4 A;  4Y65 A;  3WQP A;  2VC0 A;  4MHX A;  1WC4 A;  4P2S A;  2FPH X;  3NGR A;  1PG5 B;  4WBF A;  5IV3 A;  4ED3 A;  1TV6 B;  4BHQ A;  2J0Q D;  1K1S A;  4KHP F;  1RAA B;  3HSJ A;  2WVF A;  2AEJ A;  5KT4 A;  1PBU A;  2OPS B;  3A3N B;  5B7W A;  3V4I A;  4CYS A;  3KK1 A;  4ZJQ A;  2DIS A;  2V2Q A;  5DRK A;  4K4Y A;  5F41 A;  4A8Y A;  2GSO A;  1U0S A;  2QYG A;  7AT1 B;  1F5C A;  3MEK A;  2C3U A;  4IH7 A;  4PQA A;  3R5D A;  4CLY A;  1TTH B;  4IH5 A;  2V4J B;  1Q5V A;  2YWH A;  2QLF B;  3OPK A;  4ZVT B;  5DDR C;  1IKX B;  2OFH X;  1LFP A;  2DR6 A;  2W9C B;  3G9C A;  2NYI A;  1PYO B;  3Q22 A;  3I87 A;  4GO5 X;  4NXM J;  4JYA J;  2HRY A;  2GO8 A;  1U2R A;  5DQI A;  4LFA J;  4ZPC A;  2XY6 A;  4K59 A;  3GFH A;  1RU1 A;  1GEH A;  1UKU A;  3MM8 A;  2VIC A;  2HMI B;  2W25 A;  2YKO A;  5F0W A;  1RTD A;  3AXK A;  5GAG I;  3JSR A;  4O3P A;  1CPZ A;  3NGS A;  3RB0 A;  4TLR A;  1UMJ A;  2DVI A;  4LF7 F;  4X4V A;  3D7S B;  1S76 D;  2O66 A;  4X66 F;  4FBU A;  2DBB A;  4IG0 B;  5DDQ C;  2AEF A;  2V0N A;  1PGZ A;  2FZK B;  4ES3 A;  1EX8 A;  2FJV A;  4Y34 A;  4F67 A;  3W8G A;  4QW9 A;  4HAC B;  3AAW B;  3EZ5 A;  3MMB B;  2HSE B;  1WOO A;  3PYG A;  1EJ7 L;  2HHP A;  2HQC A;  5HMX A;  1U0H B;  3DGV A;  4OLO A;  2RKI B;  3BSO A;  2XO6 A;  1D0E A;  3QJL A;  3L9Z A;  2HHV A;  1FF2 A;  1VJQ A;  2CQ4 A;  3OQ2 A;  2FGO A;  5HBM A;  4ZVE A;  4WTO B;  3BF4 A;  4OYW A;  3TYT A;  5SZT A;  1RA6 A;  3H7H B;  2DHH A;  3MMC B;  3R6G B;  1HI8 A;  3MEE B;  2I38 A;  1ELY A;  2Z2Y B;  2KJW A;  3W63 A;  1VQS A;  1JMT A;  2WRM A;  4H54 A;  2GMJ A;  3MEE A;  2VBY A;  1SL2 A;  1RWX B;  3EZU A;  2CQD A;  2L3M A;  2W4C A;  3VF0 B;  1ZS6 A;  3OL9 A;  4YOE A;  3PRD A;  2MTL A;  2CPI A;  3Q8V A;  5HBM B;  2CXE A;  4DX7 A;  3FMB A;  1S9F A;  3LQV A;  3RR8 A;  2J0S D;  2GX8 A;  2HPU A;  2J9D A;  4GMK A;  5KFF A;  2J0X A;  2RKI A;  5LMU J;  1KP6 A;  1IBL J;  2N3L A;  3J81 U;  4UY8 5;  1HFE L;  2RHS B;  1FKA F;  3DI6 B;  4N56 A;  2A6O A;  2CIM A;  3OTO J;  4QWD A;  4ELT A;  1FA0 A;  1YQH A;  1KH5 A;  5DZ7 A;  2Y0B B;  1Y00 A;  1NKC A;  1WOR A;  3KG4 A;  1KQK A;  4XPC A;  3J7Z T;  1WC3 A;  2R2R A;  2IBK A;  2IJN A;  1NK7 A;  2BKP A;  1RTH A;  1NO8 A;  1HBN B;  4F25 A;  3LTO A;  3W1Y C;  1B0T A;  3ILL A;  5L9N A;  3KMQ A;  2HUR A;  4H4O B;  3PX6 A;  4YR2 A;  4NL5 A;  2QFJ A;  1FES A;  1YK9 A;  2FVP A;  3BQ0 A;  3M30 A;  3M8R A;  1XER A;  2F9D A;  2XHW A;  2WCX A;  3ENW A;  4HT5 A;  4ID8 A;  1U49 A;  2ZD1 A;  3MAH A;  4YB7 A;  1RCX B;  5GAD I;  4MY4 A;  1KON A;  4LBH A;  4PQU B;  3TEH B;  1EP4 A;  4LJM A;  5KFC A;  5I3Q A;  1X9W A;  2BJ1 A;  4BC7 A;  2ACM A;  2KN4 A;  3FSY A;  4MAK A;  5ETN A;  4ZOS A;  4IOC Q;  1CBK A;  2ZZM A;  2XI3 A;  4CYU A;  4G65 A;  3ENA A;  1LK7 A;  1N0V C;  1Z2Z A;  2OPS A;  3C15 B;  3KK1 B;  3E01 A;  2C2R A;  3UN3 A;  1T3N A;  2M5Y A;  3EDR B;  3FUY A;  1ZZN A;  4MYT A;  2IUC A;  2H3E B;  4R5P A;  4QIE A;  3VVU A;  1F2G A;  2ZDO A;  1H2T Z;  4I2Q B;  4OHY A;  3WAY A;  4P9S A;  2ZH4 A;  4DS5 A;  3IXQ A;  3VTI A;  2POK A;  2KZZ A;  1CJU B;  2Z57 B;  2C2E A;  4JI1 J;  1URB A;  2OPQ A;  3LGN A;  4ZGA A;  1U6B A;  1XJW B;  3MR3 A;  4PQU A;  5A6P A;  3OTB A;  5GAH I;  1Q79 A;  4XTT A;  3SBM A;  3QJJ A;  5DM7 Q;  1NU4 A;  4MJK A;  1KTQ A;  3MUV P;  2NUU G;  2WW8 A;  3J80 Y;  3OHB A;  4J7C A;  4A8Q A;  4UPK A;  1HNI A;  3FFI A;  4USW A;  2EEY A;  1FKO A;  3SSS A;  2JLF A;  2B7C B;  1DQA A;  1RAB B;  4E8U A;  4JI4 F;  3UD4 P;  1L3U A;  4LF9 J;  2Z56 B;  4EUV A;  2VUG A;  2A3J A;  5LXY A;  1X7V A;  3HVW A;  5C2G A;  4K4Z A;  1RWU A;  3IM9 A;  2EG2 A;  4DR6 J;  3MK2 A;  1REV A;  3CDA A;  4U8V A;  2OIH A;  5I3P A;  4A48 A;  2R2S A;  1SXL A;  3W60 A;  1TKZ B;  1DQ9 A;  2DR5 A;  2OTJ S;  1VOM A;  4GKK F;  4U7C A;  1ZEB A;  2ZM6 F;  3T1Y J;  4ECT A;  1SB6 A;  2EWH A;  5B0C A;  1QSS A;  1SJQ A;  3IAS 9;  2BE2 B;  3MEG B;  4LFC F;  2HNY B;  4J9N A;  1MMD A;  2NXE A;  5KFO A;  4KQZ A;  1RT5 A;  3HCX A;  4RW6 B;  5CAB A;  2IM3 A;  4OYO A;  2KHC A;  1N34 J;  1PIL A;  1HI0 P;  3A8K A;  4EGL A;  4DR5 J;  1S0V A;  2JRS A;  2HLT A;  5D4L A;  2JC0 A;  1S77 D;  1HNX F;  3DLG B;  2VAS A;  4LSZ B;  3HSZ A;  4M5L A;  4RBU A;  2XQC A;  2K3K A;  1KRP A;  2PMH A;  5J2M B;  1EQM A;  4LBP A;  3M8Q A;  5H9F J;  1BQM B;  2BVZ A;  2ZZT A;  4H4K C;  2YNG B;  1YTY A;  1UW9 A;  2EKY A;  5B0E A;  1RBL A;  1F3F A;  2V94 A;  1RA7 A;  4IG3 A;  3M8Z A;  3F73 A;  1S1T A;  3WC2 A;  2Y0S D;  3DLL Q;  3DLG A;  4X65 F;  1WEL A;  2N7Y A;  5IT0 A;  3OXF A;  2ASL A;  3I0R B;  3QWP A;  3HSG A;  4ED8 A;  2DRD A;  3PNI A;  4RW6 A;  1NEE A;  3ISZ A;  4ZVR B;  4NI2 B;  5C42 A;  5J2P B;  5JUM A;  2ZBC A;  1NJX A;  3W8P A;  2R7V A;  2HNY A;  1A9N B;  2YQ3 A;  3CDB A;  1J2V A;  3P4U B;  2GSU A;  4JV5 J;  2YPZ A;  3B5Q A;  1Y11 A;  4A8F A;  1H7W A;  3R5A A;  2V63 A;  3GPA A;  4XK8 C;  2BMB A;  3HHL D;  2RQK A;  1LW0 A;  3M8W A;  1ZPW X;  5CYM A;  3MFH A;  1RT2 B;  4A8M P;  2FTR A;  3TQ1 A;  5FD1 A;  4MIW A;  1TKT B;  3BGL A;  5E2Q A;  4ATN A;  3IGV A;  3I9V 9;  2CFX A;  1UTA A;  2LU2 A;  1A0O B;  5CAA A;  4MTP A;  2I1R A;  1RXO B;  3K17 A;  3S7R A;  3GIK A;  5KFV A;  2JH3 A;  3I0R A;  4H4M A;  2Z0G A;  4CO0 A;  2JEF A;  1O8B A;  2KM8 C;  4E2F B;  2WSC C;  4KFB B;  1FX2 A;  2YXL A;  2E9R X;  4RL1 A;  3P5T L;  3KNA A;  3PXG a;  4GVB B;  4RWX A;  4C48 A;  3M6U A;  2WSF C;  1KWM A;  1TL3 B;  4KHM A;  3US5 A;  2KM8 B;  2U1A A;  3UR3 C;  3PJW A;  2BRL A;  3OLA A;  2CDQ A;  4C9D A;  4NLP A;  1RCO B;  3AJD A;  5K8N A;  3CO9 A;  1EW8 A;  3GYN A;  3FRZ A;  2M2B A;  3M2V B;  3MK0 A;  4K50 A;  1ZA1 B;  1CJU A;  2JLE A;  2KRR A;  1T9V A;  5ETM A;  2GW8 A;  4CLZ A;  5DET A;  4JI0 F;  9RUB A;  4CLU A;  4UPL A;  1VIX A;  1SH2 A;  2V8G A;  3IFE A;  1OYD A;  2WHO A;  4I2Q A;  4M5N A;  