4LRDA

Phosphopentomutase 4h11 variant
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSIGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSLLQIAAHEEVVPLDELYKICKIARELTLDEKYKVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase 4H11 variant
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 144
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lrdA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lrdA01
4GTZA 5TJ3A 3SZYA 2W5WA 4LR2A 4UOPA 3NKRA 5INHA 1ANIA 1O99A 3T00A 1AJDA 3CMRA 1KH4A 2RH6A 5HRTA 4MY4A 5AJ9A 3A52A 3B5QA 1SHQA 2IFYA 1KH7A 3IGZB 3UN2A 4UORA 4ZG7A 3TG0A 1ED9A 4LRCA 4UPLA 4LR9A 4ZG9A 3TWZA 5EGHA 4LREA 1HDHA 5IJQA 3WAWA 4CYRA 2W5QA 4KJGA 5L0KA 3NVLA 3TX0A 1ALKA 2W5TA 1EW2A 3WAYA 1E1ZP 3T01A 3UNYA 3Q3QA 5LRNA 3M7VA 2W8DA 1E2SP 4KAVA 3WAXA 3IGYB 1B8JA 3MK0A 5IJSA 3UN5A 1URAA 1URBA 5LQQA 3NKMA 3T02A 3UN3A 1ZEDA 1P49A 4B56A 2D1GA 5DLWA 3ED4A 1Y6VA 4MHXA 1KHJA 3M8YA 1K7HA 2GLQA 5DLTA 5LRMA 3M8ZA 3BDHA 4GTWA 4ZGAA 4NWXA 4ZG6A 4QAXA 5L0BA 2W5SA 3NKPA 1ALIA 4KAYA 1KHLA 4YR1A 1SHNA 4LR7A 1AJBA 3DPCA 1EI6A 3NKNA 1FSUA 2GA3A 4LQYA 1E33P 3WBHA 1HJKA 1HQAA 1N2LA 4CXUA 3NKOA 4LR8A 4LRBA 4MIVA 2GSOA 4NWJA 4TN0A 1ELXA 4FDIA 5GOVA 1EQJA 1ZEFA 2GSNA 1EW8A 1O98A 2X98A 1E3CP 2IUCB 3MK1A 5GRRA 5EGEA 4KJDA 2W5XA 4N7TA 4GTYA 3BDGA 4FDJA 5KXAA 5L0EA 1AJAA 1ED8A 1ANJA 3LXQA 4UPIA 2VQRA 4GTXA 3IDDA 3E2DA 1ALJA 2W5VA 1KHKA 3WAVA 1EW9A 4KM4A 1AJCA 2W5RA 1ALHA 2GSUA 1KHNA 3DYCA 2W8SA 4CXSA 2G9YA 4UOOA 3M8WA 5C66A 3BDGB 3UO0A 5LIAA 1ZEBA 2ZKTA 1KH5A 5DLVA 1ELZA 3KD8A 1AUKA 3NKQA 3MK2A 2IUCA 2XR9A 4CYSA 2QZUA 4UPHA 4CXKA 1KH9A 3SZZA 1ELYA 5K4PA 4UPKA 1N2KA 2ANHA 4LRDA 3BDFA 3OT9A 1EJJA 2XRGA 4LRFA 4LRAA 1Y7AA
chains in the Genus database with same CATH superfamily
4UOPA 3C6TA 5KG5A 4I2PA 4DOZA 2ZH2A 1SC1B 1FKOA 3QIPA 1KRPA 4B3OA 1R3NA 5D78A 4Y2AA 5LMUJ 5CABA 5AJ9A 2DGWA 3NEKA 4XO0A 2QEXS 1W26A 3A13A 2DGUA 3JSMA 1T9YA 1SHQA 2BV3A 4XPEA 2GC8A 2N7YA 3K2YA 2ZHAA 4DUYJ 4QZVB 4M5NA 2KFNA 2WW4A 5DLFA 3PKYA 4DPUA 4YP3A 3HT3A 1H73A 3BPDA 2GIFA 2GV1A 2JDJA 3LP1B 4HHUA 4FF1A 4DR3J 2Z8QA 3PHEA 2OTLS 3C14B 5T7LB 3JYTB 1TKTB 3CJ3A 3I96A 4ZP7A 1V3ZA 1U02A 1WC3A 3EGVA 4ID8A 2P8IA 4WE1A 2ROEA 4O3NA 3T01A 1BD6A 2BMBA 2YWKA 4WP3A 4JV5F 3ILLA 5EHHA 2OPQB 4ZHRA 3GYNA 3ZO7A 4JI7J 4DN0A 5EGYA 3PW7A 2IJFA 2A6OA 3T02A 5E0OA 4DCPB 1H74A 1M1GA 4HI1A 2FC8A 3IP0A 3TAQA 1PJ6A 4CH0S 2R7WA 2HGNA 4YR0A 1J5OA 3M2RB 4OZ1A 2QJ3A 1S6OA 2E5JA 2AYMA 2W01A 1WHVA 1KLNA 1NUEA 3H5SA 1S77D 3H2LA 3E2EA 3I5BA 4RW6B 3DLKA 4QCLA 5IT9U 2DRDA 2KVQE 5KOXA 1P1LA 3Q0AA 2CJYB 2Y3YA 2CZ4A 1NLKL 3DFEA 2Q3PA 4WTOB 1NPKA 1KHLA 4YY3J 4KAYA 4R25A 1M0SA 2L3MA 3HVAA 4LR7A 2B4UA 4DUYF 3FQKA 1NAQA 3FSYA 4JV0A 1RP5A 3OVSA 1LFPA 2Y8WA 1HJKA 1ZPWX 2DY1A 2B9XA 1EQMA 1OY6A 3N0VA 2GQ2A 1JLGA 2NZ4A 4RW7B 2AEFA 1WF0A 2AHOB 2M9KA 1M1KT 3CC2S 2L48A 5FLXU 4LFBJ 4TN0A 2NS1B 4KY3A 3FSIA 3TZWA 1ACMB 1WSVA 1NK9A 1FRKA 2B5JB 2ZOGA 1EKRA 2R2UA 1NKEA 4LVNP 2QL7B 4KGKA 4UOHA 1ZS6A 2VODA 3FEZA 1CJVA 3LGHA 3L7OA 1NCLA 1SIZA 4P2SA 3KYLA 2NPIA 2PA3A 3GV8B 3MEEB 3PW0A 2NUHA 4GRSA 3SCIE 4A8MP 2NSCA 2KYXA 4ECRA 1YK9A 2XBPA 2G1HA 3Q86A 1FFSB 2HNZA 3W62A 2UP1A 4N76A 1CBKA 1PAEX 5DGBA 1U8WA 4F3QA 7AT1B 3LQVA 5HATA 1RQ0A 2PA8D 3DMJA 3MEGB 3HHLB 2VG6A 3HD1A 1WEYA 3K17A 4MK7A 3R5AA 2FIUA 1U1LA 1TL7B 5C66A 3NS5A 5ETTA 3WHIA 2DNQA 3GILA 1NSAA 1YJNS 3BPSP 2VDIA 2RDIA 3BR9A 4NLOA 4ZN3A 5LOQA 1N48A 1SIWB 1YZ6A 2Y0SD 5U47A 5HO4A 5JJBA 3MK2A 2E9TA 3GTYX 3VAGA 1RB0A 4K2JA 2JLGA 1FJCA 4OV1A 2C3OA 3M30A 1VYAA 3WC0A 2BBEA 2GAHC 3BGOP 4DSIA 4RL1A 3RW6A 4JUZA 3DU5A 3ILIA 2R42A 2W2QP 3V81B 3D6MB 3KLVA 1WORA 2RF2A 1AUSL 4DV4F 4DL5A 1T03B 2R7QA 3VGSA 1XWLA 4I6WA 3MEKA 2YTCA 1AJDA 3FC9A 4O3OA 2CQBA 3F0NA 2RH6A 5K9FA 4G6VB 1NH8A 2M2BA 4I0WA 2HBQB 2EI5A 4WBFA 5ETSA 4ZVTB 4A8XA 4RUCA 2XQCA 2L9DA 3MAQA 3R8YA 1IKXA 3OXFA 1TP7A 5HJXA 2XMTA 3BREA 1QM9A 2ALYB 2HBRB 1EZZB 4ZA1A 4C0OC 2WTFA 2YKMA 4M5IA 1P9QC 4XAKA 1MSWD 5F0UA 4PAAA 4X65J 2C42A 3DLHA 3FVYA 3OBIA 4OIXA 3G2XA 3GG0A 5C2GA 4DV4J 1VRTB 3CCWA 3D1HA 3JTNA 5L0KA 3HZEA 3GFHA 3NGTA 3R6LB 4TQRA 4ZP9A 2AF6A 1GX6A 2RKIA 3MECA 4C0BA 4NCAA 5L39A 4FS2A 3DYAA 4NLVA 4UOCA 5H9FJ 3U1NA 2HZAA 2JRSA 4KAVA 2WK4A 3WIVA 2RAQA 4I69A 5DLGA 2JJ4D 1JX4A 5E2QA 1BHNA 2OPRB 2PD1A 3PZPA 1HWLA 5BR8J 2POKA 1HBMA 2OTJS 1QVFR 2E5HA 5J2MA 5LQQA 1NU4A 4MYTA 3E01A 2XM3A 2AU0A 4DSLA 2JVRA 3DLEA 5RUBA 4FYDA 2D69A 4IFYA 1NDKA 1YJRA 3OR2B 2MKJA 1LWEA 5LRMA 5LMUF 2IAJA 1I1GA 4UF4A 4F4KA 3U27A 1EHWA 1RHQB 1GMWA 2GZOA 2LXUA 3S8SA 3MR3A 1YI2S 2AEMA 4NOHA 3EZOA 5GMDA 1VS3A 2DR6A 3AHPA 5BR8F 1RTHA 3FQLA 3Q2TC 2DO0A 2J7UA 2QZ8A 4TLRA 2DR8A 2MSTA 3A8KA 2DXDA 2MQ8A 2Z2MA 4DG1A 1QAJA 3OLAA 2HHHF 2RNEA 5K20B 3DGPB 4DQSA 2ZWPA 3HSZA 4M5KA 4WP9A 5A8RA 5DDQC 1IJFB 2M8DB 4LMZA 1UTAA 3MZIA 3QFHA 4YDDB 2BM1A 4I2QB 1TUWA 2HPUA 3BQ2A 4FVCA 5DDRC 2G1DA 2DY9A 1T05A 1KQKA 3UD5A 2JEGA 1SKRA 2DNZA 2V63A 3KG4A 3M1VB 2V8HA 1RT4A 2M8HA 2WCXA 3MF5A 3SQOP 5IT9Y 2CQ1A 4KE5A 2Z4PA 1QAXA 5GRRA 3AA9A 4RW6A 4K4WA 4F4ZA 2W5XA 4RKUC 2XMUA 3QGGA 3D66A 4OZ0A 5KOWA 4U7CA 3C16B 2E7WA 3PG9A 1H3DA 4I6AA 2DNLA 4NYOA 2YH1A 4NLDA 3FBEA 1D9FA 3IBFB 2HVEA 2Y0BB 4QR1A 5F9LA 1KFSA 3UVJB 2JVOA 1TUGB 4UUWA 4KM4A 4WZQA 3M2UB 2J9EA 1VHIA 2LU1A 5HQ8A 5D3GA 2NXJA 1FRMA 3M4XA 4ES1A 1GTHA 3JSRA 4MH8A 2Z30B 3IG1B 1X5SA 4M5JA 4OV6A 3J81U 2IUCA 2KU7A 1OO0B 1AUDA 5ETVA 4WWSA 2FJDB 1RT1B 2DPIA 2HRTA 3BSNA 2EKYA 2EFPA 3OV7A 3PY8A 3CCTA 4UQGA 4QYZJ 1IN0A 1QSLA 1S5ZA 1AZSA 1WC5A 1F0XA 1JWWA 1MWZA 1X7VA 2Q43A 4P71A 4KB7A 4LRFA 2ADCA 3IAS9 2C2NA 3C3LA 1SCJB 2FJEB 1QTNB 4ILMA 4ER8A 1TV6B 4YDXA 5F41A 1DARA 3UVJA 1NDPA 3W5YA 1ZH5A 1YITS 1RISA 2ZEJA 4L74A 4LF2A 4JI4J 4K4VA 4L75A 1FDAA 2C2ZB 1VOMA 2FHKA 1CLFA 2I38A 4ZJLA 2XMAA 1FK9A 1YBUA 2IC3B 3QZ7A 2ASJA 2VQEJ 2DCLA 1SV5B 2GVZB 5HK4A 3V2UC 3GQCA 1D9DA 5HBMA 2MQNA 1JLAB 4ZG7A 4I4BA 2J6TA 2CNOB 3MAHA 4M5GA 4A4JA 5HN0A 4DR5J 4RJVA 2MHNA 5D4PA 3R3TA 5ETLA 1Q86T 5EGHA 3MUTP 4CLZA 1AZSB 3GG1A 8AT1B 4DZDA 2RF2B 4ES2A 1G3OA 2UV8A 3OTEA 3HVTA 2MY7A 2V8GA 1HD1A 1VBYA 5EX3A 1LWEB 2ZOFA 5J2NA 4UY85 3MPYA 2WB1D 1FEHA 1HBNB 1RWUA 3IMQJ 3TO8A 2KH9A 3V6DB 1U48A 4KHRA 4B3TF 1NHVA 2VBZA 4EUVA 1URAA 4X4VA 2Q6CA 4IG0B 3DOKA 3PW4A 5H9EJ 4M95A 1BWEA 3BH7B 3EZUA 1QUVA 4EK2A 5DLWA 4C8OA 3SSQA 4F4WA 4F3OA 3M8QB 3D3CJ 3MXHP 2CJAA 1M5OC 3PVXA 1JXVA 1RABB 4TY9A 4Q45A 3PR4A 1X4CA 1LK7A 4CZCA 4XDCA 2OPQA 1P9YA 1JLGB 5D0GA 2HHPA 1B0VA 3Q8YA 5EWFA 4NXMF 1NO8A 2LQ8A 4HDGA 4EYHB 4GKJJ 3ENVA 1WF1A 3SDEB 1LWFA 3TW0A 2J6UA 3ADAC 1RU2A 1ZTTA 3L9ZA 5KFQA 4LFAF 1TUVA 2DGVA 4C8NA 1FSUA 2COLA 3CJTA 5AT1B 4DS5A 4DFKA 3HI9A 3TUZC 4DXLA 3CF5Q 4WYWA 2ERRA 2EVZA 2HFSA 2W25A 3NKOA 2GO8A 3G8TA 2V2ZA 1TKXA 2X1GA 1OS5A 1K47A 3IGNA 2QX0A 1UJ5A 2BJDA 2XMMA 4YEAA 4CH7A 1T8EA 1FA0A 4K4UA 4YOEA 4IQMA 1S1TB 2VFTA 4FYYB 2X98A 3JXOA 2EBGA 1O6XA 3IS9A 2PMHA 5K14B 4J9UE 2WHOA 3FRYA 1NH7A 3EE3A 4N7TA 4YY3F 4QOTA 3GMGA 4V19J 4FF2A 2XLJA 4LSLA 1UJ6A 1Q82T 3OL9A 2LYVA 3LPYA 4IKAA 1HNXF 4DEZA 2HFVA 5KG6A 5DRKA 4FPRA 3KJVA 2ZJPQ 4DPYA 1OMSA 2FVQA 1MROA 2HNYA 3CGIA 2OMLA 4M1KA 2HHXA 1I94F 4WTYA 3IN5A 1X4GA 2Y1LB 1RKJA 2IBKA 2VOOA 3MAAA 1VIXA 3AY0A 4ICLB 4OZLA 4ED7A 1WACA 3T5KA 5IFMA 3AA8A 1E6VB 4WJBA 5IS2A 4K5RA 4A8QA 2XO6A 3NL0A 2JEFA 4FBUA 3QGIA 2VASA 3BB5A 1WOPA 2GAGC 3RUBL 5GADI 2J0QD 3KD8A 5HI7A 1OWXA 2QLXA 1Y5NB 3PRVA 3C46A 2BANA 1VQKS 2J7WA 3FMBA 4MTPA 4C8YA 3HK2A 3KNGA 3TVKA 1Y5LB 1U45A 2K7KA 2HG4A 2BJEA 5J2PB 1QUPA 3M2UA 4QU6A 4LSLB 3NG8A 1FNXH 3PNIA 3MEEA 3HHLA 1ZA1B 3PM9A 1V5VA 3TYTA 2QMUB 5BXIA 3R5CA 3LA0A 3G6VA 2A1BA 1SI9A 2GO9A 3MGJA 1R8CA 2UVUA 4CM2A 4KYZA 1O99A 5LMNF 2XULA 2YPZA 2YX1A 2UUBJ 1KTQA 3CMRA 4DPTA 2RS2A 1D1UA 3G71S 3MM8A 3CCLS 5GAGU 4KV8B 2LEBA 1KC8T 1H7WA 2AGQA 1K1QA 5K8MA 4DR5F 2NPFA 1VQPS 4A48A 2HFUA 5KFFA 3VALA 1L3TA 4I67A 1T03A 2H48B 5AE1A 3CJKB 3UR3C 3A8EA 3ISND 2IDLA 3AH6A 3QIPB 5DZ6A 4C8MA 3MCSA 4BBYA 3QT8A 3W2WA 4DFPA 2G0IA 1R8PA 3IFEA 1K8AT 4J90A 4NXNF 2RDDA 5C25B 2ZITA 2R2RA 4Y2MA 4LF4F 2HVZA 4LF6J 2YBVA 3D67A 2M4MA 2HVIA 1XR5A 3DLLQ 2W5TA 4M63A 2QV6A 1HNIA 1LWFB 1ZA2B 3Q3QA 3I5CA 2GMLA 1TKDA 4PEOA 4TYAA 1VISA 3QQCD 3CJSA 3BS9A 4ECTA 3MM5B 5IJSA 1DLOA 3D3BJ 3KLGB 2W7PA 1GK8A 2R2SA 4F4AA 2YNGA 2YNIA 1DURA 1G4CA 1XTZA 1IBMF 1U47A 2CPDA 2HQFA 2YPYA 3ELHA 2F4VF 2QYGA 5T7LA 3JYTA 2BJ9A 1FFGB 2MKSA 4FXDA 1HNWJ 2JOQA 2EFVA 4MMOA 3CULA 2AYEA 2G2OA 3AJDA 4W98A 2Z2ZA 2YNFA 3OTDA 1T9TA 3X3UA 5DZ7A 2Z2YB 3GCXP 1IR1A 1C1CA 3MUMP 4WK1A 1W2BR 2PEHA 1RE1B 2ZWOA 2B0GA 1FKPB 3BBCA 2LXIA 3B8HA 1IBMJ 2GMJA 2R9LA 1NK8A 1ED9A 3ILJA 4FYWB 1XMOF 2ACMA 1VQNS 1UEVA 4ZVUB 1SHNA 2E5IA 2C28A 3R9LA 4YUDA 1F2GA 3MMCB 2CDQA 3R5JB 2D3OR 1BWVA 1M5KC 1AW0A 1NDCA 3RBZA 4YR2A 4ZJOA 3BQ1A 1HQAA 2KKHA 1IWAA 3AXKA 3NY0A 3BO2A 5D0EA 4CLLA 4CXUA 2GS8A 2HURA 2PMZD 4ZK7M 1M90T 3AD9C 1FDBA 4R5PB 3AOBA 1IXKA 2LLZA 5L38A 4F0HA 3M2VB 2CVEA 4UOGA 3MR7A 2BE2A 4HT5A 5AJ3J 4K5SA 3CJRA 1VQSA 2ATLA 3OSPA 1T9UA 3D7SB 3I55S 5F8GA 4IUFA 2RD5C 5B7WA 1WSRA 4JI5F 5KFIA 4WXOA 1V3RA 3DRSA 4HL9A 1Y00A 1PCAA 5KFPA 4DX5A 5L0EA 2MXYA 3HFZB 3A8IA 1T0TV 4NMLA 1U1KA 4F2RA 2VQRA 3R5DA 1VQOS 4KTQA 1JKHB 5BJRA 1C4CA 1RHUB 3AQOA 3HHNB 3X1LB 2UV8G 1MLAA 3DOMA 2ASDA 1Y11A 1QSYA 4RW4B 4Z37A 4I2PB 2D9PA 2GJFA 2HS4A 4NLUA 4Y2KA 1DQ8A 3ISNC 4ANDA 2Z56B 4KSEB 3R7SB 4DR6J 2V2QA 1CC8A 4F50A 4OYIA 1KVIA 2H3EB 4WK3A 4CLSA 1X8DA 3VR1A 3KLFB 2V4RA 1C0TB 1NK6A 1JJ2R 1I51B 2XYHB 2V69A 1H98A 2IVFB 4G3IA 2ZH9A 2BJ7A 4AQYF 4CYSA 2A18A 1C1BA 4CP5A 3PW5A 1FDDA 5HVFA 2I5JB 2XGQA 3VAIA 3RTVA 4HI2A 1F1BB 1I6JA 