3KLE B;  2G4B A;  4V1A k;  1I51 B;  3ZFV A;  2W5R A;  2E5L J;  2K1R B;  3MEG A;  1QUV A;  1JJ4 A;  4DSL A;  4DR5 F;  4ZK7 M;  1IJF B;  1BLU A;  1YJR A;  1FDD A;  3QAU A;  5HQ8 A;  1Q81 T;  1UL3 A;  5C5J A;  4FYW B;  2CQC A;  1KFD A;  3EX7 B;  1BQN B;  3KLH A;  1URA A;  2BJ8 A;  3KHG A;  2MLZ A;  1RAI B;  1CJT A;  2XMT A;  4RPF A;  2AIR B;  5HMW A;  4YP3 A;  1REV B;  2Z4P A;  3OJS A;  4DV7 J;  1VQO S;  2AHO B;  1T9U A;  4FN5 A;  2LMI A;  4DX8 H;  1TKD A;  3U7J A;  2G0C A;  3L3C A;  1WOP A;  1C0U A;  1IKV A;  1PCA A;  2FZG B;  2GIQ A;  2OI2 A;  5HO4 A;  2UP1 A;  4EEY A;  1LW2 A;  1M1G A;  1V3S A;  3AFG A;  4KO0 A;  5KAK A;  1QAI A;  5C7P A;  1GTH A;  1V9O A;  1OQ6 A;  4ZLN A;  1D8Z A;  1FRX A;  3LUY A;  1TP7 A;  1NRK A;  3K5P A;  2VF3 A;  1ANJ A;  1S6Q B;  1HMV A;  1URR A;  4MIB A;  4RW7 A;  3M32 B;  4HDG A;  1OIA A;  4UUX A;  3HXM A;  2QGF B;  4WF9 Q;  1VBZ A;  3MM6 B;  2DGX A;  3EE3 A;  1CQM A;  1QUP A;  4LRB A;  2WW4 A;  1AJD A;  2A18 A;  3DM2 B;  3TUZ C;  4K4U A;  2X98 A;  4OX6 A;  2J8A A;  5K5M A;  4UOP A;  4PG8 A;  2VDH A;  1QVF R;  3IC1 A;  2XNR A;  5LRN A;  3N6M A;  4DSF A;  2IA0 A;  1MRO B;  2E5L F;  3E01 B;  2ZZN A;  4ES1 A;  5I4M A;  1ELX A;  1K44 A;  2J7W A;  2QA4 G;  2NXC A;  2BEF A;  2WSE C;  4WU3 A;  5SUH A;  3I55 S;  3MR5 A;  1Q16 B;  1TUV A;  3W61 A;  2EK1 A;  4B17 A;  1VHI A;  5J1E B;  1TL1 A;  3K89 A;  1VMB A;  2NSC A;  4ES2 A;  2ZKT A;  4DV3 J;  5EN1 A;  4W92 B;  4YFU A;  1DQ8 A;  2QA4 S;  3QAT A;  5L1L A;  4IR9 A;  3MMC A;  2G0I A;  4HVZ A;  1JLG B;  3LP2 B;  5ETK A;  4PEO A;  4IOA Q;  4AFF A;  2KZM A;  1S59 A;  4X64 J;  2OEM A;  4XAK A;  4TN0 A;  1Q8B A;  2HEK A;  2BXJ A;  4O4R A;  4C11 A;  5IJS A;  3AOB A;  3DDN A;  5KFR A;  3PIO Q;  3GQC A;  2DIV A;  3QZ8 A;  2FLL A;  3T6B A;  4KB7 A;  1Q53 A;  4RW9 B;  1MN9 A;  3U27 A;  2D3O 1;  2M88 A;  5A8W B;  3RAX A;  1ALH A;  1S49 A;  2DGV A;  5HJY A;  5KG7 A;  2P5V A;  3KLG A;  3MMB A;  5ETL A;  3RRG A;  3K8V A;  5KFP A;  3PO5 A;  2W5W A;  4LF6 J;  2VG7 B;  5ETO A;  3GFZ A;  3NVL A;  5D4P A;  1Y9O A;  1X9S A;  1HYS B;  1WG4 A;  2I6W A;  2OTL S;  3H5X A;  3UNG C;  4M94 A;  1U6Z A;  2HBR B;  4WFZ A;  1RP5 A;  2AYE A;  3TUI C;  3LAN A;  5KFB A;  4NLS A;  4ZPA A;  4XIU A;  4LRA A;  1SJ3 P;  3FQL A;  1QY7 A;  3KG0 A;  4OJH A;  1QTM A;  5HLF A;  2JLG A;  2HHW A;  4NA3 A;  2AX1 A;  3CC7 S;  4RUB A;  1WNE A;  3Q23 A;  5H9E J;  1VQ8 S;  3CJQ A;  4PXE A;  3M4X A;  4M5D A;  3NMA A;  1HQE A;  4MK7 A;  1N52 B;  2CJ9 A;  2GIF A;  2W9C A;  2DEJ A;  3IS9 B;  4M5M A;  1VCT A;  3W9J A;  3OL6 A;  2UV8 A;  2W4D A;  2J6S A;  4IOB A;  2RS8 A;  1F2H A;  1ZM2 A;  5DGA A;  2MZJ A;  4QOT A;  1E6V A;  1XMQ J;  4ZLP A;  2F63 A;  1FJE B;  4B3R F;  3MR2 A;  1SJ1 A;  1T03 A;  2MST A;  3I5B A;  2JHE A;  3L7U A;  1X4C A;  3W3S A;  3HDS A;  4Q0B B;  2CYY A;  2GJI A;  1NKB A;  3P5B P;  3DHX A;  1HNV B;  1V3R A;  5E3C A;  3RBE A;  3D9B A;  2HHX A;  2XHC A;  3ONQ A;  1NJY A;  4DV4 J;  1KC8 T;  3GYX B;  5F9N A;  2VC1 A;  4OV1 A;  1K1Q A;  2HS4 A;  3WZ0 A;  3V6J A;  4PAB A;  1RT3 B;  1CC7 A;  4DR7 J;  2ADB A;  1FFW B;  2E1C A;  2MZ1 A;  2BDP A;  2MQN A;  3ZZT A;  4DR2 F;  4M5K A;  3R7N B;  1B7Y B;  2CPD A;  1R8P A;  4K4W A;  4DR4 F;  1VIO A;  2IA6 A;  3I9Z A;  4HYK A;  4CQ1 A;  1NCL A;  1FK9 B;  1VRU A;  1S1X B;  5T41 A;  4YS2 A;  1AUK A;  4USU A;  2K7K A;  2VG5 A;  2XSJ A;  4B56 A;  4NLQ A;  3IDD A;  2DR9 A;  3I31 A;  1R89 A;  1SC6 A;  2BAN B;  5G4D A;  2UVR A;  2ZE2 B;  1NJI T;  1TL4 A;  4DMZ A;  3E3X A;  2J7U A;  2VPW B;  4P72 A;  1GX5 A;  3C6U A;  2RT3 A;  1IKX A;  3TR5 A;  1BC6 A;  3MAA B;  2XCP A;  1Q95 G;  2B9X A;  1C4A A;  2N4D A;  1N2L A;  1QSY A;  2EW9 A;  2CPE A;  1GMW D;  2YNI B;  1XQI A;  2VPZ B;  1KOO A;  3MM7 B;  2P2C B;  3IA0 A;  4ZJO A;  4Q44 A;  2H5J B;  2LFV A;  4NAS A;  1N0U A;  3TAR A;  4JI4 J;  3HSD A;  5DO2 A;  4LF9 F;  1ZAV A;  3SCL E;  3FEZ A;  2OML A;  3PO4 A;  2JEJ A;  2HQI A;  4J9M A;  3TOQ A;  4DV3 F;  3GE9 A;  3MUM P;  2IVF B;  3V6D A;  2GSN A;  1R6Y A;  1X60 A;  4P2M A;  1VQ5 S;  2ZFH A;  1DAX A;  3P96 A;  3QNW B;  5IOL A;  3C6T A;  1QE1 B;  2BX6 A;  1ZZF A;  2H9Z A;  4Y2C A;  1IKW B;  3SV4 A;  5D3G B;  2CVE A;  2AYG A;  2UVU A;  3O6Q A;  3GU0 A;  3I0S B;  4AL7 A;  3PM9 A;  2GS8 A;  2IRU A;  3CSK A;  4I2P A;  5ETT A;  3JSM B;  3RB6 A;  4ZVO B;  3VQT A;  1VQ4 S;  4UQG A;  1U09 A;  3MDF A;  4F4Y A;  1CS4 A;  1JLB A;  2W9B B;  2CA9 A;  1LWE A;  3A3P B;  3N5B A;  3QAE A;  5F8G A;  3HJF A;  4FPR A;  1LWE B;  2A0F B;  2V2V A;  2ZHA A;  3CW2 C;  4F4A A;  5KG1 A;  3DDI A;  3KFW X;  5B08 A;  3NS6 A;  4QWE A;  1YLX A;  4NI2 A;  3M9M B;  1HNZ J;  5H9F K;  1WF2 A;  4RUC A;  4K8R A;  4AND A;  3V81 A;  5I3U A;  3NKR A;  2B6A B;  5ETR A;  3C6T B;  3D0G E;  3EVO A;  4NZ7 A;  3M2R B;  4DPU A;  3NKM A;  2CQ2 A;  3MM5 B;  5DJB A;  4RU9 A;  1UVL A;  2FD2 A;  5DG7 A;  4YN3 B;  5HI7 A;  1U1P A;  1FFS B;  1FVS A;  1YZ7 A;  2EFP A;  3GJR B;  2LEB A;  1OPZ A;  1H38 A;  2QFI A;  4QBU A;  2KG0 A;  5IC6 B;  1WSR A;  4Y0F A;  5FLX U;  5D0R A;  2ZH8 A;  2UV8 G;  2UXB J;  1WEZ A;  2QTW A;  1S97 A;  4ID5 B;  2CPZ A;  2HQD A;  4DV0 F;  5E3R A;  2YWF A;  1U02 A;  4KPY A;  1NDK A;  1S5Z A;  2Z8Q A;  3JSY A;  5KT3 A;  5HMZ A;  2X3D A;  3MUT P;  2EFG A;  3BGR B;  4K7Q A;  3OVA A;  2MKC A;  1HQU A;  3MAA A;  3GII A;  4G1I A;  3OTO F;  4DPW A;  1FD2 A;  2VZ9 A;  4CZC A;  4C97 A;  3SSR A;  4O0N A;  2C2K B;  3WDO A;  3NCR A;  4DQI A;  4K4X A;  2GHV C;  1X5O A;  2X1G A;  4OX8 A;  3E51 A;  3KJN B;  3WX4 A;  3MAQ A;  2FJX A;  2B5J B;  4M63 A;  1H0H B;  3CJ3 A;  5AXK A;  3R7S B;  3DXB A;  3MEC A;  1NSK L;  2HRU A;  4IRK A;  2R42 A;  4BC9 A;  5DLT A;  2LDI A;  2VG6 A;  1T8E A;  1JKH B;  2EFO A;  2XSF A;  2UZA A;  2FHO B;  3WC0 A;  4EWT A;  4AE5 A;  2RS2 A;  2WOM B;  