1IBKF 1D8YA 2QL5B 2W4CA 3BDFA 2H54B 3KJNB 4HLBA 1FO1A 4OHYA 2XSJA 4B9TA 4G1IA 3GZ7A 1D9AA 2WW8A 4CH1A 4LRAA 1IKWA 1S59A 1DFDA 2CPEA 5KFXA 3W9JA 2HAIA 2MMYA 2E1MC 4QYRA 3EPGA 3NGSA 3AODA 4H4MA 4UT4A 4URQU 2LA6A 1FWPA 2F7VA 1BQMA 3D1QA 2EXUA 4OLOA 5J2NB 4IDKB 3HD2A 4ZPTR 2ZM6J 1XMQF 3CCUS 2L9NA 2W1BA 2XCPA 4DR3F 2AYGA 1FHTA 4FZVA 1IWGA 4JI4F 2GVDB 4DUTA 3GJSB 4IFVA 3UN2A 5A0YB 4IR1A 3KUEA 2JFDA 4RX6A 3PFEA 1QD1A 3C6TB 2HHHJ 3H7HB 3B4DA 5L1LA 4YB5A 1N5SA 4LRCA 4AL5A 4JBCA 1HKAA 4LR9A 1HWUA 2BKPA 2E1AA 1S0VA 2K3IA 1Y0HA 3DKDA 2W5QA 4C9DA 2CADA 2UVWA 2JHEA 3QWPA 1TAUA 1FE0A 3M6XA 3ETOA 2RU9A 2ZM6F 4I56A 2GA7A 2XNRA 1W7WA 1D3WA 2RT3A 4H4MB 2PN6A 2G2ZA 2W8DA 2LFVA 2HQ3A 4CXSA 1YBTA 3D1OA 3QSIA 5LM7E 4AL7A 1UKUA 1CPZA 2YQ3A 3MCMA 3N5BA 3G4SS 4IH5A 3LUYA 4C98A 3ICLA 2RHSB 2DO4A 2IYIA 1ZAVA 3NOGA 1YJTA 5HVGA 2WONA 4JI2F 2G0JA 4CQ1A 1M5PC 2KG0A 4PYDA 5L8RC 3ED4A 3EDQB 3WIUA 1YJWS 2VFSA 1C0UB 1EAYC 2FZCB 2VL1A 3DYAB 3POTA 4NLPA 4X4SA 2OO4A 4C2MA 2HHTA 4KC5A 2OSQA 2W2OP 1PJ7A 3K8WA 4DU7A 2VQFJ 1RJJA 2O3DA 1NDLA 3US5A 2AMCB 2XLKA 2CXEA 2YQ0A 3CUNA 2EK1A 2I8EA 2CPJA 1TMMA 4U9RA 3Q8UA 2U2FA 4B3TJ 2IJNA 2LQBA 1U6BA 2CUYA 3M8QA 1WWHA 3DOMB 2QMWA 1RAOA 1ZPVA 1S48A 2EW9A 2CNLB 4MJKA 4OI1A 3J7YU 4QIVA 1UVKA 2CQ0A 4G1QB 3W7BA 2X51A 3LPEA 1IBLF 4F8RA 1URNA 1FRIA 4WFYA 5GAHI 4ED2A 4DL7A 2HMIA 3N6NA 2ASYA 1WHXA 1PBAA 1ELXA 2G2YA 4CNYA 2EK6A 3KLFA 4JI5J 3DHXA 1L3VA 2R8KA 1XERA 4QIFA 5ETNA 1CQMA 2VBXA 3FK4A 1Q95G 3GFYA 2FJAB 3LP2A 3RYLA 3PX6A 3HSGA 3A1YG 1S1UA 4X66F 4IQXA 4RW8B 4RBUA 1KVJA 3IGZB 2OD4A 3EM1A 4FDJA 2EEYA 4TLQA 2HS0A 1UWBB 2CPZA 2PFDA 3GIKA 1RT5A 3KLHA 4KGVB 5E3RA 2UXDF 3HO1A 4DSKA 4Q0BA 4AXIA 3TJAA 1OPZA 1R27B 2NYHA 5ETKA 1HMVA 2OH2A 1VR6A 2XHWA 2MZTA 4LIRA 2GQQA 1RWKB 3EXYA 3TR5A 4DPXA 3BSOA 1ALHA 2QZUA 2VQFF 3OW2R 2PGCA 3EPIA 3PX0A 2R3VA 1SH2A 2VZ9A 1N5VA 1TKZB 2QFJA 4QWCA 3HM9A 4MFBB 4HTIA 1ELZA 1R0CB 2CIMA 1BQNA 2OI2A 4HEA9 2BW7A 1RUSA 3I0SA 2R7UA 1T02A 3M6UA 4LF8J 2CWXA 3SSSA 3V4IA 1HWKA 1JLCA 1TL3A 2APOA 2CQGA 3V6KA 1D0EA 2NR0A 2FC9A 3B6BA 1NXIA 4USMA 4NCGA 5C42A 2DT9A 4UPKA 4ED6A 4UUXA 4DS4A 4NLGA 1EJJA 3B4MA 2Z58B 1P27B 2CNNB 1VQ8S 4K50A 4DX8H 3QNWB 2GIRA 2X1FA 1HMVB 5INHA 3NXZA 2AIRB 2HWTA 1HNIB 2VQEF 5A8WA 5GVQA 3U1LA 4AXJA 3CJQA 3I0RA 5DQIA 1UVNA 1HBNA 3CDBA 1SKUB 1BC6A 4MY4A 2DRAA 2YWGA 4OFZA 5I42B 4LF7F 2ZHOA 3FUYA 2FHJD 2K7JA 1S4EA 3G82A 3ZC4A 4YR3A 3A52A 2J9DE 3I6PA 3VQTA 4C11A 3JSYA 3IWLA 4CDIA 5B08A 3RRHA 4ECXA 3TQ1A 1X9MA 3HSDA 4JI1J 4MIWA 4PUOB 3U02A 3VVUA 1ZM2A 1ZM4A 1YTYA 1NRKA 3RB4A 6FD1A 2C22A 3MM5A 4ZG9A 2CJXB 2HNDA 1PBUA 2YX7A 2DXEA 3LAKA 1FD2A 4R0EA 2RIJA 4EO8A 1JQGA 4ZLJA 2FHJA 4W92B 3PHTA 3SQGA 4WCEQ 3TUPA 2VA2A 4C6AA 2GJ2A 1RTHB 1G2EA 1EW2A 2WRMA 1SVDA 3WAYA 2Y1JA 3PDNA 1M5VC 4PWDB 1NBEB 3CCRS 2B9YA 1DQAA 5HP1B 3IGYB 1WTFA 2DH8A 2WSEC 5I42A 3DYCA 1K0VA 3VAJA 2BYCA 2X1BA 4DV3J 2VJUA 1ZEDA 3T1HJ 3E51A 2B3TB 4ZIVA 4C11B 3HHLD 4KPCA 5A2QY 1KHWA 1FT8A 4OX9F 3CMAS 3QT6A 1OQ6A 4RZRA 2DR5A 2IMWP 3I9V9 4USKA 3GE9A 5DGAA 3K0JA 4WE1B 1RT6B 1AXQA 1F60B 2H1YA 4KFBA 5B0AA 1S6QA 2D3O1 1AFJA 4DR6F 2ASLA 2IM2A 1VQ5S 4NWXA 2RQCA 1H2TZ 4EBEA 5E3AA 3DOKB 1F5CA 5IV3A 1MMLA 2W2MP 1N0VC 2XI2A 4WPAA 1CEZA 3NKNA 1RLDA 3T1AA 1IQZA 3KHRA 3V6DA 2HNYB 3NAIA 4EEYA 1SJFA 1HWJA 1ZZNA 1HR0J 3TAPA 4ZPVR 4KGZB 4CLKA 5SZTA 3KLGA 2XS2A 4LFCJ 3PJ9A 1MU2A 2DNMA 3GP9A 4LBIA 4MKVA 3PTWA 2WSCC 4DV0J 1ZBTA 1UFLA 3ET6B 2XCAA 1S57A 2EFGA 4QBUA 4J9KA 4X4TA 1VQMS 1YJ9S 1SL1A 1A0OB 3CIMA 4DFJA 5KT5A 4JI8J 5AXKA 3MMBB 2UVRA 2IYGA 2XWXA 4NA2A 3W65A 1HPZB 2P6TA 3VWSA 3O2IA 3NMAA 3M8SA 3BDGA 1D8ZA 1W2IA 3I56S 1RU1A 2V4QA 4DV5J 1RWXB 2VFUA 2L9WA 2CPXA 1M1HA 4K7QA 3QRQA 3W61A 1T9VA 3TUIC 5KT7A 3KXDA 4WFAQ 1YG0A 5J2QB 2B6AA 2PO4A 5KT3A 2LQ5A 1OPIA 1LK5A 1S49A 2VG5A 1HHTP 3BDEA 4LF9J 1B7YB 3I0RB 3W5ZA 3FKBA 4K4YA 1TKXB 3DLJA 1DQ9A 1VC0A 2XSJB 3IC1A 3MPWA 2ZH7A 4UOOA 1YKWA 1X5OA 2BJ3A 1DY3A 4F3MA 5F9NA 5ADZA 4DF4A 1FNOA 2GVDA 4DV6F 2ZD1A 2VG7B 3CJ5A 3JQMA 3ZTSA 5A8WB 4QW9A 1Q7YT 3TANA 1AFIA 2L08A 4QWDA 2YKNA 4RU9A 1HWIA 2ZHBA 1NSKL 1KS2A 2ILYA 2WOMB 4TY8B 4C0HA 5GMKa 3KK3B 1WTBA 3P6YC 4RBTA 2ATCB 2MGZA 4ZP6A 3KHGA 4A46A 4X65F 4KO0A 3RR7A 1CS4B 2MYFA 2XYGB 2L41A 2CG8A 4GTZA 3MM6A 4MFBA 5T41A 1TKTA 3SI8A 3NKRA 4ZOSA 4ZITA 5HJYA 3EYZA 2AZ1A 2RILA 1JLEA 5GAGI 4Y2IA 1YGYA 3KK2B 1B4SA 4DV1F 1F3FA 4JI3J 2OKQA 3CWJA 1LWCB 3HPOA 1TZ0A 4NPOA 1KH4A 1H0HB 3QJPA 3C14A 3GJTB 4TXSA 3MECB 2CQ2A 2F1FA 2F9JA 4NZ6A 2UUWA 1QVGR 1RTJA 2B7BB 5E5NA 2FLLA 4B3RF 4UORA 4I64A 4DF8A 4NLYA 4YN3B 2AKWB 4IRCA 4DPOA 2BEFA 5D8HB 3DLGB 2HLUA 3CJ4A 3KWMA 6FDRA 5B0EA 3RAXA 1ICEB 2IJRA 2DEJA 3MR2A 4I7FB 2DD8S 1WG1A 3UR0A 1FXLA 2DNRA 2LECA 3FGVA 4X62J 2DPJA 2EG1A 4XK8C 2DR7A 3OJUA 5L1KA 1HHQA 1LKZA 3DOLA 4OX7A 2F4FA 2WSFC 1K0TA 3UNYA 2MQQA 3HJVA 4O44B 2MPUA 3ULHA 1AROP 1B8JA 1RHKB 2BQ3A 4PXEA 1A7GE 3KUGA 4HVZA 3NKMA 1WC1A 2KB2A 2HS3A 2OFGX 3KFWX 4CTAA 4ED4A 4B9NA 2VPXB 4NRTA 3JS9A 2MDAA 4ZVQB 2W9CB 2V9KA 2HZVA 3BEGB 3J7YI 3KNAA 3UNGC 5E41A 1KHJA 5IWAJ 4DV2J 1VRUB 2IVYA 3E8OA 3HXMA 2XY6A 1RWNB 4FNIA 3Q89A 3R2CJ 2EPIA 3TJ9A 2CPYA 3GSIA 1WC4A 2DNOA 1SJ4P 1SXLA 3SSRA 3ZFVA 1KVKA 1IR2A 2EKNA 4Y3CA 2V5HG 3HDSA 5KFDA 4YR1A 5IT4A 3BKFA 4NRUA 3JSBA 2QMXA 3DPCA 1F5BA 5G0RB 2XZTB 1K9MT 4LFBF 3CCJS 2GA3A 3HSJA 4CT8A 1HQ2A 1YDLA 1R8BA 5M2RA 5KFBA 4FYXB 3R6GB 2OEJA 5CCLA 5A2QU 2FLPA 3S7RA 1N2LA 4LR8A 1FTCA 3U7JA 3NNAA 5GMEA 4HHHA 3TA1A 4RBVA 2EG2A 4LJMA 4NLXA 3BO3A 4OI6A 2VC1A 4TVAB 3UDCA 1EQJA 3AOCA 2KXHA 2FD2A 2XS5A 1BQNB 1TU0B 1SC3B 2XS7A 4PABA 4DQQA 4S0MA 4OZ5A 2H51B 5D4OA 2W9BB 2QA4G 5D0RA 3Q8PB 1EETA 1NJZA 3WX4A 5KXAA 4L73A 1JLQB 4NLQA 5HROA 2GHPA 4C8KA 3GFXA 1B0TA 3N5FA 3QIDA 3IRXA 1X5TA 3TVZA 3K5LA 4DR7F 2HHVA 2HFZA 3FZBA 3M1VA 1ZTWA 1UJ4A 3N6LA 2MJNA 3MMBA 1RT7A 4KPYA 5HVHA 4A8KA 1JLEB 1KDNA 2QN6B 3HKWA 4FN5A 3UDEA 1BQMB 3UDVA 2JC1A 4WP8A 4N5SA 2HIYA 2XMKA 1HQEA 1W25A 4LF5J 2IA0A 3RAQA 3BDGB 2E66A 2KXFA 4P2FA 2K1RA 3ZTRA 4TU8A 5HLFB 1LNQA 2BRKA 3FFIB 1NB2A 4IO1A 1UCNA 4NLRA 5IC6B 4CYUB 3CVKA 9ATCB 4DR2F 3V6HA 2HVHA 1XEZA 4F25A 3CTRA 1WC6A 4DV7J 1BQXA 4K2XA 1P8GA 2UUBF 4NZ0A 1K1SA 2V8PA 1YJUA 2MTLA 4IOCQ 3TP2A 3KUHA 2K06A 2VFVA 3TRGA 3D28A 1UW9A 1RTJB 1NSPA 1VIOA 2ZVIA 3OL8A 2IPOB 1Z2LA 2LP4A 1FVQA 3RU0A 4PXBA 5CYJA 2UVVA 2W5WA 2RMLA 4CM0A 2IM3A 5HQLA 2DIVA 3J7A1 1MWYA 2VG7A 3RRKA 3MMAA 2VG5B 3Q22A 3BBFA 3A12A 3RG6A 4WFNQ 4PKDB 3V4IB 2XI3A 4AT1B 2E9ZA 3JQJA 3M8PA 1N33F 1LQ9A 3CW2C 3NWRA 4PYAA 1L5UA 1NM2A 3I82A 2V68A 3B5QA 5IQQA 1I3OB 3FFIA 1SQFA 4CYUA 1CS4A 1XIQA 3D6HB 4WKYA 3M32B 1FXDA 1X31C 1UVMA 1K73T 1VC6A 3QJLA 3O6QA 3IO1A 4TY8A 1PC5A 2OPRA 1PYSB 3C8YA 3H2UB 3JAMY 1U4BA 1J27A 1BY9A 1VQ9S 1N34F 1FI4A 3MM7A 2FPHX 2VH7A 1PG5B 3KDOA 4ALZA 1SBRA 2UUAF 2FY1A 2O1PA 4XDDA 3OR1A 4DL2A 3B78A 5J1NA 3FBFA 5HBMB 4ELTA 1WHYA 1HQUB 1KTVA 2PC6A 4OHWA 2MZRA 1N4LA 3ILOA 2FVPA 4JI0J 3W8PA 3C2PA 1X0FA 1E2SP 2AJ1A 2DEIA 2H5JB 2M5YA 2Z0GA 2JL9A 1F9EB 1FE4A 3G8QA 3PYGA 4CWBA 4ERDA 1B7FA 5ETOA 1FRXA 1MU2B 2RB7A 4EBCA 4MHXA 5KFAA 1R31A 4DG1B 4WYLA 1KHVA 4W4MA 1R43A 4EO6A 1G6BA 3ZTPA 4ZVOB 3MFIA 4KGXB 1NK4A 4DL0C 3CD0A 2FHMA 4NA1A 1SKWA 1WELA 3SZ2A 1WOSA 1E6YA 2HKEA 3QZ8A 2DK2A 2YH0A 1R6YA 1U1NA 4C4WA 2DCUB 3GB0A 1X5PA 5F3ZA 1NNDA 5F8JA 5D15A 1IBLJ 1DRZA 1RHRB 1O0PA 3IAM9 3AT1B 4H4KC 3E01B 1EI6A 1IKVA 3KJVB 1U49A 3MCNA 1JNRB 2ZZTA 3PEJA 3DRYA 4RPFA 1RWOB 2RRNA 4RR5A 1X9WA 3WBHA 3K89A 1X4DA 2GQCA 2FYXA 2DH7A 4LRBA 1S0NA 1GXUA 1KFDA 1S1VB 2BABA 2CJQA 3DMJB 1FKPA 1FWLA 2CQ4A 2W2PP 3MEGA 3SIPB 2BKOA 5GAHU 3EUNA 2D7SA 5I3UB 4PG8A 3OFHA 3PKMA 1VBKA 3VV2B 5IM0A 2KYZA 2C2RA 3KHLA 5SUHA 2Q79A 1CJTA 3MAAB 1S6QB 3BYRA 1KWMA 2MY8A 5J1PA 2ZNZA 3KG1A 2AQ4A 2O67A 1MN7A 3NBPB 3ZNJ1 1RAIB 3L7UA 5M2PA 3C6UA 3MDFA 5H9EK 2LDYA 1OSCA 4TKTA 1GX5A 2XZDB 3ISZA 4ZPBA 5KG0A 1QE1B 1C2PA 2MEWA 2RUGA 3BGUA 4QWAA 1XC9A 1XNRJ 4W90B 2W5VA 2HHUA 3T9NA 3CDAA 3R97A 2MQPA 2B5JA 4A8WA 3LALA 3UCUP 1DHMA 2GW8A 5J1EB 2WAQD 2HYIB 2FB0A 2W7OA 4DR7J 3EMTA 3QLHB 3VAHA 2MJUA 4OQJA 4Q2LA 1BGXT 4KH1B 4RW7A 3V6JA 1FDNA 3PIOQ 2KT2A 2G9YA 1UVJA 3R27A 1OIAA 3CCMS 3OXLA 3UO0A 1KQSR 4RUBA 1PKUA 5I3UA 2ZKTA 5HROB 3UWTA 3G6XA 4UTGA 1HNVB 2EWHA 3O8WA 4ZS6A 2VB6A 1WKKA 1HNZJ 2A2CA 5IQ6A 3LH2S 4DLGA 5DG7A 4FF3A 4X4OA 3M8PB 1LXJA 2RS8A 3OFGA 3D4JA 3SXLA 2U1AA 3QAUA 2C2MB 4F7VA 2RRBA 2W8LA 3KTQA 3QATA 4P7TA 1LW2A 5ITHA 3QYYA 3EVOA 2QFIA 1VK3A 3IBCB 1H2VZ 2RHQB 1XMQJ 4Y65A 4AYBD 4Q8FA 2YWWA 4ATNA 1HNXJ 1ZETA 2IRYA 2VPYB 1SC6A 1C1BB 2CPIA 5HAOA 3W60A 1RT1A 4OZJA 3FDSA 1UFWA 2QO3A 5B0FA 1GEHA 4USJC 5D4LA 5I4MA 5LSRA 4EBDA 2EC0A 3DRPB 3MD1A 4ED1A 3MD3A 3MWBA 3G9CA 4PRFA 2GIQA 3TEHB 2IFYA 1FJGJ 3H40A 1DJ0A 2BANB 2GNKA 3J80Y 2FDNA 3D0HE 3GCWP 2UUCJ 4X4NA 1S6UA 2YQ1A 4ZLLA 3KLIA 3ONQA 4CIOA 1S99A 4B3OB 1M5SA 3BV8A 4M5MA 1KBRA 5CCMA 1L3SA 2CWKA 3HP6A 1UA1A 1ALKA 3BR8A 4DX6A 3J7AN 1JLAA 3I87A 2HHWA 2VBYA 1NJIT 3A3PB 3EDRB 2MLZA 3GYGA 4KH0B 2XSFA 1U26A 4H4OB 1WD6A 1X4AA 3GR0A 4PR6A 4GKJF 3PW2A 4ZVPB 1UPMB 4G65A 3FCWA 3W2WB 2J5AA 4G1QA 3MM7B 4CLYA 1XMBA 4B9SA 4X62F 5BYRA 4R5PA 2QSFA 3PJWA 1S1WA 3I4PA 3KK1B 3P3DA 4YMEA 3W9IA 2VICA 4CLFA 2HLTA 2H4YB 2KTQA 1X4FA 1K7HA 2OAUA 1N36J 3VCDA 2AWZA 1HFEL 2JEIA 2HSEB 3CO0P 2OGUA 1T94A 2WBRA 4OZNA 5AXNA 3VAKA 3AXMA 2ZJQQ 3O3LA 2H9ZA 3M2RA 3M9OB 4QU7A 3K8VA 2PE8A 2ZKUA 1S1XA 2A6MA 3QRRA 4PQUB 2D41A 1REVA 2KZMA 3HHKA 2YNFB 3QT7A 5DQHA 4I68A 2IAJB 2V4JA 3C16A 3SYZA 1VQ7S 4EI2A 3DXSX 1AT1B 3H0PA 1QDUB 2ZBRA 3IR6B 5CH7B 3OTOF 3RB3A 1M5HA 3RR8A 2AJ2A 1PIEA 4TYBA 2OFHX 1X9SA 3PO5A 4J37A 2NYIA 1EW8A 4DPWA 2F9DA 2OPPB 3V5RA 2ZBIA 3HFKA 2DKOB 3NOCA 2B43A 1UVIA 2R7SA 1HNWF 2CQDA 1T9XA 3DI6A 3PACA 4ECSA 4YFUA 4DV6J 1U25A 4BCAA 4DN9A 1FNMA 5KFMA 3THVA 2V94A 4LF9F 1AJAA 5LL6d 2R7TA 2ZUAA 3TAMA 2CPHA 2OPSA 1ANJA 3LXQA 4NYPA 1ALJA 4CT9A 4YHHF 4Z7YA 4ZVRB 4ZN1A 3KJQB 1NEEA 4FVMA 2KHDA 4OI2A 3W66A 3I4HX 3MM9B 5HMXA 5GAEU 3ZZOA 2VDHA 4X4QA 4J9LA 2NREA 4JYAJ 4HDHA 3LWMA 2KFZA 1AJCA 5K5MA 2X3GA 2W5RA 2W8SA 3MI7X 2HVDA 4WFZA 3ET6A 4K8RA 2UXBF 1Q79A 3PYDA 1IKWB 1FK9B 2IC3A 1JLBA 1PYTA 1KH5A 5DLVA 4OHXA 2HAFA 2YKQA 3TZXA 3DLBA 5CA5A 4F02A 1H72C 4F36A 3F41A 2VPWB 4Q8EA 4CXKA 1ZOTA 2ZFHA 1CC7A 4GVBB 4LSNA 3V4MA 4CO3A 3BO4A 3KJFB 3AJ2A 3DRPA 3C19A 1IJEB 1PSDA 2VG6B 2R4FA 1HIYA 3OD2A 3JB9k 3CMES 1TL4A 2YNHB 1GMUA 3D0GE 2VKZG 4KRWA 4LUBA 3WX8A 1Y7AA 3I9ZA 3KG0A 1NSQA 3W64A 3B54A 3VVTA 1CJUB 3GFZA 3OVBA 5FDLB 1B99A 3TNVA 3ITHA 4GO5X 2R8IA 4DL3A 2QLFB 2R7VA 4DL4A 5DO2A 4B3RJ 1KN6A 1Q5VA 2ZDPA 4O0NA 3W9HA 6AT1B 4YQWA 4GVLA 4JI1F 2E5GA 1RAHB 5AE3A 3HVTB 2AYBA 5KFEA 2ZD1B 1HW9A 1XQIA 3N6MA 3W2VB 5EUHA 5KT2A 3J81j 3VGVA 3DNCA 2BR0A 3UCGA 3J7ZT 2G0CA 2DTJA 2HQCA 4GVBA 1KLMA 4ID5B 5THWA 4KHPJ 2VBWA 4B3SF 1IQTA 4F0KA 2DJWA 1X4BA 2YNGB 1WEZA 4OHZA 4ZCLA 3SEOA 5KFGA 2UU9F 2A2DA 3CB4A 4KQZA 2XWYA 3FRZA 1SV5A 2GVZA 1RKIA 2HGMA 1X60A 1Q5YA 3MPUB 4NL5A 4YB6A 5KFUA 1VRUA 2HEKA 4J5OA 4DUZJ 2B9EA 4USUA 4EU0A 1SUQA 1YRTA 3H98A 3QMQA 4KKOB 4Q43A 3LAMA 4A8YA 4PUOA 2GHWA 4DV2F 1MW7A 1I5OB 2O01C 1N56A 4XTTA 3KKFA 2HK3A 5A8RB 1URBA 3G82B 2XMJA 3WQPA 1U1OA 1ZZFA 3BSAA 3FBBA 3UN3A 2D3UA 2RQMA 3PR5B 1FF2A 4B3SJ 4B56A 1VGYA 2YWEA 5K8OA 2ZBCA 4E8UA 1Y6VA 2O66A 3SMZA 1UEKA 3MMCA 1KQFB 3BJYA 3UD3P 3QJJA 1RLCL 3PRDA 3KMQA 2HNDB 1OY8A 2J8SA 4OZ2A 1SC4B 4PZVA 3ENQA 4GO7X 1T05B 4OLPA 3FZ2A 1GQEA 3LP0A 4ZCMA 5L0BA 3M2VA 3KLHB 1NJWA 1YHQS 2BOAA 3M9NB 3C15B 4J9OA 4HR2A 1RXOB 1WG5A 4M5DA 2DNYA 3UI3A 1Q8KA 4NEZA 4EMDA 3EVWA 4ZMMA 1U1QA 4LQYA 1CG2A 3K59A 5IC4B 2CYYA 3NBPA 2W4PA 5L1IA 2HRYA 4DUZF 4ED8A 1ZYQA 4OMFG 4UQTA 1VBXA 1P1TA 2DNNA 4TN2A 3BKTA 2BACA 3N9UC 4NXMJ 1UAWA 3CD7A 3OTOJ 2PI4A 3N28A 3R1HA 2J0XA 4P2XA 2BDPA 2VONA 1Q8IA 3IG1A 3L7PA 5E3QA 4KFBB 3MEDA 4I1TA 2I0XA 4BWMA 4KJDA 4KT0C 3H90A 1Y3JA 1RAGB 1F3VA 3EGWB 3DRXA 2KJVA 3H5YA 4NCBA 1RK8A 2K1RB 5HLFA 1ED8A 2PFFB 4DV7F 2E7XA 4BLGA 3MURP 3OUYA 2J0WA 2YNHA 4RNOA 4WU3A 3O1LA 1IKYA 4L72B 3MR5A 1KOHA 1S1XB 2YXLA 4HYKA 4ECVA 1N5QA 1UPPA 1XR6A 2EFQA 2QLBB 4MAKA 5A8KA 4PG6A 1Q1KA 2YWFA 2OLWA 2FHOB 3CCSS 1HHSA 2HBYB 2GSUA 2ADBA 1WG4A 1QLNA 1TR0A 2ZBQA 1TVRB 3WC2A 1EQ0A 4NLSA 2V2VA 1DZ5A 3TZZA 3THTA 3MM8B 1N32J 4ECZA 5DG9A 1WNEA 1ZEBA 3CEDA 4V1Ak 2FVCA 4NLTA 3G8SA 2HFNA 1RT4B 1ULRA 2HGLA 2J7KA 3GSDA 4CO1A 4K4ZA 4C3LA 2OEMA 3DI6B 3Q2SC 4IDKA 3IWXA 3KLIB 2B4VA 2MKYA 4KV8A 1GTEA 1DTTB 2HQGA 4R8UA 4U7UD 3FNNA 4F4XA 3A4TA 1LEOA 1QE1A 4KJIA 2BQUA 2BKNA 5CYQA 2IMOA 5IOLA 5FLXY 1RAJA 4J9QA 2R7RA 1KLMB 2E29A 3AQPA 4ID5A 2VV5A 1ELOA 1F6TA 3S6EA 4MIAA 2XY7A 4J9MA 1N36F 3ETMA 4F4YA 4LSNB 1NMEB 3K58A 4USTA 2CG4A 4FYVB 5B0CA 2RKIB 5HMZA 3TEGA 2M7SA 3MR6A 2VC0A 1SQGA 4OI3A 5D6GA 4ZVHA 3MM6B 2P6SA 4ECQA 3RBDA 2JEJA 4PWWA 1NKCA 2V50A 3NGKA 4CLPA 1VJWA 2V67A 3TWZA 2ABYA 3IR7B 1HBMB 2VA3A 2DNHA 4TNOA 4JI2J 3OLBA 3OJSA 2BOPA 1EKSA 2GJIA 3IM9A 3IGVA 1FTRA 4HT7A 5LSLA 1Z4UA 5CYMB 3MUVP 1RYRA 4FP9A 2GGPA 3UPFA 4TU9A 1NB7A 3WAXA 3Q8RB 1N6QB 3M7VA 2CVIA 3PYFA 4R0JA 2MB0B 3PXGa 2E5LJ 2DNPA 1RAAB 2F8HA 4UZCA 3UN5A 1RAEB 3FCHA 2BE7D 3QAEA 1Q53A 3LP0B 1KQGB 1N54B 4RWXA 3QO9B 5K8NA 3IA0A 4O4RA 3AOAA 3CMQA 4BDPA 2W9AA 3BF4A 1P49A 3RZAA 3HX9A 2JLEA 1RBOB 1U0SA 3PRBA 4DFMA 1MG7A 2BX6A 4U95A 4ZIWA 1NK5A 2E5LF 3NS6A 1XNQF 1G7CB 2QIFA 3CNQP 2XLIA 4AFFA 3K7RA 3EZ5A 2DVIA 2HBZB 3SFUA 3OPKA 4IH7A 3IS9B 3TA2A 4ZLPA 3H4DA 1Z2ZA 3DGVA 2VJVA 2MZJA 3SQGB 2N4DA 2FQQB 4CO5A 1SL0A 4CO4A 1SL2A 4JI7F 3RGIA 2HMIB 1XNRF 3NKPA 4MK9A 1ALIA 4O4GA 4GMKA 1B64A 3EJMA 3J80U 3LWLA 1S9EB 3NWGA 3VGUA 2YKAA 1VRQC 3TJ8A 3VTIA 1VFJA 1RI7A 2RQ4A 3AB2B 4X66J 3VAMA 3LW5C 1TL1A 1RTZA 3O5TB 3PV8A 1JB0C 4FDFA 3NKYA 5ETQA 2W9BA 2WB4A 1S79A 4U96A 5IT0A 1HL6A 2CDRB 3DXBA 1WJ9A 4O0IA 2V9WA 4BC9A 4IG0A 1Y5IB 4NYZA 4AD6A 5B0DA 7FD1A 5ETRA 5HMYA 2FVRA 4X64F 4MIVA 1FWKA 1XK8A 4KAIA 3SFGA 5J2MB 2GSOA 1U6ZA 2DGTA 2I6WA 4FDIA 2PI5A 2KN4A 2PT0A 4RW4A 3GYXB 2LU2A 4P72A 3EWGA 1Y7PA 2DHAA 2KM8C 2IUCB 1RT2A 1IVZA 3BKUA 4V19X 2YWHA 2F63A 1GT8A 3R2DJ 2DH9A 2AX0A 4L3KA 4GTYA 1TKZA 2DYAA 2XTJP 1OSDA 5D0HA 4FXWA 1Q8BA 4DZ6A 3JSMB 4GKKJ 1HARA 3E2DA 1Q81T 4ZDNA 2Q1LA 2ZC3A 4C7QA 1OJ4A 4MK8A 1KHKA 3ENAA 3A3NB 5CD4H 1S72S 3G6ES 3ENWA 3WAVA 3DM2B 2DRBA 2G9OA 4R8UB 3GPAA 1WC0A 2IIHA 2BRLA 4PXCA 5K8PA 4Q44A 4ZPCA 2ZH1A 4CRJA 5HANA 1R7IA 5B0GA 2HHSA 1HI8A 2EFNA 3MPVA 3NKQA 1MN9A 4CLTA 4GKKF 2KRBA 1HA1A 4URSA 2FJVA 4USVA 3CC7S 3ZZPA 4JYAF 3CJ8A 3D6FB 2V2KA 4I6YA 1KD1T 3HKZD 1IR0A 1TK0A 4K4TA 2ZZMA 3CCZA 4U8YA 1Z1ZA 4YB1P 3GIJA 1VJQA 3Q24A 2XRGA 3HCXA 1HYSB 3M32A 5EDWA 1IKYB 4DBQA 2XC9A 3PX4A 5CXTA 1F9FA 2JNJA 3A3OB 4WU2A 2QSWA 2BA9A 4N77A 1FKAF 1HQUA 1R8AA 4ZP8A 4ANCA 4F26A 2WZ1A 2BZ2A 3T19A 4NLWA 5FIIA 5AXMA 1FJGF 5HRTA 4Y34A 4OZ3A 2FJBB 4DJBA 4DSFA 2ZZNA 4P10A 4NI2A 1D09B 1DLOB 1UZDA 2O5DA 2Z2LA 4WIQA 4UZBA 2MGZB 2AW0A 3OTCA 3MOZA 1NK0A 1N33J 2XZWA 2HW3A 1KH7A 3MCOA 2CJKA 4C3KA 2P5VA 4K4XA 4QQBA 1RWWB 4X84A 2NLWA 3CCVS 4UPLA 3NGDA 1RT6A 3KLEB 3E3XA 4NASA 1AB8A 1GFWB 2QL9B 3FCVA 3KK2A 1HDHA 4CTAB 1XR7A 2PSZA 4L76A 1RHJB 2B8PA 1HW8A 1R89A 4JB8B 5DDOC 2MKIA 4OJ1A 4HH0A 4XPCA 1S1WB 4EFAC 3M05A 3I32A 4JI0F 2ZOMA 2NXEA 1ITPA 1XNQJ 3C15A 3POTB 1KEKA 2OD6A 4AE5A 5KTQA 5KAKA 4E0DA 1UW4A 2G4BA 1KR4A 1PAUB 2E1CA 2RUSA 1RWMB 2UUAJ 1V5IB 2D74B 3DGPA 1H6KX 1X4HA 4ETXA 3P45B 3HLUA 3O44A 3KHHA 2SXLA 3CC4S 1FRHA 1KKHA 1WI8A 4I2QA 4OI4A 3GV5B 1GH8A 1S9EA 2D1CA 4IFVB 1VMBA 5A0YA 1QTMA 3LTOA 4RWWA 2AGPA 4B9LA 2QLWA 2LQJA 9RUBA 3CDWA 3M6WA 1TAQA 2EC2A 1EP4A 3IRWP 4Y2CA 2DHSA 4O3SA 5JVGQ 2IA6A 4ZVFA 1A9NB 4O44A 4YS2A 4DV0F 4ZPWR 1S1VA 3NMRA 1YJVA 1SPBP 4QAXA 2KI2A 4QR0A 3DOLB 5B0BA 4QPTA 1Y9OA 1Q16B 1N6QA 1AJBA 1O51A 1RWPB 2OPPA 3JQKA 2LQ9A 4FKXA 1T11A 3MEDB 4ETZA 4Q7AA 4MT1A 2UUCF 4J9NA 1NJYA 1E33P 4CO0A 1RACB 1WOOA 4YHHJ 2KG1A 1GMWD 1RT3B 3IM8A 3LO3A 4TQSA 4AL6A 1Q7LB 2RRAA 4B9UA 1OYEA 3D9BA 3J7Z5 3TZYA 5C24B 1CSJA 3R5BA 4NWJA 2CAJA 3D5MA 4IH6A 2FGCA 4ZLNA 5IV4A 5D4NA 1ZEFA 2CRLA 5KFOA 3B82A 3K5OA 5KFSA 4OYWA 1E3CP 1TQLA 1QY7A 3WBZA 5KFWA 4P7VA 3DCAA 2P9EA 4LT6A 2NUUG 3PIPQ 4DR1F 2R8JA 2RQKA 2V4JB 2CQHA 3M9MB 1DTTA 4ILLA 4ES3A 2RJZA 3BN4A 3L09A 4MIBA 4USHA 2YKPA 1B70B 2DB1A 2HWHA 2QA4S 2VU5A 3I5AA 1U0HA 3IXQA 5KFVA 4HH1A 1RBLA 1DTQA 1WI6A 4OX8A 2C1EB 2F5GA 3QGPA 2XGPA 1KHNA 3ZZTA 4NE9C 4DHVA 3H5XA 5LT5A 2M0GB 2XO7A 3DRRA 4YB7A 5F8IA 2ZC4A 1TK5A 1RTIB 2OJ3A 4RLEA 5DQGA 3L4BC 2IM1A 2RH3A 1JXEA 2J9CA 1DBDA 1HBOA 2OHDA 2ZE2A 1Y4ZB 4FKYA 5F8LA 3L3CA 1QSSA 1H38A 2UXDJ 2M52A 1S1UB 2XR9A 1Y10A 5H9FK 4FNHA 3M8RA 1S9GA 3P8BB 2B6AB 5E3PA 2KZZA 3OFEA 4PG4A 2CKWA 2QE5A 3HT0A 3SCKE 4RNMA 3DU6A 3W3SA 5K4PA 2UZAA 3NAHA 1EJ7L 3Q8VA 3ZZYA 4IRKA 2OELA 4X4RA 1RTIA 2KO1A 3EGNA 1GXTA 2FY8A 1YLXA 5TJ3A 3SZYA 1SJQA 4HACB 3GR1A 1YJ7A 1S4FA 5CYMA 4JI8F 4DU8A 3LGMA 3W1YC 4K0KJ 1VQ6S 4OYXA 1ANIA 1Q78A 1YVFA 5DM7Q 2DISA 8RUCA 5IJQA 4PG5A 3VGTA 4B3MJ 2FZKB 2OEKA 1TFYA 2J9DA 4LSZB 4KHPF 2XY5A 4MYUA 4DV1J 1BLUA 3MHYA 4ECYA 3WDOA 2Q66A 5E33A 2N7CA 5CAAA 1LW2B 2W7AA 5ETMA 2DXFA 4LQ3A 1IBKJ 1NJXA 2KL8A 3AAWB 3SV3A 4RW9A 2MZQA 5E7OB 2X1AA 3UD4P 1S10A 2WVCA 1YX2A 2GX8A 5DS7A 3MMAB 2LVWA 1U6FA 2DHXA 4OHVA 4PG7A 4ZCKA 3W8GA 4IYQA 3UDLA 3CT9A 4MKYA 2B8QA 1WEXA 1ZM3A 1XBWA 2NZCA 1FX2A 2NXUA 2YNIB 2WONB 4BWJA 2GHVC 3MMJA 4X64J 3NVLA 3OXGA 3UFCX 5DG8A 1JLFA 1Q4RA 2CJ9A 4O4GB 2MQLA 2W2NP 3JTPA 4UW2A 1UZHA 3THPA 2W24A 2W5SA 3N01A 4K0KF 2D9OA 4BC7A 3UCZP 3U1MA 4P74A 5L9XA 1PYOB 4IG3B 5KFYA 3FMWA 4DCOB 1JIHA 4ECWA 1Q8LA 2DNKA 2GFFA 3RW7A 2F4VJ 1UETA 3CD6S 2WVFA 4JP8A 5JXSA 2CJBA 3NCPA 3G96A 3KOAA 2P2CB 1APSA 1TL1B 5KFLA 2HQDA 4D3HA 2VHGA 5G4DA 1FD8A 1I94J 3CCQS 1HLWA 2HFOA 3PYEA 4EZ6A 5HP1A 1CJTB 1NZ8A 1S12A 3J81Y 1RA7A 3AB4B 5FD1A 5GADU 2R8GA 5C25A 2E44A 3MK1A 2CQIA 2VUGA 2IDEA 1PJ5A 1WHWA 1WDDA 3A8JA 3NGUA 2RVJA 2V34A 3QBCA 3SBMA 1KOOA 1L3KA 1FJEB 1RT5B 2AJFE 2F3JA 1YZ7A 3BGLA 2PDAA 5KG3A 2JX2A 4ZHRB 1H2UX 2LKZA 3GWCA 1F2HA 4P2MA 2P9GA 4P9SA 2AGOA 4DR4F 4ELUA 3QO9A 4QYZK 2PMWA 4EWTA 2MKKA 3DLKB 2KFYA 3OL6A 3CXCR 2CFXA 1YRXA 3GIIA 5LXYA 5IZHA 2K8GA 4DR1J 1VDHA 3H8YA 2DGXA 3T41A 2B56A 4QJVA 4LFCF 3DDIA 3T5LA 2C2KB 1WKJA 4ZVEA 3F44A 2QRRA 5CD4A 3D2WA 1HR0F 3K5MA 2RDJA 2DNGA 4ICLA 5I3PA 2V8VA 4FPIA 4EGLA 3ZZRA 1SH0A 2W4DA 4GC7A 2C2EA 1EARA 3LF0A 1SB6A 2F8EX 2ZDOA 4OJGA 4ECUA 3HHLC 4DSJA 1LFWA 2XYPB 4X4UA 3RRGA 4AQYJ 3I0SB 1IKVB 2ROGA 1HBUA 3KMSA 4HACA 2GCFA 5FJ4A 2C3PA 3BGRB 1EW9A 4M8LA 1SQEA 2CZVC 2WOMA 3FJ2A 1JK9B 1FKOB 5DETA 4DV5F 1LW0A 2E7VA 3BN7A 3OTBA 1O8BA 4J9VA 3ZZZA 3GV7B 4DR2J 2J0SD 3N79A 3FEYB 1HYSA 5LIAA 4N8OA 3K57A 2WVEA 3H4BA 1PILA 2ZH8A 1XN9A 4Q0BB 3RB6A 4F2SA 2QLJB 2C3UA 3R1LA 5DDPC 3MOJB 3BGFA 5EX0A 3SZZA 4P52A 4C97A 3FEXB 5CZXA 4OYMA 5D77A 2ANHA 1JLQA 1UMJA 4O3RA 1HQEB 4RNFA 4F04B 2BJ1A 3OUYB 3GJQB 1GXLA 4IOBA 2ZVSA 3ZZ0A 3QRPA 2NXNA 4DCJB 1U0HB 4FXVA 4NZ7A 2MZSA 1X0PA 2JFKA 2B4OA 3MTJA 3S01A 5KFHA 4K4SA 1SH3A 2AD9A 1BXNA 3M6VA 1MNEA 3F73A 3CDEA 2JH3A 1VLYA 3GIRA 4OYOA 1YBAA 4L6V3 2CQ3A 3KK3A 3H59A 3P5BP 4H54A 4X2BA 2M70A 4GC6A 1OYDA 1YQHA 3CIZA 3UW1A 3ZXWA 3CPWR 4JI3F 1J2VA 2IVMA 2LXFA 4B17A 1OY9A 1KNZA 1CQNA 2N3LA 1TFWA 1RYSA 3DHWC 3CE8A 3T6JA 1RBAA 1RA6A 1TELA 3R7BB 4N56A 2P9CA 2ILZA 3CDUA 4LREA 5A76A 4B3MF 1XMOJ 3ZTOA 4KJGA 3CJ0A 3GJRB 