2HQF A;  4ZN3 A;  1N36 J;  3I4P A;  3BM7 A;  4DU8 A;  3QT7 A;  5KFI A;  5JMN A;  1P49 A;  5DQH A;  1SJR A;  1KSP A;  3LAK A;  4RUH A;  5KOX A;  1NSA A;  3LXQ A;  1WTF A;  4B3O B;  1XMQ F;  3ISN D;  3R97 A;  3HMJ G;  5F8L A;  3T9N A;  4USH A;  5J2N B;  2E7W A;  4EYH B;  3CCS S;  2XEX A;  2V4Q A;  4RBT A;  5KT7 A;  5GAE U;  4JI7 F;  3ITH B;  1GTE A;  4JBC A;  4K2X A;  5K14 B;  5K4P A;  4DSI A;  3UW1 A;  1Q4R A;  4QIF A;  3M8S A;  2QL7 B;  1X4E A;  1M5S A;  3BO4 A;  3VAM A;  5J2Q B;  1VQM S;  2J7K A;  4L6V 3;  3HK2 A;  4FKX A;  1WC0 A;  2NYH A;  2YH0 A;  3CD7 A;  4ZPV R;  1JLQ A;  2KYZ A;  2ZJQ Q;  2HHQ A;  4MT1 A;  3G86 A;  3I32 A;  3AA8 A;  1FHT A;  4A8S A;  4EBE A;  3DRR B;  4B9S A;  2IY5 B;  1RK8 A;  1SVD A;  5KG4 A;  4DF8 A;  1IKY A;  2WB1 D;  5T7L A;  2AV5 A;  3NKO A;  4URQ U;  5CD4 A;  2PT0 A;  4ECZ A;  3KXD A;  1DJ0 A;  3R6L B;  3G8T A;  3J80 U;  4JV1 A;  4P10 A;  2Y1L B;  1KHL A;  2W5V A;  4YQW A;  4KHR A;  1KDN A;  3CD5 A;  1M90 T;  4X2B A;  2D1C A;  3T5J A;  4RW4 B;  4F3Q A;  4LFA F;  3AXM A;  4Y6I A;  1KQG B;  3PCO B;  1R0A B;  2XRG A;  3D0H E;  4EFA C;  2RIJ A;  2CZV C;  1I5O B;  2J8S A;  2YNF A;  3POT B;  1HDH A;  3N6N A;  1LQ9 A;  3DFE A;  4B9M A;  2HS3 A;  1F60 B;  1KQF B;  2YKN B;  3DKD A;  4DLE A;  4ELV A;  2HYI B;  1RQ0 A;  2MKY A;  4NPO A;  1EIY B;  4M95 A;  1S6P B;  2Y9H A;  4NWX A;  3U1N A;  2BJE A;  2K8G A;  4UUW A;  5L46 A;  4U9R A;  3DYA B;  1T05 A;  4RKU C;  5HJX A;  4AL6 A;  1BE4 A;  3BSA A;  3R2C J;  4IFV A;  4DPT A;  2GQQ A;  4R8U A;  4PKD B;  2JVO A;  3LPY A;  1OY6 A;  2V2Z A;  3IG1 A;  3DCA A;  3W2V A;  5GRR A;  4Q43 A;  1SIW B;  1IVZ A;  3KHR A;  1HJK A;  4U7U K;  2NXU A;  2M3D A;  1OQ3 A;  3OUY A;  3AJ2 A;  1TL1 B;  4DDF A;  4TKT A;  2GZO A;  3RW7 A;  4ZPW R;  1UZD A;  4JI2 F;  5IV4 A;  4JI8 F;  2CWK A;  3JQM A;  2O1P A;  4USK A;  1GXU A;  1VIS A;  2WAQ D;  3Q8Q B;  2FLP A;  3NNC A;  2XI2 A;  1KR4 A;  2MZR A;  3N01 A;  3RB4 A;  1QD1 A;  3JXO A;  2Z2M A;  1FFG B;  3PIP Q;  1JX4 A;  1PKU A;  3FKB A;  5DG8 A;  3RTV A;  1QSL A;  3HHD A;  5CH7 B;  4WYW A;  1WEX A;  4YEA A;  1PYS B;  3TVY A;  2F8M A;  2VJV A;  4K5R A;  2HGM A;  5BYQ A;  5M2R A;  5RUB A;  3P6Y C;  3GIM A;  3DRP A;  1QM9 A;  2F4F A;  3EGN A;  2HGL A;  4NLD A;  4NXN F;  2IYI A;  1HLW A;  1FWL A;  2ZHO A;  3U1L A;  4CH1 A;  3VAG A;  2MZT A;  2OPP B;  1FJC A;  5KXA A;  2ZH5 A;  1KOH A;  2JEG A;  2GQ2 A;  1N33 J;  4I69 A;  1NDC A;  2ZH1 A;  4Q8E A;  1TKX B;  1JWW A;  3T02 A;  2Q6B A;  3OTC A;  1H74 A;  1FRL A;  1F5B A;  1M0S A;  1UVI A;  2LQ9 A;  2NZC A;  3W5X A;  3TAP A;  3QO9 B;  4LQY A;  1JIH A;  4NEZ A;  3Q8S B;  4QU6 A;  2RIL A;  2N82 B;  1DRZ A;  1NND A;  2BE9 B;  3NG8 A;  2VDI A;  3RAQ A;  1N5Y A;  1MSW D;  1S4F A;  5D0G A;  1N2K A;  5HN0 A;  2DCL A;  5J1P A;  3SFG A;  1S7I A;  4EYI B;  2KVI A;  1R27 B;  2AYB A;  3NCQ A;  3EPG A;  2BJ3 A;  3KMS A;  2VKR A;  2GQC A;  3PJ9 A;  2DYA A;  4X4S A;  1X4D A;  3B82 A;  3BQ1 A;  1WHW A;  2AJ2 A;  2V68 A;  2OJ3 A;  2HND A;  3GCX P;  5INH A;  2J9C A;  4I0W A;  3SQG A;  1FSU A;  2QRR A;  2FVC A;  2OPR A;  1WAC A;  4LFB F;  3R8Y A;  3M6W A;  1TU0 B;  2YX4 A;  1UJ6 A;  4HI2 A;  1IXK A;  3OR1 B;  4J5O A;  2D3O R;  4ALZ A;  4ETZ A;  2FJB B;  1T05 B;  1P9Q C;  2PD1 A;  1HW8 A;  1Y3J A;  2ZVS A;  4CO3 A;  3PRB A;  4WKY A;  4MKB A;  1D8Y A;  3ISN C;  2RUG A;  4JI3 F;  1Y0H A;  5AXN A;  4N47 A;  2ZH9 A;  2CQ3 A;  1N5V A;  2A10 A;  2PA3 A;  3Q83 A;  3EUN A;  3FSX A;  4NCB A;  3C16 B;  3I4H X;  3SDE B;  5KFN A;  1TL5 A;  4OYA A;  3KJQ B;  1S1U A;  1S1W B;  4ZP8 A;  1YRU A;  2DD8 S;  4FS1 A;  5EGH A;  3CDE A;  1IWA A;  2R4F A;  3QBC A;  2BJ7 A;  3ICL A;  4MK9 A;  3BH6 B;  3ELH A;  3QFW A;  5IFM A;  3GV5 B;  1NK9 A;  2W2P P;  5A8K A;  3Q8R B;  1KQS R;  4Q7A A;  2AWZ A;  1VRT B;  1UCN A;  1EKR A;  3RRK A;  2HVZ A;  3MPU B;  1S4E A;  3JAM U;  1RGV A;  4KFB A;  3VZH A;  2ZC4 A;  2IMW P;  3IGZ B;  1AB8 A;  3H42 A;  2W5X A;  3BYR A;  1FDA A;  4H4M B;  2CJB A;  1WI8 A;  1TK5 A;  4E98 A;  4DR4 J;  2MQ8 A;  3GLJ A;  5LMU F;  4F26 A;  3PZP A;  4KJD A;  4JP8 A;  3BKF A;  3BGF A;  3PJX A;  2VBX A;  3SQO P;  3PW0 A;  2LEP A;  2KO1 A;  3ILI A;  3M2U B;  2YBV A;  1UWA A;  4DXL A;  4YUD A;  1NKE A;  4QU7 A;  4DSE A;  5EX0 A;  3G87 A;  1KVK A;  4LVO P;  3K5O A;  2HIQ A;  5K14 A;  1AUD A;  3QJP A;  4QYZ K;  2VFS A;  1AFI A;  4ED0 A;  1RT7 A;  3GWC A;  4KR0 B;  5EX3 A;  5KFZ A;  5EDW A;  2XGQ A;  4X65 J;  1E2S P;  5D78 A;  3T00 A;  4UPI A;  1MWZ A;  4OJ1 A;  4DL7 A;  1GXT A;  1NDP A;  1WSV A;  3BH7 B;  2V50 A;  2YWG A;  3BSN A;  5L0E A;  3T5K A;  1NZ8 A;  4M5H A;  5HRO B;  4Q5V A;  1N88 A;  2QMW A;  1IQT A;  3UFC X;  2NPI A;  1NLK L;  3GP9 A;  3DLE B;  5KFT A;  3OR2 B;  2KRB A;  2HFS A;  2J9D E;  1AT1 B;  1JKH A;  1M1H A;  5HK4 A;  4LVN P;  1O5J A;  2AJF E;  3JTP A;  2LXF A;  2W2O P;  1PAE X;  3HJV A;  1EAR A;  5E3P A;  1I3O B;  1YI2 S;  1OJ4 A;  3W66 A;  2ASJ A;  3C46 A;  4I56 A;  2OSR A;  2ATC B;  2MEW A;  2CNN B;  4O3O A;  3QGI A;  3CJ0 A;  2KXN B;  1EZZ B;  1GNK A;  2QZ8 A;  2KT5 A;  4FXV A;  2H4Y B;  2YWK A;  4TXS A;  3ZXW A;  2RRN A;  2ZEJ A;  2R7O A;  3BSC A;  2ZH7 A;  1M5O C;  3DGP A;  5DLF A;  3FEY B;  2QL9 B;  5A2Q Y;  1HQU B;  4N8N A;  4OZ5 A;  1CJK A;  2ACY A;  3OVS A;  5GOV A;  2HFV A;  1NDL A;  4EU0 A;  2R8H A;  2VQF F;  3HVT B;  1RDR A;  1RWP B;  4WYL A;  1N5Q A;  3DLJ A;  3ET6 B;  4O44 A;  3DLK A;  4O3N A;  3VAI A;  3QRR A;  2HAF A;  3NKN A;  4P2X A;  1S79 A;  5AJ9 A;  1KFS A;  4ICL A;  2ZUG A;  1JB0 C;  2OHD A;  3R2D J;  2D1G A;  4EMD A;  5KTQ A;  2GA3 A;  3BPS P;  1DY3 A;  1FER A;  1RT1 B;  3CCV S;  4OZL A;  4ECR A;  1TKZ A;  1YX2 A;  1B64 A;  2YX1 A;  3MM5 A;  5AE2 A;  3TZX A;  1JXV A;  3M2R A;  2GMH A;  2W7O A;  1ZED A;  1RKJ A;  2HFN A;  4IH6 A;  4A47 A;  