2YX4A 2BW2A 3PJXA 3T6BA 5KFCA 2J6SA 2LCWA 4QIEA 2AV5A 3TX0A 1VQLS 5KFRA 3TOQA 1C0UA 5GAEI 2BE9B 2MZ1A 3BYPA 1E1ZP 2FGOA 5LRNA 5KG7A 2YKMB 1JJCB 3ITHB 2DHGA 5G0RA 1KP6A 5H1SV 5C5JA 2FJWA 4DWIA 4LBHA 2IM0A 5KG2A 1AA1B 2I9SA 4O3QA 4TU7A 2B9WA 3KLEA 1K44A 3AFGA 3NCQA 1RT3A 3JAMU 2YKOA 3TVYA 4WZMA 2ZNYA 4USIA 1HI1A 2AZ3A 2QYCA 2QTWA 3NRBA 1XJWB 2MLYA 1RTDB 4ZVGA 3EX7B 4K59A 1S9FA 4EZ9A 4HKQA 3CJKA 2J76E 2FJXA 5DLTA 4DX7A 4QWBA 4I7FA 1F9HA 3M8ZA 3BDHA 3HFVA 4GTWA 4LF6F 3CO9A 4ZGAA 4Q2MA 1UA0A 2KRRA 3DRSB 2VIHA 1NHKL 1T3OA 4N8NA 3H5UA 3C6UB 2LEPA 3TUJC 2JZ5A 4DLEA 1U1MA 1RADB 1N34J 1BUXA 4RNHA 1S1TA 3ZNUA 5LSOA 5LJ3Y 1B0PA 3QFWA 1FX4A 1YWXA 2D3ZA 3AD8C 3FSXA 1R8HA 2CA9A 2UXCF 2HQIA 2X3DA 1UEUA 1DTQB 4U67Q 1LW0B 5EWGA 4J9PA 1AYEA 2OPSB 1NK7A 3IWNC 3OVAA 4ENOA 1J5OB 3D6TB 2Y1IA 3DLEB 4N47A 4Y00A 1HBUB 5F8HA 5KFNA 1KSPA 2HNZB 1H7XA 4KHMA 4NEYA 3AD7C 2KT5A 4RO0A 4Y6IA 5AXLA 5MLCV 1O98A 4QIGA 2X7IA 2VKRA 2B7CB 2JC0A 2RSQA 5CZVA 2YKNB 2VFRA 4JI6F 4CLWA 1G1XA 1IBCB 3NGRA 3FBCA 3P5TL 4URGA 5EN1A 1DAXA 1HNZF 2XHCA 2VPZB 3GIMA 3C66A 2FLOA 4ELVA 1Q0NA 1S7IA 3TQEA 3RAMA 3R5GA 3TARA 1PGZA 3GONA 1U8SA 2H5IB 1SJ3P 2LDIA 5DM6Q 3UQSA 4LF5F 2BVZA 1N8RT 4ITSA 3OQ2A 3VF0B 2C2OB 2LMIA 3F56A 3M8WA 5F3TA 2DHHA 3HZGA 4Y0FA 1RAFB 4J9SA 1FEEA 1LV5A 4B9VA 3G86A 4C8LA 2B4PA 1F5AA 4RUHA 3EGZA 1V3SA 1CJUA 4WXWA 1JKHA 1N5YA 5K14A 3CJ2A 1MMNA 2E1PA 4U7UK 5LJ5Y 1HPZA 2UU9J 3DLGA 2C2DA 2UXBJ 4ZPAA 1KH9A 3W63A 3IR5B 2N3OA 2M3DA 4F67A 4LRDA 4OI0A 1IKXB 3HJFA 4OYAA 2DGQA 3NP5A 1EIYB 3IRXB 3CSKA 4WIIA 4C48A 4LR2A 3ZTQA 5L9NA 5KFKA 3H20A 1N0UA 5J2QA 4O23A 4C3MA 3GU0A 5KFTA 1VQ4S 1Y3KA 4BHQA 5F8NA 3QLHA 4WFBQ 4ILRA 2ZH6A 3SV4A 1NKBA 3W5XA 1JMTA 3GLJA 5C7PA 1S9GB 1GAOA 2Y1RI 2MQMA 3M30B 5BYQA 4XIUA 4IG3A 4IRDA 1TTHB 3HHEA 3TA0A 2EFOA 4OYPA 4USWA 2Y8YA 3V81A 2DIUA 2ZE2B 4KO0B 4OX6A 4OYZA 1RCXB 4H4KA 4MKBA 4WFXA 1C4AA 1HD0A 1ZM9A 2C3MA 3K5PA 2JWNA 3RB0A 1UFKA 1S97A 4RU2A 1RTDA 3TG0A 3VAFA 3OHBA 1JJ4A 4WKRA 1CULA 8ATCB 2KVIA 2MKHA 4PPDA 2Z57B 1BMQB 4KGMA 1U2RA 3MFHA 4DR4J 1LWCA 2QA2A 3NNCA 5BYSA 1E6YB 4OJHA 2G13A 2IBOA 4DL6A 1P6TA 2A3JA 1NPPA 1BE4A 1FERA 4J7CA 4RUAA 1RSCA 4IFYB 2XNQA 2V0NA 5DJBA 5A6WA 3HVRA 3CCES 4ED3A 4LF8F 1C1CB 1NHUA 2GMHA 2HWIA 3HF5A 4LF1A 4M5LA 5IWAF 4DSEA 1NPRA 4CCHA 3MK0A 4PXDA 2KXNB 4QWEA 2BUNA 5ETPA 3BZQA 4OX9J 5KFJA 4FBTA 5T14A 4L3NA 1VI7A 1UP1A 1X4EA 2BM0A 3G6YA 4DV3F 2DR9A 3PFOA 3Q23A 2IY5B 1N52B 4E2FB 1CJKB 2CQCA 2OMOA 4ZKAA 2VF3A 4HTJA 1YSJA 2XMVA 4DMZA 2Y9HA 2XMWA 3L95X 1U2CA 2ZH5A 3WZ0A 3LOUA 2HRUA 2AP6A 1N32F 3DDNA 2DITA 2F40A 2BE2B 2W8KA 3TX8A 2HK2A 2BQRA 3H42A 1SJ1A 3NS7B 3OSNA 3RJMB 2UXCJ 3R7NB 5AJ3F 3KK1A 4FS1A 1UL3A 2AJ0A 4ZJQA 4RW8A 3VZIA 3T1YF 3P96A 1QAIA 2RU3A 2R7XA 1VK8A 2CNKB 3BGRA 5CQGA 1VBZA 1U1PA 3HVWA 3VZHA 1MMDA 1B3TA 4NWBA 1TVRA 2CPFA 4LQ9A 1RWVB 1WDTA 5KFZA 1S76D 4PPZA 1CJKA 3T5JA 2AEJA 2ZUGA 4CO2A 5A8KB 4CI0B 5IXUA 3DDKA 3OL7A 2GSNA 4P73A 5IM0B 3T5HA 1FRJA 2V6AA 1PO6A 4Z7CA 3G87A 4DQPA 1E6VA 2CZ9A 4CNZA 1TL7A 2AJ4A 4PCQA 1VQYA 2QC3A 4B02A 4EYIB 3TI0A 5EWEA 1U1RA 1C0TA 2BJ8A 2R8HA 1SJRA 5KG4A 3SDEA 4UPIA 2R7OA 2A10A 3AJ1A 3SCLE 2VOPA 2VD3A 3OFFA 3Q8QB 1JLCB 1TL3B 1LWXA 1U2FA 2QGFB 3I31A 1TL5A 4U6PA 2MQOA 1FXRA 2EBEA 4PQAA 3NCRA 1IM4A 2XEXA 4JOUA 4X4PA 2ZH3A 1YIJS 1J5EF 3BBBA 1CJVB 3CD5A 1QJHA 3LANA 2XG8A 1JJHA 2LEAA 2UUTA 2JLFA 2WBMA 3BH6B 4P75A 3QSYB 4NMXA 1RGVA 2KDOA 1S0MA 2NQPA 4RW9B 5L46A 3JTOA 4LBPA 4B9MA 5A6PA 2K2PA 1YRUA 1CULB 3D68A 4NX9A 5L1JA 1U24A 2KHCA 1FRLA 3HULA 3RBXA 3RBEA 1ZAWA 4LIWA 4DDFA 3D0IE 1ELYA 1FFWB 1UWBA 2M88A 2MKCA 3OT9A 4Y28C 4ZPDA 2YVSA 4OYBA 2OP5A 3DC2A 5KG1A 4JV1A 2I1RA 3BM7A 4JV2A 1S0OA 4E98A 2HZCA 1IUJA 2H5EA 2V8DA 2C3YA 4F0MA 5HMWA 1HNVA 3T3FA 2NSBA 3T00A 2A0FB 5C2CA 2ALZA 2F8MA 5AE2A 2FZGB 4A8OA 2RE1A 4H4OA 2DGSA 2OSRA 4ED5A 3H2VE 1RDRA 3VQSA 3QT5A 3KDNA 1JLFB 4HHJA 5F0WA 2GGPB 2DBBA 1TMJA 1ROFA 1U09A 3EVMA 1HI0P 1N5YB 4A8FA 1SUQB 4KKOA 2Q6BA 3NLCA 3Q8SB 3MPDA 4A47A 1TV6A 4A8SA 2KJWA 2WVBA 3PEHA 4KIAA 2FVSA 4C8ZA 2ZBPA 3WAWA 4CYRA 3LGNA 4KR0B 1ZAXA 4J9RA 5JUMA 1FESA 4AUKA 2OIHA 4LF7J 4J91A 1RCOB 2LA4A 4CLUA 5I3QA 3EXCX 1UVLA 2ROPA 1VHFA 2QA1A 5KT4A 1WKLA 5FDLA 2E9RX 4M5DB 2QT7A 1REGX 4LF4J 3NNHA 4M5HA 2K3KA 4PQUA 5LXRA 1EX8A 3T1HF 3VHQA 2F65A 3S1TA 4JI6J 1WF2A 2PEBA 2FUG9 5JVHQ 3LP1A 4G1PA 2IFXA 2ZH4A 4RNNA 2D1GA 3W2VA 3IBWA 2MHEA 2R2TA 4QR2A 4Q5VA 4U8VA 4M94A 4IOAQ 5HL7Q 1GMVA 3M8YA 2NCKL 4D3GA 3K5NA 1JNZB 4JV5J 2GLQA 2ACYA 2H4WB 1CVJA 1S6PB 2NXCA 2QG9B 2FLNA 1V6HA 3DN9A 1T9WA 3EICA 3Q83A 3HHDA 3ZZUA 4QPXA 4FF4A 4ZG6A 1VCTA 1OQ3A 1T95A 1VLOA 2IRXA 2KT3A 3OR1B 1T3NA 3P49B 4PWDA 2W9CA 3TAMB 3BQ0A 1S7HA 3LP2B 4Z2XA 4DQIA 3QGHA 2B51A 1MROB 2MLXA 4N41A 1EP4B 1NZAA 4OL8A 1MWQA 1EETB 5J1EA 1UWAA 3QPIA 3QWUA 1S6PA 2I2YA 4B08A 1T7PA 1IM6A 4KBIA 4OJ3A 5MAOA 1A6LA 1GNKA 2AJQA 5GOVA 4LFAJ 1JLBB 3P4UB 2BXJA 4DQRA 3MM9A 1TK8A 2HIQA 2J8AA 3OR2A 1HBOB 4PWUA 2E1RA 1URRA 1WUUA 3T9ZA 4IO9Q 2IRUA 3DM2A 3T1YJ 1R0AB 2XB2D 2N82B 5EGEA 1N5TA 1REVB 4ZCIA 2I5JA 1LOUA 2PIIA 3DRRB 5E3CA 1R0BG 4O3PA 3N4WA 2H65B 5B09A 5D3GB 1JXLA 4MKAA 5KT6A 4IR9A 1SKSA 2DGOA 1RHMB 2IHR1 2MSSA 2YY3A 1L3UA 1J5EJ 3PO4A 1V9OA 5C24A 3UE2A 5M2UA 7FDRA 2OUGA 2CQPA 3IDDA 4GTXA 3BSCA 5HQMA 5LMNJ 4DI6A 2HHQA 1KONA 3MTKA 4BS2A 4ED0A 1N88A 4WF9Q 5CYQB 3H25A 5J2PA 1FCAA 1RT2B 2WVDA 4NCGB 4QIWD 5C42B 5HSPA 5CHCB 4NI2B 4UY8T 1QAYA 2AT1B 3SCJE 3BDPA 1PC4A 3HMJG 1EB0A 1FJ7A 2FTRA 1AUKA 3PCOB 5F8MA 4ANEA 3D54A 1R0AA 2KM8B 4LVOP 4ZVSB 1R6VA 4UPHA 4UOFA 4NXNJ 1U7LA 1LXNA 1RT7B 1RZMA 2JSXA 4NA3A 1VC5A 2ZJRQ 3OHAA 2N4CA 1N2KA 1VRTA 4QW8A 2AX1A 1O5JA 5JMNA 4P6QA 1FVSA
chains in the Genus database with same CATH topology
4GTZA 5TJ3A 3SZYA 2W5WA 4LR2A 4UOPA 3NKRA 5INHA 1ANIA 1O99A 3T00A 1AJDA 3CMRA 1KH4A 2RH6A 5HRTA 4MY4A 5AJ9A 3A52A 3B5QA 1SHQA 2IFYA 1KH7A 3IGZB 3UN2A 4UORA 4ZG7A 3TG0A 1ED9A 4LRCA 4UPLA 4LR9A 4ZG9A 3TWZA 5EGHA 4LREA 1HDHA 5IJQA 3WAWA 4CYRA 2W5QA 4KJGA 5L0KA 3NVLA 3TX0A 1ALKA 2W5TA 1EW2A 3WAYA 1E1ZP 3T01A 3UNYA 3Q3QA 5LRNA 3M7VA 2W8DA 1E2SP 4KAVA 3WAXA 3IGYB 1B8JA 3MK0A 5IJSA 3UN5A 1URAA 1URBA 5LQQA 3NKMA 3T02A 3UN3A 1ZEDA 1P49A 4B56A 2D1GA 5DLWA 3ED4A 1Y6VA 4MHXA 1KHJA 3M8YA 1K7HA 2GLQA 5DLTA 5LRMA 3M8ZA 3BDHA 4GTWA 4ZGAA 4NWXA 4ZG6A 4QAXA 5L0BA 2W5SA 3NKPA 1ALIA 4KAYA 1KHLA 4YR1A 1SHNA 4LR7A 1AJBA 3DPCA 1EI6A 3NKNA 1FSUA 2GA3A 4LQYA 1E33P 3WBHA 1HJKA 1HQAA 1N2LA 4CXUA 3NKOA 4LR8A 4LRBA 4MIVA 2GSOA 4NWJA 4TN0A 1ELXA 4FDIA 5GOVA 1EQJA 1ZEFA 2GSNA 1EW8A 1O98A 2X98A 1E3CP 2IUCB 3MK1A 5GRRA 5EGEA 4KJDA 2W5XA 4N7TA 4GTYA 3BDGA 4FDJA 5KXAA 5L0EA 1AJAA 1ED8A 1ANJA 3LXQA 4UPIA 2VQRA 4GTXA 3IDDA 3E2DA 1ALJA 2W5VA 1KHKA 3WAVA 1EW9A 4KM4A 1AJCA 2W5RA 1ALHA 2GSUA 1KHNA 3DYCA 2W8SA 4CXSA 2G9YA 4UOOA 3M8WA 5C66A 3BDGB 3UO0A 5LIAA 1ZEBA 2ZKTA 1KH5A 5DLVA 1ELZA 3KD8A 1AUKA 3NKQA 3MK2A 2IUCA 2XR9A 4CYSA 2QZUA 4UPHA 4CXKA 1KH9A 3SZZA 1ELYA 5K4PA 4UPKA 1N2KA 2ANHA 4LRDA 3BDFA 3OT9A 1EJJA 2XRGA 4LRFA 4LRAA 1Y7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTZ A;  5TJ3 A;  3SZY A;  2W5W A;  4LR2 A;  4UOP A;  3NKR A;  5INH A;  1ANI A;  1O99 A;  3T00 A;  1AJD A;  3CMR A;  1KH4 A;  2RH6 A;  5HRT A;  4MY4 A;  5AJ9 A;  3A52 A;  3B5Q A;  1SHQ A;  2IFY A;  1KH7 A;  3IGZ B;  3UN2 A;  4UOR A;  4ZG7 A;  3TG0 A;  1ED9 A;  4LRC A;  4UPL A;  4LR9 A;  4ZG9 A;  3TWZ A;  5EGH A;  4LRE A;  1HDH A;  5IJQ A;  3WAW A;  4CYR A;  2W5Q A;  4KJG A;  5L0K A;  3NVL A;  3TX0 A;  1ALK A;  2W5T A;  1EW2 A;  3WAY A;  1E1Z P;  3T01 A;  3UNY A;  3Q3Q A;  5LRN A;  3M7V A;  2W8D A;  1E2S P;  4KAV A;  3WAX A;  3IGY B;  1B8J A;  3MK0 A;  5IJS A;  3UN5 A;  1URA A;  1URB A;  5LQQ A;  3NKM A;  3T02 A;  3UN3 A;  1ZED A;  1P49 A;  4B56 A;  2D1G A;  5DLW A;  3ED4 A;  1Y6V A;  4MHX A;  1KHJ A;  3M8Y A;  1K7H A;  2GLQ A;  5DLT A;  5LRM A;  3M8Z A;  3BDH A;  4GTW A;  4ZGA A;  4NWX A;  4ZG6 A;  4QAX A;  5L0B A;  2W5S A;  3NKP A;  1ALI A;  4KAY A;  1KHL A;  4YR1 A;  1SHN A;  4LR7 A;  1AJB A;  3DPC A;  1EI6 A;  3NKN A;  1FSU A;  2GA3 A;  4LQY A;  1E33 P;  3WBH A;  1HJK A;  1HQA A;  1N2L A;  4CXU A;  3NKO A;  4LR8 A;  4LRB A;  4MIV A;  2GSO A;  4NWJ A;  4TN0 A;  1ELX A;  4FDI A;  5GOV A;  1EQJ A;  1ZEF A;  2GSN A;  1EW8 A;  1O98 A;  2X98 A;  1E3C P;  2IUC B;  3MK1 A;  5GRR A;  5EGE A;  4KJD A;  2W5X A;  4N7T A;  4GTY A;  3BDG A;  4FDJ A;  5KXA A;  5L0E A;  1AJA A;  1ED8 A;  1ANJ A;  3LXQ A;  4UPI A;  2VQR A;  4GTX A;  3IDD A;  3E2D A;  1ALJ A;  2W5V A;  1KHK A;  3WAV A;  1EW9 A;  4KM4 A;  1AJC A;  2W5R A;  1ALH A;  2GSU A;  1KHN A;  3DYC A;  2W8S A;  4CXS A;  2G9Y A;  4UOO A;  3M8W A;  5C66 A;  3BDG B;  3UO0 A;  5LIA A;  1ZEB A;  2ZKT A;  1KH5 A;  5DLV A;  1ELZ A;  3KD8 A;  1AUK A;  3NKQ A;  3MK2 A;  2IUC A;  2XR9 A;  4CYS A;  2QZU A;  4UPH A;  4CXK A;  1KH9 A;  3SZZ A;  1ELY A;  5K4P A;  4UPK A;  1N2K A;  2ANH A;  4LRD A;  3BDF A;  3OT9 A;  1EJJ A;  2XRG A;  4LRF A;  4LRA A;  1Y7A A; 
#chains in the Genus database with same CATH topology