3KLF B;  4MFB A;  2QSF A;  3R9L A;  3E8O A;  3THP A;  3FNN A;  4CXS A;  2ATL A;  1JK9 B;  2EC2 A;  1IBK F;  5DZ6 A;  3BPD A;  4M1K A;  4RW8 A;  2PA8 D;  2CJX B;  2CJA A;  2J5A A;  5HAO A;  2ZOF A;  1W2B R;  4EZ9 A;  2ZBI A;  1ELO A;  2B0G A;  1DLO B;  1UVN A;  1RHM B;  1Y3K A;  4QPX A;  2C3P A;  2N3O A;  5BR8 F;  1RAD B;  2F4V F;  2BUN A;  4RNH A;  4CP5 A;  2G2Y A;  1HNI B;  2W9B A;  2JDJ A;  1CS4 B;  1BGX T;  1LKZ A;  1DHM A;  1E6Y B;  3D6H B;  3KLI B;  3TZW A;  1RHR B;  3M1V B;  8AT1 B;  1Y5L B;  5B0D A;  1T95 A;  4HH1 A;  1T7P A;  1IKW A;  1WOS A;  4QR0 A;  4LRD A;  1RLC L;  1QE1 A;  2E9T A;  3BDF A;  3BEG B;  3GZ7 A;  4TNO A;  3CGI A;  4CT9 A;  1FRK A;  2DR8 A;  5C24 A;  1CLF A;  2OP5 A;  2IDE A;  3D67 A;  1ZET A;  4DFP A;  1VQY A;  3KG1 A;  5HQM A;  1G1X A;  5AJ3 F;  1EW9 A;  1HWJ A;  1U2C A;  3AA9 A;  3R3T A;  2HIY A;  4KGK A;  3W2W A;  4YDD B;  1PYT A;  3HT0 A;  1LK5 A;  3BO2 A;  1VQ7 S;  4DZD A;  2C3O A;  4PG7 A;  3QQC D;  3ZNJ 1;  4YHH J;  4U96 A;  1UFW A;  4F4Z A;  1WUU A;  2KFZ A;  1B70 B;  2DJW A;  3EGW B;  3SCI E;  4Z2X A;  1JJH A;  2GO9 A;  2NR0 A;  5CZX A;  3MD3 A;  2RD5 C;  4UPH A;  2UUB F;  1UEK A;  2LA4 A;  4R25 A;  4UOF A;  1FJ7 A;  2XTJ P;  5HRT A;  3HFZ B;  4Z37 A;  4Y2A A;  2HVH A;  3NKQ A;  3R5C A;  3EIC A;  3A12 A;  1DTQ A;  3HX9 A;  4QYR A;  1FK9 A;  1VRU B;  3Q2S C;  2XYP B;  1Q8L A;  2YKM A;  2Q1L A;  3HKZ D;  1CUL B;  4RX6 A;  1IR2 A;  2U2F A;  2R7X A;  1NPK A;  2CNO B;  4CLL A;  1KVJ A;  5A6W A;  3F0N A;  2VV5 A;  3UDV A;  4DPX A;  3GV7 B;  3E2D A;  1FKP A;  3I6P A;  4I6Y A;  1LXJ A;  2HHH J;  5HSP A;  1JLC A;  1VJW A;  2JC1 A;  1AUS L;  1C1B B;  4LIW A;  3CIZ A;  3CCM S;  3T1H J;  1RYR A;  1TUG B;  2LXI A;  1QLN A;  2W5T A;  1FRI A;  2LEA A;  3OT9 A;  1FJG J;  3NNH A;  3CTR A;  2E66 A;  2J9E A;  1TK0 A;  3MTJ A;  3RW6 A;  1MNE A;  4HT7 A;  9ATC B;  4DR7 F;  1UZH A;  4DPY A;  2UU9 F;  1U1O A;  3P49 B;  4OYM A;  1D09 B;  4LBI A;  5KFE A;  3A8E A;  3BKT A;  2RQC A;  4NLU A;  3BQ2 A;  4DL2 A;  1E6V B;  4P52 A;  1KTV A;  3VAL A;  3KYL A;  4C8Y A;  4C3M A;  1RWM B;  2GVZ A;  1N36 F;  1SV5 B;  4KGM A;  1A7G E;  2IPO B;  3R27 A;  1WC1 A;  3KK2 B;  2XMV A;  1ZM9 A;  1YRX A;  1YJN S;  1HQE B;  4EBD A;  1WWH A;  5K9F A;  4M5D B;  3RBZ A;  1X5T A;  2RAQ A;  3PAC A;  4TU7 A;  2MHN A;  2ZBQ A;  4CLP A;  2ZHB A;  4ZPD A;  1SQG A;  4UY8 T;  2IFY A;  3OTE A;  1R8C A;  1K47 A;  1TR0 A;  1ZA2 B;  4OV6 A;  2R7R A;  1VHF A;  5KFG A;  5ETV A;  2D3Z A;  2DH9 A;  2RSQ A;  2FQQ B;  2VFT A;  4HTJ A;  4WU2 A;  4KH1 B;  4XDC A;  3TEG A;  1KHJ A;  1RTJ A;  3J7Z 5;  1DUR A;  1FKP B;  1TVR A;  3JYT B;  3FBF A;  3PDN A;  4LF8 J;  1FWK A;  5LSR A;  2A1B A;  1TVR B;  3JYT A;  3RRH A;  2DNH A;  1RTJ B;  2DNK A;  2YKM B;  1BMQ B;  1O6X A;  2H54 B;  3CCL S;  2AU0 A;  1YIJ S;  2B9W A;  4JYA F;  4CH0 S;  2WVD A;  1DTQ B;  1L3T A;  2VQR A;  5IM0 B;  2ABY A;  2EFN A;  4C8K A;  5CA5 A;  2OEL A;  8ATC B;  3CPW R;  4DX6 A;  3WHI A;  4OZJ A;  2EC0 A;  3HFK A;  2UUW A;  3FBB A;  3MCO A;  5F8H A;  4UW2 A;  2G9O A;  3N9U C;  4ZJL A;  3NY0 A;  4DV0 J;  4J9R A;  3T01 A;  4C0H A;  5GAE I;  3D66 A;  3O5T B;  1IM6 A;  4A4J A;  3KK2 A;  4D3H A;  3GIL A;  2R7T A;  2KH9 A;  1UAW A;  2FC8 A;  3ZTR A;  5H9E K;  1HBO B;  2B9Y A;  3T5L A;  1RHJ B;  2IRY A;  2WBM A;  3LA0 A;  4NLO A;  2IVM A;  3QFH A;  1HW9 A;  4BBY A;  3LP0 A;  3G6Y A;  2VFU A;  3RB3 A;  2KKH A;  1HNZ F;  2DNN A;  5L0B A;  2CPJ A;  2VPY B;  1G6B A;  3ILO A;  4ZA1 A;  4WK3 A;  1C1C A;  3BBC A;  4HDH A;  4O3Q A;  3KUH A;  2H65 B;  2XLJ A;  1X4B A;  4LR7 A;  4CLF A;  2GC8 A;  2ZNZ A;  2ROE A;  4ZLJ A;  1I6J A;  5MAO A;  4IRD A;  1WF1 A;  1X5S A;  2HZA A;  2A2D A;  4KGZ B;  3CCT A;  1C0T A;  3MM6 A;  3K59 A;  2HG4 A;  2YY3 A;  2BOA A;  1NH7 A;  3LWM A;  1RZM A;  4ZLL A;  3HT3 A;  4BLG A;  3PKM A;  5C66 A;  1AA1 B;  2V4R A;  3VAH A;  5CCL A;  4DUZ F;  5HP1 B;  1HR0 F;  5DLG A;  1H7X A;  1KHW A;  5JVG Q;  4OI2 A;  2XO7 A;  4MKV A;  1DLO A;  2GNK A;  4PYA A;  4B3M F;  4KO0 B;  1JLA B;  2APO A;  3PTW A;  4GO7 X;  4OYP A;  3A8I A;  2QG9 B;  3B4D A;  3U02 A;  3C8Y A;  4WWS A;  2RE1 A;  4P7V A;  2RU3 A;  2LQ5 A;  2X1F A;  3NCP A;  1OO0 B;  2H1Y A;  4KC5 A;  2ZJR Q;  4MFB B;  4CO1 A;  1NAQ A;  1ZBT A;  4IKA A;  3KLF A;  4ECY A;  1P8G A;  2DHS A;  1CJT B;  2HRT A;  4EBC A;  4LSL A;  4OL8 A;  4Q8F A;  4RJV A;  1BQN A;  1RIS A;  4FVM A;  3KLH B;  2BV3 A;  1T0T V;  3PR5 B;  1RT1 A;  2RB7 A;  5KFA A;  4DR3 J;  5I42 A;  3QWU A;  1SKR A;  1HI1 A;  2V8V A;  5K8O A;  3Q8U A;  3CUN A;  4G1P A;  2VH7 A;  4ICL B;  5CYJ A;  4DI6 A;  3HHL C;  3CME S;  4KGV B;  3IBW A;  3V4M A;  2XMK A;  3K7R A;  2X3G A;  5ADZ A;  1V5V A;  1FNX H;  4XDD A;  2DNP A;  2UVV A;  2XZD B;  4J9P A;  3PW5 A;  3QMQ A;  2DHG A;  1U45 A;  2Y1I A;  4LF4 J;  3VAJ A;  4C3K A;  4B9T A;  4QW8 A;  1WF0 A;  2N7C A;  1UWB B;  1RWO B;  3AOA A;  2K3I A;  5BXI A;  4UT4 A;  5DQG A;  2MQP A;  3IWX A;  4HHH A;  1LV5 A;  4CCH A;  3DGP B;  2UXC J;  1Q5Y A;  4OYX A;  3W5Y A;  2ZH2 A;  4GRS A;  1RHK B;  2IM0 A;  4N41 A;  5E3A A;  3KDN A;  4DR2 J;  2YWE A;  1D1U A;  4QPT A;  2JSX A;  3K57 A;  4JOU A;  2DNR A;  4C0O C;  2Q6C A;  2MGZ A;  2B4P A;  3P45 B;  4ZDN A;  4DU7 A;  4CT8 A;  3QLH B;  4F3M A;  1FEE A;  3MOJ B;  2HWT A;  2LQJ A;  2MQL A;  4NCA A;  3SIP B;  5D0E A;  3CCZ A;  4RW8 B;  4CH7 A;  4DL0 C;  1URN A;  4U67 Q;  2XWY A;  1WKK A;  4EO8 A;  1VQK S;  2KT3 A;  1IQZ A;  1S1V A;  2L41 A;  3BKU A;  3G82 A;  3PR4 A;  4DS4 A;  2UXD J;  4ECS A;  2WVB A;  5HQL A;  1NHV A;  5KG2 A;  1ZTW A;  1F5A A;  3VVT A;  1SH0 A;  1K8A T;  1V5I B;  5D77 A;  2AP6 A;  4DN0 A;  3CJ8 A;  2G1D A;  2L9W A;  4JV2 A;  1KHN A;  1VR6 A;  3CO0 P;  5G0R B;  2B56 A;  2IYG A;  4NLV A;  5B09 A;  5GAH U;  2ZC3 A;  1N6Q A;  4OLP A;  2QEX S;  3MMA A;  1FJG F;  3I5A A;  2NCK L;  1HPZ A;  1EB0 A;  2DK2 A;  3PHE A;  4ANE A;  1XNQ J;  4WZM A;  1T11 A;  2LQB A;  3EMT A;  2XUL A;  3D1Q A;  1WC5 A;  3UVJ A;  2MPU A;  4O3S A;  3QSY B;  1J27 A;  2HBQ B;  3F41 A;  3HVT A;  4ED5 A;  2AJ4 A;  5KT5 A;  1CJK B;  2Y1J A;  4DV1 J;  2B8P A;  2IRX A;  5HVF A;  4Y00 A;  4OYZ A;  3M8Y A;  2VJU A;  3MPW A;  2RHQ B;  4KV8 B;  1G3O A;  4TLQ A;  2MQO A;  1NK0 A;  2NLW A;  5IQQ A;  3U1M A;  3DLH A;  3DPC A;  6AT1 B;  1EAY C;  3Q24 A;  4CXU A;  2X1B A;  3VAF A;  3TO8 A;  2YNG A;  3DOK A;  2JVR A;  3NS7 B;  4JV0 A;  3KTQ A;  1N5T A;  3D3C J;  5DLW A;  4F50 A;  3DLB A;  3TG0 A;  3K5N A;  3MCN A;  1VC6 A;  4P2F A;  2ROG A;  3CMA S;  3CJ5 A;  1S1W A;  3M6V A;  2WB4 A;  3W62 A;  2XC9 A;  4DSJ A;  4E0D A;  1U8W A;  4ZCK A;  1XMO F;  2MZS A;  4ZVF A;  3HPO A;  2VD3 A;  3ETO A;  1Y5I B;  3GSI A;  1N54 B;  3N6L A;  3VZI A;  4C0B A;  3BDG B;  4ZN1 A;  2GAG C;  1FNO A;  2HHT A;  4X66 J;  2H5E A;  4J91 A;  2ILY A;  4ZIV A;  7FD1 A;  1RT5 B;  4QWB A;  4C8Z A;  1FRJ A;  4QIV A;  5CYQ B;  2E9Z A;  1D9A A;  4WJB A;  4ED1 A;  1NXI A;  4KY3 A;  1DTT B;  1F3V A;  1UVM A;  1MML A;  2ROP A;  3EWG A;  3SQG B;  4J9U E;  4ED7 A;  3QSI A;  3T5H A;  5H1S V;  1DAR A;  2R7S A;  2BAB A;  4J90 A;  2ZJP Q;  3BGU A;  5KT6 A;  5K20 B;  5HAT A;  2EBE A;  1IBM F;  2UUC F;  3CIM A;  4NA2 A;  1RTZ A;  1H73 A;  2DGU A;  1RT6 B;  2JFK A;  2ZM6 J;  4A8W A;  4PWD B;  3NOG A;  2Y3Y A;  1MU2 A;  2UVW A;  2W5S A;  3DRS B;  2AT1 B;  3TAQ A;  1BWE A;  3B54 A;  1RYS A;  5ETS A;  3JQK A;  3BBB A;  1MWQ A;  3ZTP A;  3Q89 A;  3MHY A;  1AJB A;  3M7V A;  4CLS A;  5A8K B;  4C2M A;  1H2V Z;  3IR6 B;  1MWY A;  3WX8 A;  1YSJ A;  2MKI A;  2OEK A;  1KD1 T;  4L75 A;  2YVS A;  3MI7 X;  1HWK A;  3NBP B;  3AB2 B;  4GTW A;  3WAV A;  2SXL A;  4L72 B;  3SDE A;  1YHQ S;  2OAU A;  5BYR A;  1C0T B;  2BQ3 A;  1RAH B;  2D74 B;  1GXL A;  1PIE A;  2P6T A;  2OPQ B;  3D5M A;  4USM A;  3MUR P;  4ANC A;  3KK3 A;  4LSN B;  2VOO A;  2V5H G;  1BUX A;  2VFV A;  5KT2 A;  4FDI A;  2KXF A;  4BS2 A;  2KVQ E;  4JI2 J;  4LF1 A;  2GFF A;  3OR1 A;  1EI6 A;  3GMG A;  3SFU A;  3TAM A;  3X3U A;  2ILZ A;  3NAI A;  3OD2 A;  4BDP A;  3R5J B;  4FYD A;  1S12 A;  1L3K A;  2BRK A;  5AE1 A;  1SHN A;  3B78 A;  3UO0 A;  2EG1 A;  2HNZ A;  1HYS A;  4JI0 J;  1IUJ A;  3NWR A;  3EPI A;  3NNA A;  3VCD A;  4KPC A;  3W64 A;  4ZCI A;  2VHG A;  1CG2 A;  1HBM A;  3MD1 A;  4M5G A;  1G7C B;  4WE1 A;  3P8B B;  1HHT P;  1HBO A;  2PN6 A;  3WAX A;  4DR1 F;  1XR6 A;  4HHU A;  4WE1 B;  2DGQ A;  3OFF A;  2DO4 A;  2C2N A;  2DKO B;  4WXW A;  2AGQ A;  1OWX A;  4Y2K A;  2AGP A;  1AZS B;  1HQA A;  1VBY A;  4C8O A;  1R0C B;  4NA1 A;  2BZ2 A;  2E5J A;  3PYD A;  2VQE F;  2Q3P A;  2IC3 B;  3BN7 A;  3MED B;  5KFW A;  1XMO J;  1KLM B;  5ITH A;  2XLI A;  4LF2 A;  3BB5 A;  1HBN A;  4MIA A;  4X62 J;  1DZ5 A;  3UN5 A;  2XCA A;  3QRP A;  1PAU B;  2CQ1 A;  2XMJ A;  1W25 A;  1OMS A;  3DNC A;  2ASD A;  4CM2 A;  1Y10 A;  2YNF B;  3MR7 A;  4TYB A;  1XC9 A;  4B02 A;  1PC4 A;  1NUE A;  4KAI A;  3IN5 A;  4WPA A;  3H90 A;  2CQB A;  2FLN A;  1TAQ A;  4WFY A;  2A6M A;  2C2M B;  4UOO A;  2CPH A;  3D6M B;  4KT0 C;  4TQR A;  5KFY A;  1O98 A;  4ECX A;  1Z1Z A;  2MY8 A;  3DRS A;  3VV2 B;  2IM2 A;  1MU2 B;  2OUG A;  1CVJ A;  3L7O A;  1T9Y A;  2GJ2 A;  2HQ3 A;  5E7O B;  3S6E A;  2AJQ A;  3IO1 A;  2VL1 A;  2DEI A;  1XNQ F;  5IT9 U;  3KUE A;  4CM0 A;  4RNM A;  1IBL F;  2AZ3 A;  5D6G A;  2W8L A;  3NWG A;  1RBA A;  4PR6 A;  2ZH3 A;  3MZI A;  4RZR A;  4FNI A;  3OUY B;  3HKW A;  3CE8 A;  4QZV B;  1RWN B;  2N4C A;  2HFU A;  1YZ6 A;  3B6B A;  2HAI A;  4OI6 A;  3UDC A;  3ZZR A;  2AD9 A;  2YKA A;  3UDE A;  3IG1 B;  3X1L B;  2B9E A;  2GVD A;  2WVC A;  3F44 A;  1FDN A;  4W98 A;  2LXU A;  1B0P A;  5J2N A;  1G4C A;  5CYQ A;  2IIH A;  2BAC A;  3DYA A;  3GSD A;  1S57 A;  2DB1 A;  2H51 B;  3H5S A;  4OJG A;  1D3W A;  3ETM A;  5FII A;  1SJ4 P;  4B3S F;  4HAC A;  2CJQ A;  2R8I A;  5F8J A;  1CQN A;  5L1J A;  1X4F A;  2QN6 B;  5F9L A;  4CNZ A;  4ZKA A;  3O8W A;  3POT A;  3KDO A;  4JI3 J;  1N34 F;  1CUL A;  4RUA A;  1SL1 A;  2PI5 A;  3HF5 A;  4F7V A;  5A8R A;  4OZN A;  1KH4 A;  4QR1 A;  3KD8 A;  3SV3 A;  2OH2 A;  3J7Y U;  3N0V A;  3BDP A;  4NCG A;  1YJU A;  2XYH B;  4MKA A;  4NOH A;  4CIO A;  2HMI A;  3MPY A;  2B51 A;  1E3C P;  2W8S A;  1HHS A;  1ALK A;  3IGY B;  3GTY X;  2XS5 A;  2ZOG A;  2B4U A;  2D3U A;  1UFL A;  2CJY B;  2EXU A;  2IHR 1;  4KV8 A;  3CD6 S;  1S0N A;  2FJE B;  1NSP A;  4YME A;  3CJ2 A;  1NK6 A;  4JI6 J;  1HQ2 A;  3FMW A;  2QMU B;  3NEK A;  1NB2 A;  1VLY A;  3DOL B;  1RUS A;  2GGP A;  4IDK B;  1JLQ B;  1AJC A;  1FTR A;  1NME B;  3UQS A;  5K8P A;  3UVJ B;  2PC6 A;  3IBC B;  4U8Y A;  3T9Z A;  1U1N A;  5J2Q A;  3MM9 B;  4IQX A;  4NXM F;  2JNJ A;  1HPZ B;  4CWB A;  3J7Y I;  2CAJ A;  2DY9 A;  3MMA B;  3TVK A;  3V4I B;  3OSP A;  4ZG6 A;  1FXR A;  1N6Q B;  4B3T J;  4OZ0 A;  3TQE A;  4C7Q A;  1KEK A;  5C24 B;  3HD1 A;  1I1G A;  1XWL A;  3LP1 B;  5KG3 A;  1F0X A;  4TY8 B;  4J9Q A;  2AYM A;  4Q2L A;  3PVX A;  3HZG A;  4IFY B;  3RBD A;  4YR1 A;  5ETP A;  2IMO A;  1S48 A;  5I3U B;  3KNG A;  4RBV A;  2EI5 A;  1Q0N A;  3G82 B;  4ZVG A;  4F8R A;  1FXL A;  1S1V B;  2OO4 A;  1SUQ A;  3SZY A;  2W2M P;  4DUZ J;  1HA1 A;  1HR0 J;  2OEJ A;  1X5P A;  2WOM A;  2AJ1 A;  2CRL A;  2G13 A;  1E6Y A;  2KI2 A;  1CSJ A;  2CPY A;  2G2O A;  2YQ1 A;  3AD7 C;  3EVW A;  1X31 C;  3DDK A;  5LOQ A;  3MMJ A;  3T1H F;  3N5F A;  3UNY A;  2WBR A;  5A0Y A;  3C14 B;  3MEC B;  2MXY A;  4CTA A;  1U25 A;  1M5K C;  1TQL A;  1WEY A;  5A0Y B;  4J9S A;  2C1E B;  4TU9 A;  1JLB B;  4DJB A;  2CQP A;  4W90 B;  1YJV A;  5KFS A;  3W65 A;  1PSD A;  4Q0B A;  2HK3 A;  2QC3 A;  2I9S A;  1J5O A;  3C2P A;  2W4P A;  3CDW A;  5ETQ A;  3LAM A;  3R5B A;  1WHV A;  