 4UOP A;  3C6T A;  5KG5 A;  4I2P A;  4DOZ A;  2ZH2 A;  1SC1 B;  1FKO A;  3QIP A;  1KRP A;  4B3O A;  1R3N A;  5D78 A;  4Y2A A;  5LMU J;  5CAB A;  5AJ9 A;  2DGW A;  3NEK A;  4XO0 A;  2QEX S;  1W26 A;  3A13 A;  2DGU A;  3JSM A;  1T9Y A;  1SHQ A;  2BV3 A;  4XPE A;  2GC8 A;  2N7Y A;  3K2Y A;  2ZHA A;  4DUY J;  4QZV B;  4M5N A;  2KFN A;  2WW4 A;  5DLF A;  3PKY A;  4DPU A;  4YP3 A;  3HT3 A;  1H73 A;  3BPD A;  2GIF A;  2GV1 A;  2JDJ A;  3LP1 B;  4HHU A;  4FF1 A;  4DR3 J;  2Z8Q A;  3PHE A;  2OTL S;  3C14 B;  5T7L B;  3JYT B;  1TKT B;  3CJ3 A;  3I96 A;  4ZP7 A;  1V3Z A;  1U02 A;  1WC3 A;  3EGV A;  4ID8 A;  2P8I A;  4WE1 A;  2ROE A;  4O3N A;  3T01 A;  1BD6 A;  2BMB A;  2YWK A;  4WP3 A;  4JV5 F;  3ILL A;  5EHH A;  2OPQ B;  4ZHR A;  3GYN A;  3ZO7 A;  4JI7 J;  4DN0 A;  5EGY A;  3PW7 A;  2IJF A;  2A6O A;  3T02 A;  5E0O A;  4DCP B;  1H74 A;  1M1G A;  4HI1 A;  2FC8 A;  3IP0 A;  3TAQ A;  1PJ6 A;  4CH0 S;  2R7W A;  2HGN A;  4YR0 A;  1J5O A;  3M2R B;  4OZ1 A;  2QJ3 A;  1S6O A;  2E5J A;  2AYM A;  2W01 A;  1WHV A;  1KLN A;  1NUE A;  3H5S A;  1S77 D;  3H2L A;  3E2E A;  3I5B A;  4RW6 B;  3DLK A;  4QCL A;  5IT9 U;  2DRD A;  2KVQ E;  5KOX A;  1P1L A;  3Q0A A;  2CJY B;  2Y3Y A;  2CZ4 A;  1NLK L;  3DFE A;  2Q3P A;  4WTO B;  1NPK A;  1KHL A;  4YY3 J;  4KAY A;  4R25 A;  1M0S A;  2L3M A;  3HVA A;  4LR7 A;  2B4U A;  4DUY F;  3FQK A;  1NAQ A;  3FSY A;  4JV0 A;  1RP5 A;  3OVS A;  1LFP A;  2Y8W A;  1HJK A;  1ZPW X;  2DY1 A;  2B9X A;  1EQM A;  1OY6 A;  3N0V A;  2GQ2 A;  1JLG A;  2NZ4 A;  4RW7 B;  2AEF A;  1WF0 A;  2AHO B;  2M9K A;  1M1K T;  3CC2 S;  2L48 A;  5FLX U;  4LFB J;  4TN0 A;  2NS1 B;  4KY3 A;  3FSI A;  3TZW A;  1ACM B;  1WSV A;  1NK9 A;  1FRK A;  2B5J B;  2ZOG A;  1EKR A;  2R2U A;  1NKE A;  4LVN P;  2QL7 B;  4KGK A;  4UOH A;  1ZS6 A;  2VOD A;  3FEZ A;  1CJV A;  3LGH A;  3L7O A;  1NCL A;  1SIZ A;  4P2S A;  3KYL A;  2NPI A;  2PA3 A;  3GV8 B;  3MEE B;  3PW0 A;  2NUH A;  4GRS A;  3SCI E;  4A8M P;  2NSC A;  2KYX A;  4ECR A;  1YK9 A;  2XBP A;  2G1H A;  3Q86 A;  1FFS B;  2HNZ A;  3W62 A;  2UP1 A;  4N76 A;  1CBK A;  1PAE X;  5DGB A;  1U8W A;  4F3Q A;  7AT1 B;  3LQV A;  5HAT A;  1RQ0 A;  2PA8 D;  3DMJ A;  3MEG B;  3HHL B;  2VG6 A;  3HD1 A;  1WEY A;  3K17 A;  4MK7 A;  3R5A A;  2FIU A;  1U1L A;  1TL7 B;  5C66 A;  3NS5 A;  5ETT A;  3WHI A;  2DNQ A;  3GIL A;  1NSA A;  1YJN S;  3BPS P;  2VDI A;  2RDI A;  3BR9 A;  4NLO A;  4ZN3 A;  5LOQ A;  1N48 A;  1SIW B;  1YZ6 A;  2Y0S D;  5U47 A;  5HO4 A;  5JJB A;  3MK2 A;  2E9T A;  3GTY X;  3VAG A;  1RB0 A;  4K2J A;  2JLG A;  1FJC A;  4OV1 A;  2C3O A;  3M30 A;  1VYA A;  3WC0 A;  2BBE A;  2GAH C;  3BGO P;  4DSI A;  4RL1 A;  3RW6 A;  4JUZ A;  3DU5 A;  3ILI A;  2R42 A;  2W2Q P;  3V81 B;  3D6M B;  3KLV A;  1WOR A;  2RF2 A;  1AUS L;  4DV4 F;  4DL5 A;  1T03 B;  2R7Q A;  3VGS A;  1XWL A;  4I6W A;  3MEK A;  2YTC A;  1AJD A;  3FC9 A;  4O3O A;  2CQB A;  3F0N A;  2RH6 A;  5K9F A;  4G6V B;  1NH8 A;  2M2B A;  4I0W A;  2HBQ B;  2EI5 A;  4WBF A;  5ETS A;  4ZVT B;  4A8X A;  4RUC A;  2XQC A;  2L9D A;  3MAQ A;  3R8Y A;  1IKX A;  3OXF A;  1TP7 A;  5HJX A;  2XMT A;  3BRE A;  1QM9 A;  2ALY B;  2HBR B;  1EZZ B;  4ZA1 A;  4C0O C;  2WTF A;  2YKM A;  4M5I A;  1P9Q C;  4XAK A;  1MSW D;  5F0U A;  4PAA A;  4X65 J;  2C42 A;  3DLH A;  3FVY A;  3OBI A;  4OIX A;  3G2X A;  3GG0 A;  5C2G A;  4DV4 J;  1VRT B;  3CCW A;  3D1H A;  3JTN A;  5L0K A;  3HZE A;  3GFH A;  3NGT A;  3R6L B;  4TQR A;  4ZP9 A;  2AF6 A;  1GX6 A;  2RKI A;  3MEC A;  4C0B A;  4NCA A;  5L39 A;  4FS2 A;  3DYA A;  4NLV A;  4UOC A;  5H9F J;  3U1N A;  2HZA A;  2JRS A;  4KAV A;  2WK4 A;  3WIV A;  2RAQ A;  4I69 A;  5DLG A;  2JJ4 D;  1JX4 A;  5E2Q A;  1BHN A;  2OPR B;  2PD1 A;  3PZP A;  1HWL A;  5BR8 J;  2POK A;  1HBM A;  2OTJ S;  1QVF R;  2E5H A;  5J2M A;  5LQQ A;  1NU4 A;  4MYT A;  3E01 A;  2XM3 A;  2AU0 A;  4DSL A;  2JVR A;  3DLE A;  5RUB A;  4FYD A;  2D69 A;  4IFY A;  1NDK A;  1YJR A;  3OR2 B;  2MKJ A;  1LWE A;  5LRM A;  5LMU F;  2IAJ A;  1I1G A;  4UF4 A;  4F4K A;  3U27 A;  1EHW A;  1RHQ B;  1GMW A;  2GZO A;  2LXU A;  3S8S A;  3MR3 A;  1YI2 S;  2AEM A;  4NOH A;  3EZO A;  5GMD A;  1VS3 A;  2DR6 A;  3AHP A;  5BR8 F;  1RTH A;  3FQL A;  3Q2T C;  2DO0 A;  2J7U A;  2QZ8 A;  4TLR A;  2DR8 A;  2MST A;  3A8K A;  2DXD A;  2MQ8 A;  2Z2M A;  4DG1 A;  1QAJ A;  3OLA A;  2HHH F;  2RNE A;  5K20 B;  3DGP B;  4DQS A;  2ZWP A;  3HSZ A;  4M5K A;  4WP9 A;  5A8R A;  5DDQ C;  1IJF B;  2M8D B;  4LMZ A;  1UTA A;  3MZI A;  3QFH A;  4YDD B;  2BM1 A;  4I2Q B;  1TUW A;  2HPU A;  3BQ2 A;  4FVC A;  5DDR C;  2G1D A;  2DY9 A;  1T05 A;  1KQK A;  3UD5 A;  2JEG A;  1SKR A;  2DNZ A;  2V63 A;  3KG4 A;  3M1V B;  2V8H A;  1RT4 A;  2M8H A;  2WCX A;  3MF5 A;  3SQO P;  5IT9 Y;  2CQ1 A;  4KE5 A;  2Z4P A;  1QAX A;  5GRR A;  3AA9 A;  4RW6 A;  4K4W A;  4F4Z A;  2W5X A;  4RKU C;  2XMU A;  3QGG A;  3D66 A;  4OZ0 A;  5KOW A;  4U7C A;  3C16 B;  2E7W A;  3PG9 A;  1H3D A;  4I6A A;  2DNL A;  4NYO A;  2YH1 A;  4NLD A;  3FBE A;  1D9F A;  3IBF B;  2HVE A;  2Y0B B;  4QR1 A;  5F9L A;  1KFS A;  3UVJ B;  2JVO A;  1TUG B;  4UUW A;  4KM4 A;  4WZQ A;  3M2U B;  2J9E A;  1VHI A;  2LU1 A;  5HQ8 A;  5D3G A;  2NXJ A;  1FRM A;  3M4X A;  4ES1 A;  1GTH A;  3JSR A;  4MH8 A;  2Z30 B;  3IG1 B;  1X5S A;  4M5J A;  4OV6 A;  3J81 U;  2IUC A;  2KU7 A;  1OO0 B;  1AUD A;  5ETV A;  4WWS A;  2FJD B;  1RT1 B;  2DPI A;  2HRT A;  3BSN A;  2EKY A;  2EFP A;  3OV7 A;  3PY8 A;  3CCT A;  4UQG A;  4QYZ J;  1IN0 A;  1QSL A;  1S5Z A;  1AZS A;  1WC5 A;  1F0X A;  1JWW A;  1MWZ A;  1X7V A;  2Q43 A;  4P71 A;  4KB7 A;  4LRF A;  2ADC A;  3IAS 9;  2C2N A;  3C3L A;  1SCJ B;  2FJE B;  1QTN B;  4ILM A;  4ER8 A;  1TV6 B;  4YDX A;  5F41 A;  1DAR A;  3UVJ A;  1NDP A;  3W5Y A;  1ZH5 A;  1YIT S;  1RIS A;  2ZEJ A;  4L74 A;  4LF2 A;  4JI4 J;  4K4V A;  4L75 A;  1FDA A;  2C2Z B;  1VOM A;  2FHK A;  1CLF A;  2I38 A;  4ZJL A;  2XMA A;  1FK9 A;  1YBU A;  2IC3 B;  3QZ7 A;  2ASJ A;  2VQE J;  2DCL A;  1SV5 B;  2GVZ B;  5HK4 A;  3V2U C;  3GQC A;  1D9D A;  5HBM A;  2MQN A;  1JLA B;  4ZG7 A;  4I4B A;  2J6T A;  2CNO B;  3MAH A;  4M5G A;  4A4J A;  5HN0 A;  4DR5 J;  4RJV A;  2MHN A;  5D4P A;  3R3T A;  5ETL A;  1Q86 T;  5EGH A;  3MUT P;  4CLZ A;  1AZS B;  3GG1 A;  8AT1 B;  4DZD A;  2RF2 B;  4ES2 A;  1G3O A;  2UV8 A;  3OTE A;  3HVT A;  2MY7 A;  2V8G A;  1HD1 A;  1VBY A;  5EX3 A;  1LWE B;  2ZOF A;  5J2N A;  4UY8 5;  3MPY A;  2WB1 D;  1FEH A;  1HBN B;  1RWU A;  3IMQ J;  3TO8 A;  2KH9 A;  3V6D B;  1U48 A;  4KHR A;  4B3T F;  1NHV A;  2VBZ A;  4EUV A;  1URA A;  4X4V A;  2Q6C A;  4IG0 B;  3DOK A;  3PW4 A;  5H9E J;  4M95 A;  1BWE A;  3BH7 B;  3EZU A;  1QUV A;  4EK2 A;  5DLW A;  4C8O A;  3SSQ A;  4F4W A;  4F3O A;  3M8Q B;  3D3C J;  3MXH P;  2CJA A;  1M5O C;  3PVX A;  1JXV A;  1RAB B;  4TY9 A;  4Q45 A;  3PR4 A;  1X4C A;  1LK7 A;  4CZC A;  4XDC A;  2OPQ A;  1P9Y A;  1JLG B;  5D0G A;  2HHP A;  1B0V A;  3Q8Y A;  5EWF A;  4NXM F;  1NO8 A;  2LQ8 A;  4HDG A;  4EYH B;  4GKJ J;  3ENV A;  1WF1 A;  3SDE B;  1LWF A;  3TW0 A;  2J6U A;  3ADA C;  1RU2 A;  1ZTT A;  3L9Z A;  5KFQ A;  4LFA F;  1TUV A;  2DGV A;  4C8N A;  1FSU A;  2COL A;  3CJT A;  5AT1 B;  4DS5 A;  4DFK A;  3HI9 A;  3TUZ C;  4DXL A;  3CF5 Q;  4WYW A;  2ERR A;  2EVZ A;  2HFS A;  2W25 A;  3NKO A;  2GO8 A;  3G8T A;  2V2Z A;  1TKX A;  2X1G A;  1OS5 A;  1K47 A;  3IGN A;  2QX0 A;  1UJ5 A;  2BJD A;  2XMM A;  4YEA A;  4CH7 A;  1T8E A;  1FA0 A;  4K4U A;  4YOE A;  4IQM A;  1S1T B;  2VFT A;  4FYY B;  2X98 A;  3JXO A;  2EBG A;  1O6X A;  3IS9 A;  2PMH A;  5K14 B;  4J9U E;  2WHO A;  3FRY A;  1NH7 A;  3EE3 A;  4N7T A;  4YY3 F;  4QOT A;  3GMG A;  4V19 J;  4FF2 A;  2XLJ A;  4LSL A;  1UJ6 A;  1Q82 T;  3OL9 A;  2LYV A;  3LPY A;  4IKA A;  1HNX F;  4DEZ A;  2HFV A;  5KG6 A;  5DRK A;  4FPR A;  3KJV A;  2ZJP Q;  4DPY A;  1OMS A;  2FVQ A;  1MRO A;  2HNY A;  3CGI A;  2OML A;  4M1K A;  2HHX A;  1I94 F;  4WTY A;  3IN5 A;  1X4G A;  2Y1L B;  1RKJ A;  2IBK A;  2VOO A;  3MAA A;  1VIX A;  3AY0 A;  4ICL B;  4OZL A;  4ED7 A;  1WAC A;  3T5K A;  5IFM A;  3AA8 A;  1E6V B;  4WJB A;  5IS2 A;  4K5R A;  4A8Q A;  2XO6 A;  3NL0 A;  2JEF A;  4FBU A;  3QGI A;  2VAS A;  3BB5 A;  1WOP A;  2GAG C;  3RUB L;  5GAD I;  2J0Q D;  3KD8 A;  5HI7 A;  1OWX A;  2QLX A;  1Y5N B;  3PRV A;  3C46 A;  2BAN A;  1VQK S;  2J7W A;  3FMB A;  4MTP A;  4C8Y A;  3HK2 A;  3KNG A;  3TVK A;  1Y5L B;  1U45 A;  2K7K A;  2HG4 A;  2BJE A;  5J2P B;  1QUP A;  3M2U A;  4QU6 A;  4LSL B;  3NG8 A;  1FNX H;  3PNI A;  3MEE A;  3HHL A;  1ZA1 B;  3PM9 A;  1V5V A;  3TYT A;  2QMU B;  5BXI A;  3R5C A;  3LA0 A;  3G6V A;  2A1B A;  1SI9 A;  2GO9 A;  3MGJ A;  1R8C A;  2UVU A;  4CM2 A;  4KYZ A;  1O99 A;  5LMN F;  2XUL A;  2YPZ A;  2YX1 A;  2UUB J;  1KTQ A;  3CMR A;  4DPT A;  2RS2 A;  1D1U A;  3G71 S;  3MM8 A;  3CCL S;  5GAG U;  4KV8 B;  2LEB A;  1KC8 T;  1H7W A;  2AGQ A;  1K1Q A;  5K8M A;  4DR5 F;  2NPF A;  1VQP S;  4A48 A;  2HFU A;  5KFF A;  3VAL A;  1L3T A;  4I67 A;  1T03 A;  2H48 B;  5AE1 A;  3CJK B;  3UR3 C;  3A8E A;  3ISN D;  2IDL A;  3AH6 A;  3QIP B;  5DZ6 A;  4C8M A;  3MCS A;  4BBY A;  3QT8 A;  3W2W A;  4DFP A;  2G0I A;  1R8P A;  3IFE A;  1K8A T;  4J90 A;  4NXN F;  2RDD A;  5C25 B;  2ZIT A;  2R2R A;  4Y2M A;  4LF4 F;  2HVZ A;  4LF6 J;  2YBV A;  3D67 A;  2M4M A;  2HVI A;  1XR5 A;  3DLL Q;  2W5T A;  4M63 A;  2QV6 A;  1HNI A;  1LWF B;  1ZA2 B;  3Q3Q A;  3I5C A;  2GML A;  1TKD A;  4PEO A;  4TYA A;  1VIS A;  3QQC D;  3CJS A;  3BS9 A;  4ECT A;  3MM5 B;  5IJS A;  1DLO A;  3D3B J;  3KLG B;  2W7P A;  1GK8 A;  2R2S A;  4F4A A;  2YNG A;  2YNI A;  1DUR A;  1G4C A;  1XTZ A;  1IBM F;  1U47 A;  2CPD A;  2HQF A;  2YPY A;  3ELH A;  2F4V F;  2QYG A;  5T7L A;  3JYT A;  2BJ9 A;  1FFG B;  2MKS A;  4FXD A;  1HNW J;  2JOQ A;  2EFV A;  4MMO A;  3CUL A;  2AYE A;  2G2O A;  3AJD A;  4W98 A;  2Z2Z A;  2YNF A;  3OTD A;  1T9T A;  3X3U A;  5DZ7 A;  2Z2Y B;  3GCX P;  1IR1 A;  1C1C A;  3MUM P;  4WK1 A;  1W2B R;  2PEH A;  1RE1 B;  2ZWO A;  2B0G A;  1FKP B;  3BBC A;  2LXI