2E5H A;  2QLW A;  4ZP6 A;  4DLG A;  1MN7 A;  2D69 A;  4USJ C;  3CF5 Q;  1BQX A;  3V6H A;  1VQN S;  3LP1 A;  3ULH A;  2C2O B;  4JB8 B;  2EFV A;  4AXJ A;  1SKW A;  2HZV A;  1FX4 A;  1U7L A;  2R7W A;  1SHQ A;  3MK1 A;  4ID5 A;  5GME A;  1AXQ A;  1VC0 A;  2M0G B;  3MF5 A;  3LWL A;  1OSC A;  3IP0 A;  3MM9 A;  4OYB A;  3IWN C;  3I82 A;  5I42 B;  4RNN A;  5IT9 Y;  3ET6 A;  4O44 B;  3SEO A;  2KHD A;  1GMU A;  1H6K X;  4QIW D;  1K0T A;  3NKP A;  2JFD A;  2ZBP A;  4IDK A;  4LSL B;  2AEM A;  4P75 A;  3DOL A;  3MGJ A;  4PXB A;  4CI0 B;  2RDJ A;  1ARO P;  1WD6 A;  1IBC B;  1SKS A;  2DNZ A;  1Z4U A;  2KL8 A;  3H4D A;  2DTJ A;  3W9I A;  3L4B C;  2VFR A;  2F65 A;  2F1F A;  2O01 C;  2V34 A;  3AH6 A;  3CJR A;  3CMQ A;  2D41 A;  3EZO A;  3OBI A;  3F56 A;  3TX0 A;  3RR7 A;  1PO6 A;  3EGZ A;  4LF8 F;  5GAD U;  2PE8 A;  3BV8 A;  3PYE A;  4NYP A;  4IO9 Q;  2VG5 B;  3BJY A;  4F0H A;  5KFQ A;  4A8K A;  1WG5 A;  4UOG A;  2V8D A;  3AHP A;  1P1L A;  2BE7 D;  5C2C A;  3OR2 A;  3PEH A;  1DFD A;  3DLE A;  4DV4 F;  2AGO A;  3GJT B;  4FDF A;  4OHX A;  2XNQ A;  3HVA A;  5KFK A;  3LH2 S;  2Q66 A;  1FE4 A;  1S9E B;  8RUC A;  5KOW A;  1S7H A;  2BW2 A;  3ENV A;  3FBE A;  3FC9 A;  2HHU A;  1KVI A;  4IFY A;  5KG6 A;  2P9E A;  4TY8 A;  2HHS A;  1KHV A;  3CVK A;  3D2W A;  2GLQ A;  4NX9 A;  5IXU A;  1WDT A;  5FLX Y;  3HHN B;  3LF0 A;  4PPZ A;  4C3L A;  3TUP A;  3Q3Q A;  2Q79 A;  2DH8 A;  4B9U A;  2FVS A;  3ZZP A;  3HZE A;  3OFG A;  4O0I A;  1W7W A;  2BKO A;  1ED8 A;  2UU9 J;  3WBH A;  4RWW A;  1GMV A;  1T03 B;  3QYY A;  3QPI A;  3G96 A;  1AYE A;  1PJ7 A;  3LGH A;  3M2U A;  4QCL A;  4UZB A;  2ZH6 A;  4NLG A;  4ZIT A;  1VDH A;  2GGP B;  2QT7 A;  2M7S A;  4B3T F;  3IR5 B;  4ZVH A;  6FDR A;  3BS9 A;  4WP9 A;  2F5G A;  2GML A;  3TP2 A;  4ZCL A;  3MXH P;  3VAK A;  3CNQ P;  2QZU A;  1TEL A;  1WC6 A;  1ZAW A;  2DCU B;  4QQB A;  2ZE2 A;  4DV2 J;  4DV5 J;  1Q86 T;  2HHH F;  5D4N A;  1VI7 A;  1EET A;  2JX2 A;  2MHE A;  2KTQ A;  3A52 A;  5KFU A;  4KJG A;  5HLF B;  2WZ1 A;  5F8M A;  2XSJ B;  2NPF A;  2FDN A;  1NB7 A;  4F3O A;  1KNZ A;  2KU7 A;  4DV2 F;  4DV5 F;  2R8K A;  3KUG A;  2FB0 A;  2B43 A;  2L48 A;  1VLO A;  3ZZO A;  4Y2M A;  3SCK E;  1U24 A;  1KHK A;  4DHV A;  2R8G A;  4UST A;  3THT A;  1RT4 A;  2H4W B;  1S1U B;  2PSZ A;  4FP9 A;  2P6S A;  3EJM A;  4OX7 A;  4YB1 P;  2UUA J;  2QYC A;  3HUL A;  3RBX A;  4IRC A;  2VG7 A;  1FE0 A;  2UUB J;  4X64 F;  5JXS A;  2BA9 A;  2XR9 A;  3PRV A;  2NZ4 A;  1YG0 A;  1IR1 A;  2DNM A;  2V6A A;  3NKY A;  1VFJ A;  2OKQ A;  1TL7 B;  2JZ5 A;  3IRX A;  4I68 A;  2XLK A;  1KLM A;  4O4G A;  5E0O A;  5KFX A;  2W5Q A;  1KS2 A;  2IC3 A;  3MED A;  1HNV A;  2OPR B;  3O1L A;  3H59 A;  4P71 A;  3SXL A;  2FHJ D;  1Y7P A;  4I7F A;  3JS9 A;  2BQR A;  1EW2 A;  2L9N A;  4X4P A;  1AZS A;  2W1B A;  1UFK A;  1JLG A;  5IJQ A;  2E7V A;  2LEC A;  4P74 A;  2VON A;  3R1L A;  4YR3 A;  1U26 A;  4P6Q A;  1N5S A;  2DY1 A;  3CB4 A;  2OLW A;  4F0M A;  5AT1 B;  1XR7 A;  1WDD A;  3IS9 A;  1XBW A;  4C8N A;  2RF2 A;  2DR7 A;  3H2L A;  4EZ6 A;  2KT2 A;  2MY7 A;  1U1M A;  1JLF B;  1Q8I A;  4AYB D;  4J9O A;  5DM6 Q;  5TJ3 A;  2D7S A;  2ZIT A;  4L76 A;  4DUY J;  4GKJ F;  2QSW A;  2FLO A;  1KN6 A;  5IZH A;  4ZP9 A;  4LFC J;  2LP4 A;  3N79 A;  3DM2 A;  4FYY B;  1TKX A;  1WKJ A;  1JLC B;  2FJW A;  4NEY A;  4MKY A;  4OHZ A;  3KK3 B;  2PEB A;  4CO2 A;  1VYA A;  5J1N A;  2W8D A;  3WBZ A;  2I2Y A;  3QIP B;  3GCW P;  3HLU A;  1LWC B;  2J0W A;  2FHM A;  1HBU B;  4X84 A;  3UR0 A;  2UXD F;  2MQM A;  4HTI A;  3DRP B;  2K7J A;  3HVR A;  1NZA A;  2H5I B;  1ZEF A;  3ED4 A;  2FC9 A;  5A8W A;  4C98 A;  4WFB Q;  4RW9 A;  4JI5 J;  4DPO A;  4DN9 A;  4LF5 J;  2DRB A;  3SCJ E;  4C11 B;  5DG9 A;  2B4O A;  3VGU A;  1KLN A;  4OZ1 A;  3TI0 A;  2V67 A;  1RT6 A;  4A46 A;  2PDA A;  2YH1 A;  4PWD A;  4OQJ A;  4KYZ A;  2XS7 A;  3HO1 A;  1GAO A;  1GT8 A;  1YIT S;  1TUW A;  3ZNU A;  2UXC F;  2Z30 B;  3R7B B;  1S10 A;  1KH7 A;  1HBM B;  2DNQ A;  1OS5 A;  1RTI A;  4AXI A;  1SL0 A;  4JI1 F;  3QT5 A;  1IM4 A;  2B7B B;  3W2V B;  3W2W B;  3SZZ A;  5CZV A;  1HNW J;  1U48 A;  4IFV B;  3M9N B;  1MRO A;  3D28 A;  1VK8 A;  1BWV A;  4P7T A;  3DOM B;  3TAM B;  2VOP A;  3KKF A;  1HNW F;  3ZTS A;  1S6O A;  3GV8 B;  3OFH A;  4PWU A;  4LSN A;  2CNK B;  2B3T B;  5IS2 A;  3BDG A;  2ASY A;  1GH8 A;  1HIY A;  3DRY A;  5KG5 A;  2HGN A;  2Q43 A;  5LJ3 Y;  3O2I A;  3M1V A;  4Z7C A;  3CDU A;  3KLI A;  1FEH A;  1NHU A;  2YX7 A;  3MCS A;  3NBP A;  4JI5 F;  5F8I A;  3L7P A;  1S6Q A;  2CPX A;  5L39 A;  1R0A A;  1W26 A;  2HKE A;  3KJV A;  1OSD A;  2LDY A;  4LR2 A;  2E5I A;  4FNH A;  2H48 B;  3FJ2 A;  2I5J B;  4PRF A;  2W7A A;  4R0E A;  5AXL A;  2PII A;  2ZWP A;  3A4T A;  4ZVQ B;  1VQ6 S;  1RHU B;  3UDL A;  2C42 A;  4KKO B;  5LQQ A;  3PV8 A;  4WKR A;  1C0U B;  3B8H A;  3D6F B;  2W24 A;  4X4Q A;  5T7L B;  3CCJ S;  1ZOT A;  3M9O B;  2VBW A;  1LOU A;  2YKP A;  3C66 A;  3DRR A;  4V19 X;  5KFD A;  2F40 A;  2J76 E;  1QAX A;  4U6P A;  3J7A 1;  4GTZ A;  3ZO7 A;  2RDI A;  3HD2 A;  1TMJ A;  3WIU A;  1R31 A;  1HAR A;  5LMN J;  1RT2 A;  1SC4 B;  1YVF A;  4RNO A;  3UCU P;  1LW0 B;  3AB4 B;  5CYM B;  5GVQ A;  3G8S A;  1B7F A;  4CYR A;  2W7P A;  1FVQ A;  4ILL A;  2UUC J;  2V9W A;  2MKJ A;  1DTT A;  4USI A;  4EI2 A;  2OD4 A;  1L3S A;  2K1R A;  3THV A;  1S9G A;  4G1Q B;  1T9T A;  2WTF A;  3KLE A;  2HVD A;  3IRW P;  2IM1 A;  4FVC A;  5C42 B;  4HKQ A;  4JUZ A;  2R2U A;  1T02 A;  2DGS A;  1ZAX A;  2EFQ A;  3BBF A;  5CHC B;  4NZ6 A;  4YDX A;  4ERD A;  3T6J A;  3PX4 A;  2AMC B;  4LUB A;  2XS2 A;  4DQR A;  3FZB A;  1LWF B;  2QLX A;  3A1Y G;  3FGV A;  4UQT A;  4B3S J;  2EVZ A;  3R5G A;  4ZIW A;  5EWG A;  3IWL A;  4CXK A;  1VS3 A;  3TJA A;  3NL0 A;  1SQE A;  1ANI A;  1PC5 A;  5GMK a;  4LF5 F;  5FJ4 A;  3DOK B;  5BYS A;  2DHA A;  5D15 A;  3OL8 A;  4GVB A;  2B5J A;  3G6X A;  5KFL A;  3BDE A;  4O23 A;  4NLT A;  4PYD A;  2UUA F;  1O99 A;  3RU0 A;  1U4B A;  3CD0 A;  4Y3C A;  1RAC B;  1FTC A;  4OIX A;  4TVA B;  1ULR A;  5KFH A;  1WTB A;  2F8H A;  1LWF A;  5HRO A;  3J81 j;  3H0P A;  1RAE B;  2VOD A;  1RBO B;  2OGU A;  3TA2 A;  3V5R A;  2VPX B;  5M2P A;  1K73 T;  3CJT A;  2IVY A;  3BGR A;  3M8P B;  4ZVS B;  4ER8 A;  2G1H A;  4GKK J;  1AFJ A;  3AY0 A;  2ERR A;  2RH3 A;  3OTD A;  1UJ5 A;  3UPF A;  4LF7 J;  1GX6 A;  4D3G A;  3JTO A;  4KJI A;  3LW5 C;  2GV1 A;  1S9G B;  2ZNY A;  3BZQ A;  3KJF B;  4G1Q A;  4USV A;  1Q1K A;  4PWW A;  3PW4 A;  2YKQ A;  2BJD A;  3FQK A;  3ZTO A;  2DPJ A;  2DNL A;  2LLZ A;  4FXD A;  4GTY A;  4NLX A;  1Q8K A;  4HEA 9;  3VHQ A;  5J2P A;  4HHJ A;  1U1R A;  2B6A A;  2JWN A;  2BW7 A;  1H3D A;  2PMW A;  1T9W A;  1TFY A;  3V81 B;  1PJ5 A;  2IJR A;  4ZPT R;  3BN4 A;  4OZ2 A;  3QT6 A;  4M8L A;  3SI8 A;  3EVM A;  4KKO A;  5D8H B;  1NHK L;  5KFJ A;  3OSN A;  4FXW A;  1M5P C;  2Z2Z A;  2DXE A;  3D4J A;  4I6A A;  4IG3 B;  4Y28 C;  5E5N A;  5U47 A;  4OX9 F;  2I5J A;  4DOZ A;  2MGZ B;  5DS7 A;  2AW0 A;  3OJU A;  4FBT A;  3MCM A;  1MW7 A;  3TZY A;  1CEZ A;  1JXE A;  2HFO A;  1HWL A;  5JJB A;  3GYG A;  3OHA A;  2KXH A;  3JSM A;  4DV7 F;  2MZQ A;  4KBI A;  4F2S A;  2BM0 A;  3I0S A;  3ZZU A;  2MB0 B;  1ELZ A;  4M5J A;  1VK3 A;  2ALY B;  2NXJ A;  4NRT A;  1FNM A;  2YPY A;  4F4K A;  2DIT A;  2EBG A;  3H5U A;  3WIV A;  4ECV A;  3PW7 A;  4ZVU B;  2DNY A;  3AOC A;  1WJ9 A;  4R5P B;  4OFZ A;  1Q7L B;  2GIR A;  2ZKU A;  3DXS X;  3FDS A;  3T3F A;  1JNZ B;  4X4R A;  3UD3 P;  4F36 A;  3TAN A;  1C1C B;  1R8B A;  3C15 A;  3OFE A;  3FSI A;  2PI4 A;  5B0A A;  2E1A A;  3LAL A;  2DGO A;  4LRF A;  4PXD A;  2HS0 A;  4UZC A;  1GMW A;  3RZA A;  1YJW S;  1FO1 A;  3MM7 A;  3ZC4 A;  1RTI B;  3K8W A;  4WZQ A;  1EQJ A;  5DDO C;  1EP4 B;  1FDB A;  4F4W A;  4UOR A;  2CQ0 A;  3G2X A;  3HHK A;  4C8M A;  5B0F A;  4AL5 A;  4ZG9 A;  2HBZ B;  1OY9 A;  3IMQ J;  4HL9 A;  3JTN A;  4ZP7 A;  3M30 B;  5IT4 A;  4LQ3 A;  4KAY A;  3D1H A;  1N5Y B;  3RGI A;  2XM3 A;  2DGT A;  1Q82 T;  2OSQ A;  2DPI A;  2J6U A;  1N32 F;  1UA1 A;  4PG5 A;  4LR9 A;  3EXY A;  3H20 A;  2FZC B;  4OX9 J;  1AW0 A;  2COL A;  4MMO A;  3IAM 9;  5IM0 A;  2LCW A;  5AJ3 J;  3FFI B;  3PFE A;  1VQ9 S;  1VRQ C;  4RU2 A;  4DCP B;  4C4W A;  1NK4 A;  2XYG B;  4F04 B;  2FY8 A;  2OPP A;  3H8Y A;  3GIJ A;  3BR8 A;  2CZ9 A;  5F8N A;  5A2Q U;  4DUT A;  4WII A;  5HVG A;  5KFM A;  1ZM3 A;  4J9L A;  4F02 A;  1R3N A;  4F4X A;  3MTK A;  2RDD A;  3DU6 A;  2HK2 A;  1UVK A;  2FVR A;  3RUB L;  5T14 A;  1RE1 B;  2IDL A;  3KOA A;  2YQ0 A;  4JV5 F;  2RRA A;  2IUC B;  4DV6 F;  5AXM A;  4NWB A;  1SCJ B;  3TWZ A;  4DSK A;  4ZS6 A;  4WFX A;  4DCO B;  1NBE B;  3CCU S;  2XZW A;  4DCJ B;  2RF2 B;  3LP0 B;  4EK2 A;  1MG7 A;  1FXD A;  1SV5 A;  2E7X A;  2QE5 A;  4B9L A;  2NS1 B;  1YJ7 A;  1Q7Y T;  2ZD1 B;  4K4V A;  3H2U B;  2F9J A;  2M8D B;  4L74 A;  2WON A;  4PG6 A;  1F6T A;  1F9H A;  3CJK A;  1ALI A;  5B0B A;  4TN2 A;  1C4C A;  3GB0 A;  5EWE A;  4I1T A;  1SBR A;  3PW2 A;  4I7F B;  1S72 S;  2L08 A;  4DR1 J;  5LRM A;  2DNO A;  4F2R A;  5KG0 A;  4OI0 A;  2RJZ A;  2GAH C;  4KTQ A;  2DT9 A;  5L1I A;  4C8L A;  3K58 A;  3K2Y A;  1TL7 A;  1U47 A;  1ZM4 A;  5CD4 H;  1VQL S;  1S6P A;  1T94 A;  1YRT A;  2E44 A;  4IQM A;  1XNR J;  1C1B A;  4X4T A;  3MFI A;  1E33 P;  4KH0 B;  3VGT A;  5EGE A;  1UET A;  2C28 A;  2YKN A;  2ADC A;  1GFW B;  2VQF J;  2QV6 A;  1VC5 A;  2NUH A;  1YBT A;  1Z2L A;  2WVE A;  2P9G A;  4HR2 A;  4IG0 A;  3AOD A;  1B0V A;  1RT4 B;  1X4G A;  4QWC A;  4W4M A;  2XY7 A;  4IR1 A;  1K0V A;  4FYX B;  4B08 A;  4KIA A;  2J6T A;  2JOQ A;  4NYZ A;  3HHE A;  4DL3 A;  5F3Z A;  2QIF A;  1LFW A;  4CLT A;  3T1Y F;  2M8H A;  5LL6 d;  2O67 A;  2LA6 A;  4OHW A;  5F3T A;  2AKW B;  2Z58 B;  3G4S S;  1UP1 A;  3AT1 B;  4AQY F;  1SC1 B;  4IYQ A;  3CED A;  4NWJ A;  2O5D A;  4WTY A;  2VA2 A;  1REG X;  2DO0 A;  3LP2 A;  1OY8 A;  1IKY B;  3TZZ A;  3ENQ A;  1X4H A;  2WON B;  3CJK B;  4DR6 F;  3DYC A;  3TVZ A;  3CT9 A;  2GVZ B;  3T1A A;  2MJU A;  5EUH A;  2HWH A;  5MLC V;  5K8M A;  4U95 A;  5J1E A;  4ZMM A;  1K9M T;  4RR5 A;  1RJJ A;  3A8J A;  5JVH Q;  3FCV A;  1YJT A;  4KAV A;  1HL6 A;  1CC8 A;  4I64 A;  4FF3 A;  5DGB A;  1WI6 A;  4B3R J;  1OYE A;  3TW0 A;  2OFG X;  4DF4 A;  1SJF A;  2RML A;  3V6K A;  4DQP A;  4WCE Q;  4DFM A;  4QIG A;  5L38 A;  2DRA A;  1TV6 A;  1Y4Z B;  3J7A N;  1NPR A;  2CWX A;  4UF4 A;  4CDI A;  3A3O B;  3KHL A;  3PYF A;  3QT8 A;  1JLE A;  4F0K A;  5LXR A;  5FDL B;  1PJ6 A;  2XMA A;  2AF6 A;  3CXC R;  1XK8 A;  3N4W A;  4P73 A;  4WIQ A;  1HKA A;  1RSC A;  1WHY A;  2PGC A;  2C2Z B;  3V2U C;  5LT5 A;  4DV6 J;  4DL6 A;  4DL4 A;  1M1K T;  2W9A A;  1I94 J;  2E1R A;  4YB6 A;  1LEO A;  3I56 S;  2MMY A;  3M32 A;  3J81 Y;  1FI4 A;  1HMV B;  2F7V A;  3LPE A;  4FF1 A;  3RYL A;  4LRC A;  2VG6 B;  2FIU A;  4PAA A;  3DHW C;  2V8H A;  3GR0 A;  7FDR A;  1WHX A;  3PY8 A;  2A2C A;  2XBP A;  1N56 A;  5LM7 E;  4R0J A;  3UN2 A;  2ANH A;  1B4S A;  4CRJ A;  2GHP A;  3GFX A;  5L1K A;  1IWG A;  4DR3 F;  2DXD A;  1LW2 B;  2NQP A;  5GMD A;  2KYX A;  3D3B J;  1ICE B;  4N5S A;  2JEI A;  4K4S A;  1SIZ A;  3DC2 A;  3GG1 A;  4Q45 A;  1RAG B;  2O3D A;  5D4O A;  2BM1 A;  4NMX A;  3Q2T C;  2ZUA A;  4NRU A;  5DLV A;  2EKN A;  3EYZ A;  3SZ2 A;  1KKH A;  4YB5 A;  4PUO A;  3G6V A;  1U1L A;  4Y2I A;  4S0M A;  2Y8W A;  3ZZZ A;  4ED2 A;  1N8R T;  1S6U A;  2XMU A;  5D0H A;  1HD1 A;  2AZ1 A;  4HI1 A;  1X0F A;  1ZYQ A;  3KWM A;  4ZG7 A;  2OMO A;  3QGH A;  1U1Q A;  2IFX A;  4LFB J;  3QRQ A;  2VBZ A;  4FF2 A;  1J5E J;  3D6T B;  2HQG A;  2V9K A;  2GJF A;  4N7T A;  5E33 A;  1OPI A;  2MYF A;  1EJJ A;  4I4B A;  3GR1 A;  3ZZY A;  2BKN A;  4QJV