A;  3B8H A;  1IBM J;  2GMJ A;  2R9L A;  1NK8 A;  1ED9 A;  3ILJ A;  4FYW B;  1XMO F;  2ACM A;  1VQN S;  1UEV A;  4ZVU B;  1SHN A;  2E5I A;  2C28 A;  3R9L A;  4YUD A;  1F2G A;  3MMC B;  2CDQ A;  3R5J B;  2D3O R;  1BWV A;  1M5K C;  1AW0 A;  1NDC A;  3RBZ A;  4YR2 A;  4ZJO A;  3BQ1 A;  1HQA A;  2KKH A;  1IWA A;  3AXK A;  3NY0 A;  3BO2 A;  5D0E A;  4CLL A;  4CXU A;  2GS8 A;  2HUR A;  2PMZ D;  4ZK7 M;  1M90 T;  3AD9 C;  1FDB A;  4R5P B;  3AOB A;  1IXK A;  2LLZ A;  5L38 A;  4F0H A;  3M2V B;  2CVE A;  4UOG A;  3MR7 A;  2BE2 A;  4HT5 A;  5AJ3 J;  4K5S A;  3CJR A;  1VQS A;  2ATL A;  3OSP A;  1T9U A;  3D7S B;  3I55 S;  5F8G A;  4IUF A;  2RD5 C;  5B7W A;  1WSR A;  4JI5 F;  5KFI A;  4WXO A;  1V3R A;  3DRS A;  4HL9 A;  1Y00 A;  1PCA A;  5KFP A;  4DX5 A;  5L0E A;  2MXY A;  3HFZ B;  3A8I A;  1T0T V;  4NML A;  1U1K A;  4F2R A;  2VQR A;  3R5D A;  1VQO S;  4KTQ A;  1JKH B;  5BJR A;  1C4C A;  1RHU B;  3AQO A;  3HHN B;  3X1L B;  2UV8 G;  1MLA A;  3DOM A;  2ASD A;  1Y11 A;  1QSY A;  4RW4 B;  4Z37 A;  4I2P B;  2D9P A;  2GJF A;  2HS4 A;  4NLU A;  4Y2K A;  1DQ8 A;  3ISN C;  4AND A;  2Z56 B;  4KSE B;  3R7S B;  4DR6 J;  2V2Q A;  1CC8 A;  4F50 A;  4OYI A;  1KVI A;  2H3E B;  4WK3 A;  4CLS A;  1X8D A;  3VR1 A;  3KLF B;  2V4R A;  1C0T B;  1NK6 A;  1JJ2 R;  1I51 B;  2XYH B;  2V69 A;  1H98 A;  2IVF B;  4G3I A;  2ZH9 A;  2BJ7 A;  4AQY F;  4CYS A;  2A18 A;  1C1B A;  4CP5 A;  3PW5 A;  1FDD A;  5HVF A;  2I5J B;  2XGQ A;  3VAI A;  3RTV A;  4HI2 A;  1F1B B;  1I6J A;  1IBK F;  1D8Y A;  2QL5 B;  2W4C A;  3BDF A;  2H54 B;  3KJN B;  4HLB A;  1FO1 A;  4OHY A;  2XSJ A;  4B9T A;  4G1I A;  3GZ7 A;  1D9A A;  2WW8 A;  4CH1 A;  4LRA A;  1IKW A;  1S59 A;  1DFD A;  2CPE A;  5KFX A;  3W9J A;  2HAI A;  2MMY A;  2E1M C;  4QYR A;  3EPG A;  3NGS A;  3AOD A;  4H4M A;  4UT4 A;  4URQ U;  2LA6 A;  1FWP A;  2F7V A;  1BQM A;  3D1Q A;  2EXU A;  4OLO A;  5J2N B;  4IDK B;  3HD2 A;  4ZPT R;  2ZM6 J;  1XMQ F;  3CCU S;  2L9N A;  2W1B A;  2XCP A;  4DR3 F;  2AYG A;  1FHT A;  4FZV A;  1IWG A;  4JI4 F;  2GVD B;  4DUT A;  3GJS B;  4IFV A;  3UN2 A;  5A0Y B;  4IR1 A;  3KUE A;  2JFD A;  4RX6 A;  3PFE A;  1QD1 A;  3C6T B;  2HHH J;  3H7H B;  3B4D A;  5L1L A;  4YB5 A;  1N5S A;  4LRC A;  4AL5 A;  4JBC A;  1HKA A;  4LR9 A;  1HWU A;  2BKP A;  2E1A A;  1S0V A;  2K3I A;  1Y0H A;  3DKD A;  2W5Q A;  4C9D A;  2CAD A;  2UVW A;  2JHE A;  3QWP A;  1TAU A;  1FE0 A;  3M6X A;  3ETO A;  2RU9 A;  2ZM6 F;  4I56 A;  2GA7 A;  2XNR A;  1W7W A;  1D3W A;  2RT3 A;  4H4M B;  2PN6 A;  2G2Z A;  2W8D A;  2LFV A;  2HQ3 A;  4CXS A;  1YBT A;  3D1O A;  3QSI A;  5LM7 E;  4AL7 A;  1UKU A;  1CPZ A;  2YQ3 A;  3MCM A;  3N5B A;  3G4S S;  4IH5 A;  3LUY A;  4C98 A;  3ICL A;  2RHS B;  2DO4 A;  2IYI A;  1ZAV A;  3NOG A;  1YJT A;  5HVG A;  2WON A;  4JI2 F;  2G0J A;  4CQ1 A;  1M5P C;  2KG0 A;  4PYD A;  5L8R C;  3ED4 A;  3EDQ B;  3WIU A;  1YJW S;  2VFS A;  1C0U B;  1EAY C;  2FZC B;  2VL1 A;  3DYA B;  3POT A;  4NLP A;  4X4S A;  2OO4 A;  4C2M A;  2HHT A;  4KC5 A;  2OSQ A;  2W2O P;  1PJ7 A;  3K8W A;  4DU7 A;  2VQF J;  1RJJ A;  2O3D A;  1NDL A;  3US5 A;  2AMC B;  2XLK A;  2CXE A;  2YQ0 A;  3CUN A;  2EK1 A;  2I8E A;  2CPJ A;  1TMM A;  4U9R A;  3Q8U A;  2U2F A;  4B3T J;  2IJN A;  2LQB A;  1U6B A;  2CUY A;  3M8Q A;  1WWH A;  3DOM B;  2QMW A;  1RAO A;  1ZPV A;  1S48 A;  2EW9 A;  2CNL B;  4MJK A;  4OI1 A;  3J7Y U;  4QIV A;  1UVK A;  2CQ0 A;  4G1Q B;  3W7B A;  2X51 A;  3LPE A;  1IBL F;  4F8R A;  1URN A;  1FRI A;  4WFY A;  5GAH I;  4ED2 A;  4DL7 A;  2HMI A;  3N6N A;  2ASY A;  1WHX A;  1PBA A;  1ELX A;  2G2Y A;  4CNY A;  2EK6 A;  3KLF A;  4JI5 J;  3DHX A;  1L3V A;  2R8K A;  1XER A;  4QIF A;  5ETN A;  1CQM A;  2VBX A;  3FK4 A;  1Q95 G;  3GFY A;  2FJA B;  3LP2 A;  3RYL A;  3PX6 A;  3HSG A;  3A1Y G;  1S1U A;  4X66 F;  4IQX A;  4RW8 B;  4RBU A;  1KVJ A;  3IGZ B;  2OD4 A;  3EM1 A;  4FDJ A;  2EEY A;  4TLQ A;  2HS0 A;  1UWB B;  2CPZ A;  2PFD A;  3GIK A;  1RT5 A;  3KLH A;  4KGV B;  5E3R A;  2UXD F;  3HO1 A;  4DSK A;  4Q0B A;  4AXI A;  3TJA A;  1OPZ A;  1R27 B;  2NYH A;  5ETK A;  1HMV A;  2OH2 A;  1VR6 A;  2XHW A;  2MZT A;  4LIR A;  2GQQ A;  1RWK B;  3EXY A;  3TR5 A;  4DPX A;  3BSO A;  1ALH A;  2QZU A;  2VQF F;  3OW2 R;  2PGC A;  3EPI A;  3PX0 A;  2R3V A;  1SH2 A;  2VZ9 A;  1N5V A;  1TKZ B;  2QFJ A;  4QWC A;  3HM9 A;  4MFB B;  4HTI A;  1ELZ A;  1R0C B;  2CIM A;  1BQN A;  2OI2 A;  4HEA 9;  2BW7 A;  1RUS A;  3I0S A;  2R7U A;  1T02 A;  3M6U A;  4LF8 J;  2CWX A;  3SSS A;  3V4I A;  1HWK A;  1JLC A;  1TL3 A;  2APO A;  2CQG A;  3V6K A;  1D0E A;  2NR0 A;  2FC9 A;  3B6B A;  1NXI A;  4USM A;  4NCG A;  5C42 A;  2DT9 A;  4UPK A;  4ED6 A;  4UUX A;  4DS4 A;  4NLG A;  1EJJ A;  3B4M A;  2Z58 B;  1P27 B;  2CNN B;  1VQ8 S;  4K50 A;  4DX8 H;  3QNW B;  2GIR A;  2X1F A;  1HMV B;  5INH A;  3NXZ A;  2AIR B;  2HWT A;  1HNI B;  2VQE F;  5A8W A;  5GVQ A;  3U1L A;  4AXJ A;  3CJQ A;  3I0R A;  5DQI A;  1UVN A;  1HBN A;  3CDB A;  1SKU B;  1BC6 A;  4MY4 A;  2DRA A;  2YWG A;  4OFZ A;  5I42 B;  4LF7 F;  2ZHO A;  3FUY A;  2FHJ D;  2K7J A;  1S4E A;  3G82 A;  3ZC4 A;  4YR3 A;  3A52 A;  2J9D E;  3I6P A;  3VQT A;  4C11 A;  3JSY A;  3IWL A;  4CDI A;  5B08 A;  3RRH A;  4ECX A;  3TQ1 A;  1X9M A;  3HSD A;  4JI1 J;  4MIW A;  4PUO B;  3U02 A;  3VVU A;  1ZM2 A;  1ZM4 A;  1YTY A;  1NRK A;  3RB4 A;  6FD1 A;  2C22 A;  3MM5 A;  4ZG9 A;  2CJX B;  2HND A;  1PBU A;  2YX7 A;  2DXE A;  3LAK A;  1FD2 A;  4R0E A;  2RIJ A;  4EO8 A;  1JQG A;  4ZLJ A;  2FHJ A;  4W92 B;  3PHT A;  3SQG A;  4WCE Q;  3TUP A;  2VA2 A;  4C6A A;  2GJ2 A;  1RTH B;  1G2E A;  1EW2 A;  2WRM A;  1SVD A;  3WAY A;  2Y1J A;  3PDN A;  1M5V C;  4PWD B;  1NBE B;  3CCR S;  2B9Y A;  1DQA A;  5HP1 B;  3IGY B;  1WTF A;  2DH8 A;  2WSE C;  5I42 A;  3DYC A;  1K0V A;  3VAJ A;  2BYC A;  2X1B A;  4DV3 J;  2VJU A;  1ZED A;  3T1H J;  3E51 A;  2B3T B;  4ZIV A;  4C11 B;  3HHL D;  4KPC A;  5A2Q Y;  1KHW A;  1FT8 A;  4OX9 F;  3CMA S;  3QT6 A;  1OQ6 A;  4RZR A;  2DR5 A;  2IMW P;  3I9V 9;  4USK A;  3GE9 A;  5DGA A;  3K0J A;  4WE1 B;  1RT6 B;  1AXQ A;  1F60 B;  2H1Y A;  4KFB A;  5B0A A;  1S6Q A;  2D3O 1;  1AFJ A;  4DR6 F;  2ASL A;  2IM2 A;  1VQ5 S;  4NWX A;  2RQC A;  1H2T Z;  4EBE A;  5E3A A;  3DOK B;  1F5C A;  5IV3 A;  1MML A;  2W2M P;  1N0V C;  2XI2 A;  4WPA A;  1CEZ A;  3NKN A;  1RLD A;  3T1A A;  1IQZ A;  3KHR A;  3V6D A;  2HNY B;  3NAI A;  4EEY A;  1SJF A;  1HWJ A;  1ZZN A;  1HR0 J;  3TAP A;  4ZPV R;  4KGZ B;  4CLK A;  5SZT A;  3KLG A;  2XS2 A;  4LFC J;  3PJ9 A;  1MU2 A;  2DNM A;  3GP9 A;  4LBI A;  4MKV A;  3PTW A;  2WSC C;  4DV0 J;  1ZBT A;  1UFL A;  3ET6 B;  2XCA A;  1S57 A;  2EFG A;  4QBU A;  4J9K A;  4X4T A;  1VQM S;  1YJ9 S;  1SL1 A;  1A0O B;  3CIM A;  4DFJ A;  5KT5 A;  4JI8 J;  5AXK A;  3MMB B;  2UVR A;  2IYG A;  2XWX A;  4NA2 A;  3W65 A;  1HPZ B;  2P6T A;  3VWS A;  3O2I A;  3NMA A;  3M8S A;  3BDG A;  1D8Z A;  1W2I A;  3I56 S;  1RU1 A;  2V4Q A;  4DV5 J;  1RWX B;  2VFU A;  2L9W A;  2CPX A;  1M1H A;  4K7Q A;  3QRQ A;  3W61 A;  1T9V A;  3TUI C;  5KT7 A;  3KXD A;  4WFA Q;  1YG0 A;  5J2Q B;  2B6A A;  2PO4 A;  5KT3 A;  2LQ5 A;  1OPI A;  1LK5 A;  1S49 A;  2VG5 A;  1HHT P;  3BDE A;  4LF9 J;  1B7Y B;  3I0R B;  3W5Z A;  3FKB A;  4K4Y A;  1TKX B;  3DLJ A;  1DQ9 A;  1VC0 A;  2XSJ B;  3IC1 A;  3MPW A;  2ZH7 A;  4UOO A;  1YKW A;  1X5O A;  2BJ3 A;  1DY3 A;  4F3M A;  5F9N A;  5ADZ A;  4DF4 A;  1FNO A;  2GVD A;  4DV6 F;  2ZD1 A;  2VG7 B;  3CJ5 A;  3JQM A;  3ZTS A;  5A8W B;  4QW9 A;  1Q7Y T;  3TAN A;  1AFI A;  2L08 A;  4QWD A;  2YKN A;  4RU9 A;  1HWI A;  2ZHB A;  1NSK L;  1KS2 A;  2ILY A;  2WOM B;  4TY8 B;  4C0H A;  5GMK a;  3KK3 B;  1WTB A;  3P6Y C;  4RBT A;  2ATC B;  2MGZ A;  4ZP6 A;  3KHG A;  4A46 A;  4X65 F;  4KO0 A;  3RR7 A;  1CS4 B;  2MYF A;  2XYG B;  2L41 A;  2CG8 A;  4GTZ A;  3MM6 A;  4MFB A;  5T41 A;  1TKT A;  3SI8 A;  3NKR A;  4ZOS A;  4ZIT A;  5HJY A;  3EYZ A;  2AZ1 A;  2RIL A;  1JLE A;  5GAG I;  4Y2I A;  1YGY A;  3KK2 B;  1B4S A;  4DV1 F;  1F3F A;  4JI3 J;  2OKQ A;  3CWJ A;  1LWC B;  3HPO A;  1TZ0 A;  4NPO A;  1KH4 A;  1H0H B;  3QJP A;  3C14 A;  3GJT B;  4TXS A;  3MEC B;  2CQ2 A;  2F1F A;  2F9J A;  4NZ6 A;  2UUW A;  1QVG R;  1RTJ A;  2B7B B;  5E5N A;  2FLL A;  4B3R F;  4UOR A;  4I64 A;  4DF8 A;  4NLY A;  4YN3 B;  2AKW B;  4IRC A;  4DPO A;  2BEF A;  5D8H B;  3DLG B;  2HLU A;  3CJ4 A;  3KWM A;  6FDR A;  5B0E A;  3RAX A;  1ICE B;  2IJR A;  2DEJ A;  3MR2 A;  4I7F B;  2DD8 S;  1WG1 A;  3UR0 A;  1FXL A;  2DNR A;  2LEC A;  3FGV A;  4X62 J;  2DPJ A;  2EG1 A;  4XK8 C;  2DR7 A;  3OJU A;  5L1K A;  1HHQ A;  1LKZ A;  3DOL A;  4OX7 A;  2F4F A;  2WSF C;  1K0T A;  3UNY A;  2MQQ A;  3HJV A;  4O44 B;  2MPU A;  3ULH A;  1ARO P;  1B8J A;  1RHK B;  2BQ3 A;  4PXE A;  1A7G E;  3KUG A;  4HVZ A;  3NKM A;  1WC1 A;  2KB2 A;  2HS3 A;  2OFG X;  3KFW X;  4CTA A;  4ED4 A;  4B9N A;  2VPX B;  4NRT A;  3JS9 A;  2MDA A;  4ZVQ B;  2W9C B;  2V9K A;  2HZV A;  3BEG B;  3J7Y I;  3KNA A;  3UNG C;  5E41 A;  1KHJ A;  5IWA J;  4DV2 J;  1VRU B;  2IVY A;  3E8O A;  3HXM A;  2XY6 A;  1RWN B;  4FNI A;  3Q89 A;  3R2C J;  2EPI A;  3TJ9 A;  2CPY A;  3GSI A;  1WC4 A;  2DNO A;  1SJ4 P;  1SXL A;  3SSR A;  3ZFV A;  1KVK A;  1IR2 A;  2EKN A;  4Y3C A;  2V5H G;  3HDS A;  5KFD A;  4YR1 A;  5IT4 A;  3BKF A;  4NRU A;  3JSB A;  2QMX A;  3DPC A;  1F5B A;  5G0R B;  2XZT B;  1K9M T;  4LFB F;  3CCJ S;  2GA3 A;  3HSJ A;  4CT8 A;  1HQ2 A;  1YDL A;  1R8B A;  5M2R A;  5KFB A;  4FYX B;  3R6G B;  