A;  3M2V A;  1IN0 A;  1UPP A;  4RLE A;  4RO0 A;  4ZHR A;  3SYZ A;  3ADA C;  1S0M A;  2NRE A;  2IAJ A;  4WP8 A;  2C3Y A;  4GVL A;  1P6T A;  3UCG A;  2QLJ B;  3G71 S;  2CVI A;  1SC3 B;  4K4T A;  4CLW A;  1TL3 A;  3FVY A;  1F9E B;  4CTA B;  4ECQ A;  3T19 A;  5HMY A;  1HHQ A;  3BRE A;  2MJN A;  2K06 A;  3C14 A;  1B3T A;  4GC6 A;  2MKH A;  2RVJ A;  3QGG A;  4KSE B;  2R3V A;  4MYU A;  4L3N A;  4NML A;  4I2P B;  1XN9 A;  4PCQ A;  3W9H A;  1N33 F;  3ZTQ A;  4NYO A;  4CLK A;  1SH3 A;  2XWX A;  3OL7 A;  3CCR S;  5L0K A;  5D3G A;  2DXF A;  1RKI A;  4K5S A;  1RWK B;  3DU5 A;  4RNF A;  1TKT A;  3HHL A;  1VBK A;  2E29 A;  4DL5 A;  2XGP A;  4U7U D;  1IBK J;  4LRE A;  1RT7 B;  4DG1 B;  5C25 A;  2M70 A;  2ZDP A;  3MPV A;  1P9Y A;  4ZVP B;  2CG4 A;  4CO4 A;  1IBM J;  4ENO A;  1UW4 A;  4WP3 A;  2FJA B;  1GQE A;  3L09 A;  4X4O A;  3DLK B;  4AQY J;  4ETX A;  4ELU A;  1ALJ A;  3CMR A;  2R2T A;  2YNI A;  2MSS A;  3FRY A;  3M8P A;  5LSL A;  4LQ9 A;  2Y1R I;  3FCH A;  1BY9 A;  4WFA Q;  3G6E S;  4JI8 J;  2KDO A;  1XEZ A;  4L73 A;  3NAH A;  1ACM B;  3VWS A;  4FS2 A;  4GC7 A;  1S0O A;  1L5U A;  1U2F A;  1X8D A;  2JJ4 D;  4G6V B;  3TA0 A;  1S1T B;  4KGX B;  3FBC A;  6FD1 A;  3QID A;  3O44 A;  1VRT A;  1GK8 A;  2YNH A;  3GIR A;  4UTG A;  3NOC A;  2PFF B;  1RB0 A;  3S1T A;  1X4A A;  4NCG B;  1BQM A;  2MLY A;  3L95 X;  3HP6 A;  5THW A;  3M8Q B;  1YJ9 S;  3S01 A;  3DRX A;  2QA1 A;  2KB2 A;  4UOC A;  4YR0 A;  5A8R B;  2CPF A;  4TU8 A;  1XNR F;  2AX0 A;  4URS A;  2NSB A;  5F0U A;  4AT1 B;  4N8O A;  2ZVI A;  1R0B G;  1V6H A;  2F8E X;  2GA7 A;  5CXT A;  2CQH A;  4DBQ A;  1ED9 A;  4NE9 C;  3VGS A;  1U8S A;  2DIU A;  3G8Q A;  4TY9 A;  2UUT A;  1B99 A;  2OD6 A;  3DN9 A;  3NGT A;  3SSQ A;  3I96 A;  2FHK A;  2FUG 9;  4C6A A;  2M9K A;  2CDR B;  2JL9 A;  1UA0 A;  1M5V C;  3TRG A;  1KBR A;  4FKY A;  3NGK A;  2V8P A;  4AD6 A;  2W2N P;  2DNG A;  2GVD B;  4ED4 A;  4KHP J;  4MH8 A;  1L3V A;  2G9Y A;  2EK6 A;  4G3I A;  3K5L A;  2HND B;  2EPI A;  1KH9 A;  2VKZ G;  4GTX A;  4DQQ A;  3GON A;  2B8Q A;  2CKW A;  3CUL A;  3OLB A;  3C19 A;  4LR8 A;  1NK8 A;  4K0K J;  1FCA A;  2BQU A;  1K7H A;  4MK8 A;  3GJS B;  1Q78 A;  3K0J A;  4KM4 A;  1Y5N B;  4TYA A;  1RAF B;  1AJA A;  1LWX A;  2VA3 A;  3BYP A;  1NM2 A;  2VU5 A;  3P3D A;  1HWI A;  1FT8 A;  5LMN F;  4KRW A;  1R8H A;  3PKY A;  1G2E A;  5EWF A;  2P9C A;  2Z2L A;  1YWX A;  4JI7 J;  3UE2 A;  2W2Q P;  3GG0 A;  3KJV B;  1YBA A;  2FGC A;  3OXG A;  2MKS A;  5HVH A;  1FRM A;  4WXO A;  3NP5 A;  3TNV A;  3C16 A;  3H5Y A;  1H2U X;  4DQS A;  1N32 J;  2PO4 A;  4YHH F;  1QAY A;  2PMZ D;  4XO0 A;  1R43 A;  3KLG B;  3H40 A;  1B8J A;  2HBY B;  2XB2 D;  1YKW A;  1NPP A;  3AQO A;  5E3Q A;  4FYV B;  1Y7A A;  3VQS A;  5DDP C;  4M5I A;  1SKU B;  5CQG A;  4YY3 J;  4PZV A;  1UEU A;  3D1O A;  1YBU A;  3DOM A;  4DZ6 A;  2KFY A;  1NJW A;  4OMF G;  2W8K A;  2BJ9 A;  1HNX J;  3LOU A;  3AJ1 A;  1TMM A;  1E1Z P;  1VQP S;  1X0P A;  4CYU B;  1RHQ B;  2IBO A;  3DMJ B;  2X51 A;  2LKZ A;  2YWW A;  4CO5 A;  2P8I A;  3NXZ A;  3CCW A;  1QJH A;  1RI7 A;  2ZBR A;  2CG8 A;  3DMJ A;  2XG8 A;  4J37 A;  2RU9 A;  4A8O A;  2DGW A;  2HNZ B;  1ROF A;  3AQP A;  3HFV A;  3BGO P;  3IR7 B;  1LNQ A;  4DFK A;  4LF4 F;  1A6L A;  4R8U B;  1J5E F;  3IBF B;  4ILR A;  4NLR A;  1FD8 A;  2HWI A;  2QMX A;  3A13 A;  2WK4 A;  1MLA A;  3D0I E;  3QO9 A;  4H4O A;  3R1H A;  5HAN A;  3EDQ B;  1RTH B;  2MLX A;  2BBE A;  1ZH5 A;  2LU1 A;  1CJV B;  2VB6 A;  3TA1 A;  3TUJ C;  1ZPV A;  1HBU A;  1WG1 A;  2CAD A;  4OHV A;  1LWC A;  3QGP A;  5B0G A;  4OJ3 A;  4O3R A;  2I8E A;  2FYX A;  3QIP A;  4RW7 B;  3O3L A;  3RG6 A;  1EQ0 A;  1CJV A;  2MKK A;  1RWV B;  2R7U A;  2XY5 A;  1P1T A;  3DI6 A;  3D54 A;  4PPD A;  4ECU A;  4B9N A;  4HH0 A;  3NGU A;  3UI3 A;  4RW4 A;  3IGN A; 
#chains in the Genus database with same CATH homology
 1EW8 A;  4UOO A;  4LQY A;  1ANI A;  3M8Y A;  4CXS A;  1O98 A;  4MIV A;  4QAX A;  4ZG7 A;  1N2K A;  4NWJ A;  3WAW A;  4FDJ A;  3T01 A;  3TX0 A;  3DPC A;  4CXU A;  3BDH A;  1Y6V A;  4CXK A;  3DYC A;  1KH7 A;  3TG0 A;  5DLW A;  5DLT A;  1ALH A;  4KAV A;  3SZZ A;  5L0B A;  1FSU A;  1ED9 A;  3UN3 A;  1ELZ A;  2IUC A;  3MK0 A;  3BDF A;  3BDG B;  4LRD A;  4LR7 A;  3WAY A;  3LXQ A;  4MHX A;  4UPH A;  4UPL A;  2GLQ A;  1URB A;  3BDG A;  2W5R A;  4ZGA A;  1EW9 A;  3Q3Q A;  4CYS A;  5K4P A;  4LRF A;  1ED8 A;  2G9Y A;  5EGH A;  1KH4 A;  2GSO A;  1KH9 A;  3WBH A;  3KD8 A;  5C66 A;  4LRC A;  4GTX A;  1EQJ A;  1URA A;  4LR2 A;  4UPK A;  3ED4 A;  1AUK A;  1K7H A;  4LR8 A;  4UOR A;  3UN2 A;  2ANH A;  2W8S A;  4B56 A;  1AJC A;  3IGY B;  1ALK A;  4ZG9 A;  3IDD A;  4KM4 A;  4KAY A;  1AJA A;  3NKO A;  2QZU A;  3IGZ B;  5LQQ A;  2W5X A;  1KHL A;  3A52 A;  5HRT A;  2W5V A;  4LR9 A;  3MK2 A;  4KJG A;  1N2L A;  3NKQ A;  1AJB A;  4KJD A;  3M7V A;  4GTZ A;  5DLV A;  1ANJ A;  2XRG A;  1KHK A;  4CYR A;  1ZEB A;  4GTW A;  3WAV A;  5LIA A;  1HDH A;  4ZG6 A;  3E2D A;  4LRB A;  1E2S P;  1B8J A;  2XR9 A;  1AJD A;  2X98 A;  4FDI A;  4UOP A;  4UPI A;  4N7T A;  3T00 A;  4NWX A;  4YR1 A;  1Y7A A;  1EJJ A;  1EI6 A;  2D1G A;  3OT9 A;  2W5T A;  5LRN A;  5L0E A;  2IUC B;  2W5Q A;  3SZY A;  3TWZ A;  1E1Z P;  1ELX A;  1EW2 A;  1SHN A;  3UO0 A;  5GRR A;  5IJQ A;  3UNY A;  1HJK A;  1ELY A;  2ZKT A;  3WAX A;  1ALI A;  1O99 A;  3M8Z A;  1HQA A;  5INH A;  5TJ3 A;  5LRM A;  2W5S A;  4TN0 A;  5IJS A;  2IFY A;  5L0K A;  3NKR A;  3NKM A;  1E33 P;  5GOV A;  5EGE A;  3UN5 A;  1KHN A;  1KHJ A;  2W5W A;  1SHQ A;  3MK1 A;  2W8D A;  4LRE A;  3NKN A;  2GSU A;  3NVL A;  3B5Q A;  5AJ9 A;  1KH5 A;  1P49 A;  2RH6 A;  2GA3 A;  5KXA A;  1E3C P;  3M8W A;  2GSN A;  4GTY A;  4MY4 A;  1ALJ A;  3CMR A;  1ZEF A;  1ZED A;  3T02 A;  3NKP A;  4LRA A;  2VQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...