2OEJ A;  5CCL A;  5A2Q U;  2FLP A;  3S7R A;  1N2L A;  4LR8 A;  1FTC A;  3U7J A;  3NNA A;  5GME A;  4HHH A;  3TA1 A;  4RBV A;  2EG2 A;  4LJM A;  4NLX A;  3BO3 A;  4OI6 A;  2VC1 A;  4TVA B;  3UDC A;  1EQJ A;  3AOC A;  2KXH A;  2FD2 A;  2XS5 A;  1BQN B;  1TU0 B;  1SC3 B;  2XS7 A;  4PAB A;  4DQQ A;  4S0M A;  4OZ5 A;  2H51 B;  5D4O A;  2W9B B;  2QA4 G;  5D0R A;  3Q8P B;  1EET A;  1NJZ A;  3WX4 A;  5KXA A;  4L73 A;  1JLQ B;  4NLQ A;  5HRO A;  2GHP A;  4C8K A;  3GFX A;  1B0T A;  3N5F A;  3QID A;  3IRX A;  1X5T A;  3TVZ A;  3K5L A;  4DR7 F;  2HHV A;  2HFZ A;  3FZB A;  3M1V A;  1ZTW A;  1UJ4 A;  3N6L A;  2MJN A;  3MMB A;  1RT7 A;  4KPY A;  5HVH A;  4A8K A;  1JLE B;  1KDN A;  2QN6 B;  3HKW A;  4FN5 A;  3UDE A;  1BQM B;  3UDV A;  2JC1 A;  4WP8 A;  4N5S A;  2HIY A;  2XMK A;  1HQE A;  1W25 A;  4LF5 J;  2IA0 A;  3RAQ A;  3BDG B;  2E66 A;  2KXF A;  4P2F A;  2K1R A;  3ZTR A;  4TU8 A;  5HLF B;  1LNQ A;  2BRK A;  3FFI B;  1NB2 A;  4IO1 A;  1UCN A;  4NLR A;  5IC6 B;  4CYU B;  3CVK A;  9ATC B;  4DR2 F;  3V6H A;  2HVH A;  1XEZ A;  4F25 A;  3CTR A;  1WC6 A;  4DV7 J;  1BQX A;  4K2X A;  1P8G A;  2UUB F;  4NZ0 A;  1K1S A;  2V8P A;  1YJU A;  2MTL A;  4IOC Q;  3TP2 A;  3KUH A;  2K06 A;  2VFV A;  3TRG A;  3D28 A;  1UW9 A;  1RTJ B;  1NSP A;  1VIO A;  2ZVI A;  3OL8 A;  2IPO B;  1Z2L A;  2LP4 A;  1FVQ A;  3RU0 A;  4PXB A;  5CYJ A;  2UVV A;  2W5W A;  2RML A;  4CM0 A;  2IM3 A;  5HQL A;  2DIV A;  3J7A 1;  1MWY A;  2VG7 A;  3RRK A;  3MMA A;  2VG5 B;  3Q22 A;  3BBF A;  3A12 A;  3RG6 A;  4WFN Q;  4PKD B;  3V4I B;  2XI3 A;  4AT1 B;  2E9Z A;  3JQJ A;  3M8P A;  1N33 F;  1LQ9 A;  3CW2 C;  3NWR A;  4PYA A;  1L5U A;  1NM2 A;  3I82 A;  2V68 A;  3B5Q A;  5IQQ A;  1I3O B;  3FFI A;  1SQF A;  4CYU A;  1CS4 A;  1XIQ A;  3D6H B;  4WKY A;  3M32 B;  1FXD A;  1X31 C;  1UVM A;  1K73 T;  1VC6 A;  3QJL A;  3O6Q A;  3IO1 A;  4TY8 A;  1PC5 A;  2OPR A;  1PYS B;  3C8Y A;  3H2U B;  3JAM Y;  1U4B A;  1J27 A;  1BY9 A;  1VQ9 S;  1N34 F;  1FI4 A;  3MM7 A;  2FPH X;  2VH7 A;  1PG5 B;  3KDO A;  4ALZ A;  1SBR A;  2UUA F;  2FY1 A;  2O1P A;  4XDD A;  3OR1 A;  4DL2 A;  3B78 A;  5J1N A;  3FBF A;  5HBM B;  4ELT A;  1WHY A;  1HQU B;  1KTV A;  2PC6 A;  4OHW A;  2MZR A;  1N4L A;  3ILO A;  2FVP A;  4JI0 J;  3W8P A;  3C2P A;  1X0F A;  1E2S P;  2AJ1 A;  2DEI A;  2H5J B;  2M5Y A;  2Z0G A;  2JL9 A;  1F9E B;  1FE4 A;  3G8Q A;  3PYG A;  4CWB A;  4ERD A;  1B7F A;  5ETO A;  1FRX A;  1MU2 B;  2RB7 A;  4EBC A;  4MHX A;  5KFA A;  1R31 A;  4DG1 B;  4WYL A;  1KHV A;  4W4M A;  1R43 A;  4EO6 A;  1G6B A;  3ZTP A;  4ZVO B;  3MFI A;  4KGX B;  1NK4 A;  4DL0 C;  3CD0 A;  2FHM A;  4NA1 A;  1SKW A;  1WEL A;  3SZ2 A;  1WOS A;  1E6Y A;  2HKE A;  3QZ8 A;  2DK2 A;  2YH0 A;  1R6Y A;  1U1N A;  4C4W A;  2DCU B;  3GB0 A;  1X5P A;  5F3Z A;  1NND A;  5F8J A;  5D15 A;  1IBL J;  1DRZ A;  1RHR B;  1O0P A;  3IAM 9;  3AT1 B;  4H4K C;  3E01 B;  1EI6 A;  1IKV A;  3KJV B;  1U49 A;  3MCN A;  1JNR B;  2ZZT A;  3PEJ A;  3DRY A;  4RPF A;  1RWO B;  2RRN A;  4RR5 A;  1X9W A;  3WBH A;  3K89 A;  1X4D A;  2GQC A;  2FYX A;  2DH7 A;  4LRB A;  1S0N A;  1GXU A;  1KFD A;  1S1V B;  2BAB A;  2CJQ A;  3DMJ B;  1FKP A;  1FWL A;  2CQ4 A;  2W2P P;  3MEG A;  3SIP B;  2BKO A;  5GAH U;  3EUN A;  2D7S A;  5I3U B;  4PG8 A;  3OFH A;  3PKM A;  1VBK A;  3VV2 B;  5IM0 A;  2KYZ A;  2C2R A;  3KHL A;  5SUH A;  2Q79 A;  1CJT A;  3MAA B;  1S6Q B;  3BYR A;  1KWM A;  2MY8 A;  5J1P A;  2ZNZ A;  3KG1 A;  2AQ4 A;  2O67 A;  1MN7 A;  3NBP B;  3ZNJ 1;  1RAI B;  3L7U A;  5M2P A;  3C6U A;  3MDF A;  5H9E K;  2LDY A;  1OSC A;  4TKT A;  1GX5 A;  2XZD B;  3ISZ A;  4ZPB A;  5KG0 A;  1QE1 B;  1C2P A;  2MEW A;  2RUG A;  3BGU A;  4QWA A;  1XC9 A;  1XNR J;  4W90 B;  2W5V A;  2HHU A;  3T9N A;  3CDA A;  3R97 A;  2MQP A;  2B5J A;  4A8W A;  3LAL A;  3UCU P;  1DHM A;  2GW8 A;  5J1E B;  2WAQ D;  2HYI B;  2FB0 A;  2W7O A;  4DR7 J;  3EMT A;  3QLH B;  3VAH A;  2MJU A;  4OQJ A;  4Q2L A;  1BGX T;  4KH1 B;  4RW7 A;  3V6J A;  1FDN A;  3PIO Q;  2KT2 A;  2G9Y A;  1UVJ A;  3R27 A;  1OIA A;  3CCM S;  3OXL A;  3UO0 A;  1KQS R;  4RUB A;  1PKU A;  5I3U A;  2ZKT A;  5HRO B;  3UWT A;  3G6X A;  4UTG A;  1HNV B;  2EWH A;  3O8W A;  4ZS6 A;  2VB6 A;  1WKK A;  1HNZ J;  2A2C A;  5IQ6 A;  3LH2 S;  4DLG A;  5DG7 A;  4FF3 A;  4X4O A;  3M8P B;  1LXJ A;  2RS8 A;  3OFG A;  3D4J A;  3SXL A;  2U1A A;  3QAU A;  2C2M B;  4F7V A;  2RRB A;  2W8L A;  3KTQ A;  3QAT A;  4P7T A;  1LW2 A;  5ITH A;  3QYY A;  3EVO A;  2QFI A;  1VK3 A;  3IBC B;  1H2V Z;  2RHQ B;  1XMQ J;  4Y65 A;  4AYB D;  4Q8F A;  2YWW A;  4ATN A;  1HNX J;  1ZET A;  2IRY A;  2VPY B;  1SC6 A;  1C1B B;  2CPI A;  5HAO A;  3W60 A;  1RT1 A;  4OZJ A;  3FDS A;  1UFW A;  2QO3 A;  5B0F A;  1GEH A;  4USJ C;  5D4L A;  5I4M A;  5LSR A;  4EBD A;  2EC0 A;  3DRP B;  3MD1 A;  4ED1 A;  3MD3 A;  3MWB A;  3G9C A;  4PRF A;  2GIQ A;  3TEH B;  2IFY A;  1FJG J;  3H40 A;  1DJ0 A;  2BAN B;  2GNK A;  3J80 Y;  2FDN A;  3D0H E;  3GCW P;  2UUC J;  4X4N A;  1S6U A;  2YQ1 A;  4ZLL A;  3KLI A;  3ONQ A;  4CIO A;  1S99 A;  4B3O B;  1M5S A;  3BV8 A;  4M5M A;  1KBR A;  5CCM A;  1L3S A;  2CWK A;  3HP6 A;  1UA1 A;  1ALK A;  3BR8 A;  4DX6 A;  3J7A N;  1JLA A;  3I87 A;  2HHW A;  2VBY A;  1NJI T;  3A3P B;  3EDR B;  2MLZ A;  3GYG A;  4KH0 B;  2XSF A;  1U26 A;  4H4O B;  1WD6 A;  1X4A A;  3GR0 A;  4PR6 A;  4GKJ F;  3PW2 A;  4ZVP B;  1UPM B;  4G65 A;  3FCW A;  3W2W B;  2J5A A;  4G1Q A;  3MM7 B;  4CLY A;  1XMB A;  4B9S A;  4X62 F;  5BYR A;  4R5P A;  2QSF A;  3PJW A;  1S1W A;  3I4P A;  3KK1 B;  3P3D A;  4YME A;  3W9I A;  2VIC A;  4CLF A;  2HLT A;  2H4Y B;  2KTQ A;  1X4F A;  1K7H A;  2OAU A;  1N36 J;  3VCD A;  2AWZ A;  1HFE L;  2JEI A;  2HSE B;  3CO0 P;  2OGU A;  1T94 A;  2WBR A;  4OZN A;  5AXN A;  3VAK A;  3AXM A;  2ZJQ Q;  3O3L A;  2H9Z A;  3M2R A;  3M9O B;  4QU7 A;  3K8V A;  2PE8 A;  2ZKU A;  1S1X A;  2A6M A;  3QRR A;  4PQU B;  2D41 A;  1REV A;  2KZM A;  3HHK A;  2YNF B;  3QT7 A;  5DQH A;  4I68 A;  2IAJ B;  2V4J A;  3C16 A;  3SYZ A;  1VQ7 S;  4EI2 A;  3DXS X;  1AT1 B;  3H0P A;  1QDU B;  2ZBR A;  3IR6 B;  5CH7 B;  3OTO F;  3RB3 A;  1M5H A;  3RR8 A;  2AJ2 A;  1PIE A;  4TYB A;  2OFH X;  1X9S A;  3PO5 A;  4J37 A;  2NYI A;  1EW8 A;  4DPW A;  2F9D A;  2OPP B;  3V5R A;  2ZBI A;  3HFK A;  2DKO B;  3NOC A;  2B43 A;  1UVI A;  2R7S A;  1HNW F;  2CQD A;  1T9X A;  3DI6 A;  3PAC A;  4ECS A;  4YFU A;  4DV6 J;  1U25 A;  4BCA A;  4DN9 A;  1FNM A;  5KFM A;  3THV A;  2V94 A;  4LF9 F;  1AJA A;  5LL6 d;  2R7T A;  2ZUA A;  3TAM A;  2CPH A;  2OPS A;  1ANJ A;  3LXQ A;  4NYP A;  1ALJ A;  4CT9 A;  4YHH F;  4Z7Y A;  4ZVR B;  4ZN1 A;  3KJQ B;  1NEE A;  4FVM A;  2KHD A;  4OI2 A;  3W66 A;  3I4H X;  3MM9 B;  5HMX A;  5GAE U;  3ZZO A;  2VDH A;  4X4Q A;  4J9L A;  2NRE A;  4JYA J;  4HDH A;  3LWM A;  2KFZ A;  1AJC A;  5K5M A;  2X3G A;  2W5R A;  2W8S A;  3MI7 X;  2HVD A;  4WFZ A;  3ET6 A;  4K8R A;  2UXB F;  1Q79 A;  3PYD A;  1IKW B;  1FK9 B;  2IC3 A;  1JLB A;  1PYT A;  1KH5 A;  5DLV A;  4OHX A;  2HAF A;  2YKQ A;  3TZX A;  3DLB A;  5CA5 A;  4F02 A;  1H72 C;  4F36 A;  3F41 A;  2VPW B;  4Q8E A;  4CXK A;  1ZOT A;  2ZFH A;  1CC7 A;  4GVB B;  4LSN A;  3V4M A;  4CO3 A;  3BO4 A;  3KJF B;  3AJ2 A;  3DRP A;  3C19 A;  1IJE B;  1PSD A;  2VG6 B;  2R4F A;  1HIY A;  3OD2 A;  3JB9 k;  3CME S;  1TL4 A;  2YNH B;  1GMU A;  3D0G E;  2VKZ G;  4KRW A;  4LUB A;  3WX8 A;  1Y7A A;  3I9Z A;  3KG0 A;  1NSQ A;  3W64 A;  3B54 A;  3VVT A;  1CJU B;  3GFZ A;  3OVB A;  5FDL B;  1B99 A;  3TNV A;  3ITH A;  4GO5 X;  2R8I A;  4DL3 A;  2QLF B;  2R7V A;  4DL4 A;  5DO2 A;  4B3R J;  1KN6 A;  1Q5V A;  2ZDP A;  4O0N A;  3W9H A;  6AT1 B;  4YQW A;  4GVL A;  4JI1 F;  2E5G A;  1RAH B;  5AE3 A;  3HVT B;  2AYB A;  5KFE A;  2ZD1 B;  1HW9 A;  1XQI A;  3N6M A;  3W2V B;  5EUH A;  5KT2 A;  3J81 j;  3VGV A;  3DNC A;  2BR0 A;  3UCG A;  3J7Z T;  2G0C A;  2DTJ A;  2HQC A;  4GVB A;  1KLM A;  4ID5 B;  5THW A;  4KHP J;  2VBW A;  4B3S F;  1IQT A;  4F0K A;  2DJW A;  1X4B A;  2YNG B;  1WEZ A;  4OHZ A;  4ZCL A;  3SEO A;  5KFG A;  2UU9 F;  2A2D A;  3CB4 A;  4KQZ A;  2XWY A;  3FRZ A;  1SV5 A;  2GVZ A;  1RKI A;  2HGM A;  1X60 A;  1Q5Y A;  3MPU B;  4NL5 A;  4YB6 A;  5KFU A;  1VRU A;  2HEK A;  4J5O A;  4DUZ J;  2B9E A;  4USU A;  4EU0 A;  1SUQ A;  1YRT A;  3H98 A;  3QMQ A;  4KKO B;  4Q43 A;  3LAM A;  4A8Y A;  4PUO A;  2GHW A;  4DV2 F;  1MW7 A;  1I5O B;  2O01 C;  1N56 A;  4XTT A;  3KKF A;  2HK3 A;  5A8R B;  1URB A;  3G82 B;  2XMJ A;  3WQP A;  1U1O A;  1ZZF A;  3BSA A;  3FBB A;  3UN3 A;  2D3U A;  2RQM A;  3PR5 B;  1FF2 A;  4B3S J;  4B56 A;  1VGY A;  2YWE A;  5K8O A;  2ZBC A;  4E8U A;  1Y6V A;  2O66 A;  3SMZ A;  1UEK A;  3MMC A;  1KQF B;  3BJY A;  3UD3 P;  3QJJ A;  1RLC L;  3PRD A;  3KMQ A;  2HND B;  1OY8 A;  2J8S A;  4OZ2 A;  1SC4 B;  4PZV A;  3ENQ A;  4GO7 X;  1T05 B;  4OLP A;  3FZ2 A;  1GQE A;  3LP0 A;  4ZCM A;  5L0B A;  3M2V A;  3KLH B;  1NJW A;  1YHQ S;  2BOA A;  3M9N B;  3C15 B;  4J9O A;  4HR2 A;  1RXO B;  1WG5 A;  4M5D A;  2DNY A;  3UI3 A;  1Q8K A;  4NEZ A;  4EMD A;  3EVW A;  4ZMM A;  1U1Q A;  4LQY A;  1CG2 A;  3K59 A;  5IC4 B;  2CYY A;  3NBP A;  2W4P A;  5L1I A;  2HRY A;  4DUZ F;  4ED8 A;  1ZYQ A;  4OMF G;  4UQT A;  1VBX A;  1P1T A;  2DNN A;  4TN2 A;  3BKT A;  2BAC A;  3N9U C;  4NXM J;  1UAW A;  3CD7 A;  3OTO J;  2PI4 A;  3N28 A;  3R1H A;  2J0X A;  4P2X A;  2BDP A;  2VON A;  1Q8I A;  3IG1 A;  3L7P A;  5E3Q A;  4KFB B;  3MED A;  4I1T A;  2I0X A;  4BWM A;  4KJD A;  4KT0 C;  3H90 A;  1Y3J A;  1RAG B;  1F3V A;  3EGW B;  3DRX A;  2KJV A;  3H5Y A;  4NCB A;  1RK8 A;  2K1R B;  5HLF A;  1ED8 A;  2PFF B;  4DV7 F;  2E7X A;  4BLG A;  3MUR P;  3OUY A;  2J0W A;  2YNH A;  4RNO A;  4WU3 A;  3O1L A;  1IKY A;  4L72 B;  3MR5 A;  1KOH A;  1S1X B;  2YXL A;  4HYK A;  4ECV A;  1N5Q A;  1UPP A;  1XR6 A;  2EFQ A;  2QLB B;  4MAK A;  5A8K A;  4PG6 A;  1Q1K A;  2YWF A;  2OLW A;  2FHO B;  3CCS S;  1HHS A;  2HBY B;  2GSU A;  2ADB A;  1WG4 A;  1QLN A;  1TR0 A;  2ZBQ A;  1TVR B;  3WC2 A;  1EQ0 A;  4NLS A;  2V2V A;  1DZ5 A;  3TZZ A;  3THT A;  3MM8 B;  1N32 J;  4ECZ A;  5DG9 A;  1WNE A;  1ZEB A;  3CED A;  4V1A k;  2FVC A;  4NLT A;  3G8S A;  2HFN A;  1RT4 B;  1ULR A;  2HGL A;  2J7K A;  3GSD A;  4CO1 A;  4K4Z A;  4C3L A;  2OEM A;  3DI6 B;  3Q2S C;  4IDK A;  3IWX A;  3KLI B;  2B4V A;  2MKY A;  4KV8 A;  1GTE A;  1DTT B;  2HQG A;  4R8U A;  4U7U D;  3FNN A;  4F4X A;  3A4T A;  1LEO A;  1QE1 A;  4KJI A;  2BQU A;  2BKN A;  5CYQ A;  2IMO A;  5IOL A;  5FLX Y;  1RAJ A;  4J9Q A;  2R7R A;  1KLM B;  2E29 A;  3AQP A;  4ID5 A;  2VV5 A;  1ELO A;  1F6T A;  3S6E A;  4MIA A;  2XY7 A;  4J9M A;  1N36 F;  3ETM A;  4F4Y A;  4LSN B;  1NME B;  3K58 A;  4UST A;  2CG4 A;  4FYV B;  5B0C A;  2RKI B;  5HMZ A;  3TEG A;  2M7S A;  3MR6 A;  2VC0 A;  1SQG A;  4OI3 A;  5D6G A;  4ZVH A;  3MM6 B;  2P6S A;  4ECQ A;  3RBD A;  2JEJ A;  4PWW A;  1NKC A;  2V50 A;  3NGK A;  4CLP A;  1VJW A;  2V67 A;  3TWZ A;  2ABY A;  3IR7 B;  1HBM B;  2VA3 A;  2DNH A;  4TNO A;  4JI2 J;  3OLB A;  3OJS A;  2BOP A;  1EKS A;  2GJI A;  3IM9 A;  3IGV A;  1FTR A;  4HT7 A;  5LSL A;  1Z4U A;  5CYM B;  3MUV P;  1RYR A;  4FP9 A;  2GGP A;  3UPF A;  4TU9 A;  1NB7 A;  3WAX A;  3Q8R B;  1N6Q B;  3M7V A;  2CVI A;  3PYF A;  4R0J A;  2MB0 B;  3PXG a;  2E5L J;  2DNP A;  1RAA B;  2F8H A;  4UZC A;  3UN5 A;  1RAE B;  3FCH A;  2BE7 D;  3QAE A;  1Q53 A;  3LP0 B;  1KQG B;  1N54 B;  4RWX A;  3QO9 B;  5K8N A;  3IA0 A;  4O4R A;  3AOA A;  3CMQ A;  4BDP A;  2W9A A;  3BF4 A;  1P49 A;  3RZA A;  3HX9 A;  2JLE A;  1RBO B;  1U0S A;  3PRB A;  4DFM A;  1MG7 A;  2BX6 A;  4U95 A;  4ZIW A;  1NK5 A;  2E5L F;  3NS6 A;  1XNQ F;  1G7C B;  2QIF A;  3CNQ P;  2XLI A;  4AFF A;  3K7R A;  3EZ5 A;  2DVI A;  2HBZ B;  3SFU A;  3OPK A;  4IH7 A;  3IS9 B;  3TA2 A;  4ZLP A;  3H4D A;  1Z2Z A;  3DGV A;  2VJV A;  2MZJ A;  3SQG B;  2N4D A;  2FQQ B;  4CO5 A;  1SL0 A;  4CO4 A;  1SL2 A;  4JI7 F;  3RGI A;  2HMI B;  1XNR F;  3NKP A;  4MK9 A;  1ALI A;  4O4G A;  4GMK A;  1B64 A;  3EJM A;  3J80 U;  3LWL A;  1S9E B;  3NWG A;  3VGU A;  2YKA A;  1VRQ C;  3TJ8 A;  3VTI A;  1VFJ A;  1RI7 A;  2RQ4 A;  3AB2 B;  4X66 J;  3VAM A;  3LW5 C;  1TL1 A;  1RTZ A;  3O5T B;  3PV8 A;  1JB0 C;  4FDF A;  3NKY A;  5ETQ A;  2W9B A;  2WB4 A;  1S79 A;  4U96 A;  5IT0 A;  1HL6 A;  2CDR B;  3DXB A;  1WJ9 A;  4O0I A;  2V9W A;  4BC9 A;  4IG0 A;  1Y5I B;  4NYZ A;  4AD6 A;  5B0D A;  7FD1 A;  5ETR A;  5HMY A;  2FVR A;  4X64 F;  4MIV A;  1FWK A;  1XK8 A;  4KAI A;  3SFG A;  5J2M B;  2GSO A;  1U6Z A;  2DGT A;  2I6W A;  4FDI A;  2PI5 A;  2KN4 A;  2PT0 A;  4RW4 A;  3GYX B;  2LU2 A;  4P72 A;  3EWG A;  1Y7P A;  2DHA A;  2KM8 C;  2IUC B;  1RT2 A;  1IVZ A;  3BKU A;  4V19 X;  2YWH A;  2F63 A;  1GT8 A;  3R2D J;  2DH9 A;  2AX0 A;  4L3K A;  4GTY A;  1TKZ A;  2DYA A;  2XTJ P;  1OSD A;  5D0H A;  4FXW A;  1Q8B A;  4DZ6 A;  3JSM B;  4GKK J;  1HAR A;  3E2D A;  1Q81 T;  4ZDN A;  2Q1L A;  2ZC3 A;  4C7Q A;  1OJ4 A;  4MK8 A;  1KHK A;  3ENA A;  3A3N B;  5CD4 H;  1S72 S;  3G6E S;  3ENW A;  3WAV A;  3DM2 B;  2DRB A;  2G9O A;  4R8U B;  3GPA A;  1WC0 A;  2IIH A;  2BRL A;  4PXC A;  5K8P A;  4Q44 A;  4ZPC A;  2ZH1 A;  4CRJ A;  5HAN A;  1R7I A;  5B0G A;  2HHS A;  1HI8 A;  2EFN A;  3MPV A;  3NKQ A;  1MN9 A;  4CLT A;  4GKK F;  2KRB A;  1HA1 A;  4URS A;  2FJV A;  4USV A;  3CC7 S;  3ZZP A;  4JYA F;  3CJ8 A;  3D6F B;  2V2K A;  4I6Y A;  1KD1 T;  3HKZ D;  1IR0 A;  1TK0 A;  4K4T A;  2ZZM A;  3CCZ A;  4U8Y A;  1Z1Z A;  4YB1 P;  3GIJ A;  1VJQ A;  3Q24 A;  2XRG A;  3HCX A;  1HYS B;  3M32 A;  5EDW A;  1IKY B;  4DBQ A;  2XC9 A;  3PX4 A;  5CXT A;  1F9F A;  2JNJ A;  3A3O B;  4WU2 A;  2QSW A;  2BA9 A;  4N77 A;  1FKA F;  1HQU A;  1R8A A;  4ZP8 A;  4ANC A;  4F26 A;  2WZ1 A;  2BZ2 A;  3T19 A;  4NLW A;  5FII A;  5AXM A;  1FJG F;  5HRT A;  4Y34 A;  4OZ3 A;  2FJB B;  4DJB A;  4DSF A;  2ZZN A;  4P10 A;  4NI2 A;  1D09 B;  1DLO B;  1UZD A;  2O5D A;  2Z2L A;  4WIQ A;  4UZB A;  2MGZ B;  2AW0 A;  3OTC A;  3MOZ A;  1NK0 A;  1N33 J;  2XZW A;  2HW3 A;  1KH7 A;  3MCO A;  2CJK A;  4C3K A;  2P5V A;  4K4X A;  4QQB A;  1RWW B;  4X84 A;  2NLW A;  3CCV S;  4UPL A;  3NGD A;  1RT6 A;  3KLE B;  3E3X A;  4NAS A;  1AB8 A;  1GFW B;  2QL9 B;  3FCV A;  3KK2 A;  1HDH A;  4CTA B;  1XR7 A;  2PSZ A;  4L76 A;  1RHJ B;  2B8P A;  1HW8 A;  1R89 A;  4JB8 B;  5DDO C;  2MKI A;  4OJ1 A;  4HH0 A;  4XPC A;  1S1W B;  4EFA C;  3M05 A;  3I32 A;  4JI0 F;  2ZOM A;  2NXE A;  1ITP A;  1XNQ J;  3C15 A;  3POT B;  1KEK A;  2OD6 A;  4AE5 A;  5KTQ A;  5KAK A;  4E0D A;  1UW4 A;  2G4B A;  1KR4 A;  1PAU B;  2E1C A;  2RUS A;  1RWM B;  2UUA J;  1V5I B;  2D74 B;  3DGP A;  1H6K X;  1X4H A;  4ETX A;  3P45 B;  3HLU A;  3O44 A;  3KHH A;  2SXL A;  3CC4 S;  1FRH A;  1KKH A;  1WI8 A;  4I2Q A;  4OI4 A;  3GV5 B;  1GH8 A;  1S9E A;  2D1C A;  4IFV B;  1VMB A;  5A0Y A;  1QTM A;  3LTO A;  4RWW A;  2AGP A;  4B9L A;  2QLW A;  2LQJ A;  9RUB A;  3CDW A;  3M6W A;  1TAQ A;  2EC2 A;  1EP4 A;  3IRW P;  4Y2C A;  2DHS A;  4O3S A;  5JVG Q;  2IA6 A;  4ZVF A;  1A9N B;  4O44 A;  4YS2 A;  4DV0 F;  4ZPW R;  1S1V A;  3NMR A;  1YJV A;  1SPB P;  4QAX A;  2KI2 A;  4QR0 A;  3DOL B;  5B0B A;  4QPT A;  1Y9O A;  1Q16 B;  1N6Q A;  1AJB A;  1O51 A;  1RWP B;  2OPP A;  3JQK A;  2LQ9 A;  4FKX A;  1T11 A;  3MED B;  4ETZ A;  4Q7A A;  4MT1 A;  2UUC F;  4J9N A;  1NJY A;  1E33 P;  4CO0 A;  1RAC B;  1WOO A;  4YHH J;  2KG1 A;  1GMW D;  1RT3 B;  3IM8 A;  3LO3 A;  4TQS A;  4AL6 A;  1Q7L B;  2RRA A;  4B9U A;  1OYE A;  3D9B A;  3J7Z 5;  3TZY A;  5C24 B;  1CSJ A;  3R5B A;  4NWJ A;  2CAJ A;  3D5M A;  4IH6 A;  2FGC A;  4ZLN A;  5IV4 A;  5D4N A;  1ZEF A;  2CRL A;  5KFO A;  3B82 A;  3K5O A;  5KFS A;  4OYW A;  1E3C P;  1TQL A;  1QY7 A;  3WBZ A;  5KFW A;  4P7V A;  3DCA A;  2P9E A;  4LT6 A;  2NUU G;  3PIP Q;  4DR1 F;  2R8J A;  2RQK A;  2V4J B;  2CQH A;  3M9M B;  1DTT A;  4ILL A;  4ES3 A;  2RJZ A;  3BN4 A;  3L09 A;  4MIB A;  4USH A;  2YKP A;  1B70 B;  2DB1 A;  2HWH A;  2QA4 S;  2VU5 A;  3I5A A;  1U0H A;  3IXQ A;  5KFV A;  4HH1 A;  1RBL A;  1DTQ A;  1WI6 A;  4OX8 A;  2C1E B;  2F5G A;  3QGP A;  2XGP A;  1KHN A;  3ZZT A;  4NE9 C;  4DHV A;  3H5X A;  5LT5 A;  2M0G B;  2XO7 A;  3DRR A;  4YB7 A;  5F8I A;  2ZC4 A;  1TK5 A;  1RTI B;  2OJ3 A;  4RLE A;  5DQG A;  3L4B C;  2IM1 A;  2RH3 A;  1JXE A;  2J9C A;  1DBD A;  1HBO A;  2OHD A;  2ZE2 A;  1Y4Z B;  4FKY A;  5F8L A;  3L3C A;  1QSS A;  1H38 A;  2UXD J;  2M52 A;  1S1U B;  2XR9 A;  1Y10 A;  5H9F K;  4FNH A;  3M8R A;  1S9G A;  3P8B B;  2B6A B;  5E3P A;  2KZZ A;  3OFE A;  4PG4 A;  2CKW A;  2QE5 A;  3HT0 A;  3SCK E;  4RNM A;  3DU6 A;  3W3S A;  5K4P A;  2UZA A;  3NAH A;  1EJ7 L;  3Q8V A;  3ZZY A;  4IRK A;  2OEL A;  4X4R A;  1RTI A;  2KO1 A;  3EGN A;  1GXT A;  2FY8 A;  1YLX A;  5TJ3 A;  3SZY A;  1SJQ A;  4HAC B;  3GR1 A;  1YJ7 A;  1S4F A;  5CYM A;  4JI8 F;  4DU8 A;  3LGM A;  3W1Y C;  4K0K J;  1VQ6 S;  4OYX A;  1ANI A;  1Q78 A;  1YVF A;  5DM7 Q;  2DIS A;  8RUC A;  5IJQ A;  4PG5 A;  3VGT A;  4B3M J;  2FZK B;  2OEK A;  1TFY A;  2J9D A;  4LSZ B;  4KHP F;  2XY5 A;  4MYU A;  4DV1 J;  1BLU A;  3MHY A;  4ECY A;  3WDO A;  2Q66 A;  5E33 A;  2N7C A;  5CAA A;  1LW2 B;  2W7A A;  5ETM A;  2DXF A;  4LQ3 A;  1IBK J;  1NJX A;  2KL8 A;  3AAW B;  3SV3 A;  4RW9 A;  2MZQ A;  5E7O B;  2X1A A;  3UD4 P;  1S10 A;  2WVC A;  1YX2 A;  2GX8 A;  5DS7 A;  3MMA B;  2LVW A;  1U6F A;  2DHX A;  4OHV A;  4PG7 A;  4ZCK A;  3W8G A;  4IYQ A;  3UDL A;  3CT9 A;  4MKY A;  2B8Q A;  1WEX A;  1ZM3 A;  1XBW A;  2NZC A;  1FX2 A;  2NXU A;  2YNI B;  2WON B;  4BWJ A;  2GHV C;  3MMJ A;  4X64 J;  3NVL A;  3OXG A;  3UFC X;  5DG8 A;  1JLF A;  1Q4R A;  2CJ9 A;  4O4G B;  2MQL A;  2W2N P;  3JTP A;  4UW2 A;  1UZH A;  3THP A;  2W24 A;  2W5S A;  3N01 A;  4K0K F;  2D9O A;  4BC7 A;  3UCZ P;  3U1M A;  4P74 A;  5L9X A;  1PYO B;  4IG3 B;  5KFY A;  3FMW A;  4DCO B;  1JIH A;  4ECW A;  1Q8L A;  2DNK A;  2GFF A;  3RW7 A;  2F4V J;  1UET A;  3CD6 S;  2WVF A;  4JP8 A;  5JXS A;  2CJB A;  3NCP A;  3G96 A;  3KOA A;  2P2C B;  1APS A;  1TL1 B;  5KFL A;  2HQD A;  4D3H A;  2VHG A;  5G4D A;  1FD8 A;  1I94 J;  3CCQ S;  1HLW A;  2HFO A;  3PYE A;  4EZ6 A;  5HP1 A;  1CJT B;  1NZ8 A;  1S12 A;  3J81 Y;  1RA7 A;  3AB4 B;  5FD1 A;  5GAD U;  2R8G A;  5C25 A;  2E44 A;  3MK1 A;  2CQI A;  2VUG A;  2IDE A;  1PJ5 A;  1WHW A;  1WDD A;  3A8J A;  3NGU A;  2RVJ A;  2V34 A;  3QBC A;  3SBM A;  1KOO A;  1L3K A;  1FJE B;  1RT5 B;  2AJF E;  2F3J A;  1YZ7 A;  3BGL A;  2PDA A;  5KG3 A;  2JX2 A;  4ZHR B;  1H2U X;  2LKZ A;  3GWC A;  1F2H A;  4P2M A;  2P9G A;  4P9S A;  2AGO A;  4DR4 F;  4ELU A;  3QO9 A;  4QYZ K;  2PMW A;  4EWT A;  2MKK A;  3DLK B;  2KFY A;  3OL6 A;  3CXC R;  2CFX A;  1YRX A;  3GII A;  5LXY A;  5IZH A;  2K8G A;  4DR1 J;  1VDH A;  3H8Y A;  2DGX A;  3T41 A;  2B56 A;  4QJV A;  4LFC F;  3DDI A;  3T5L A;  2C2K B;  1WKJ A;  4ZVE A;  3F44 A;  2QRR A;  5CD4 A;  3D2W A;  1HR0 F;  3K5M A;  2RDJ A;  2DNG A;  4ICL A;  5I3P A;  2V8V A;  4FPI A;  4EGL A;  3ZZR A;  1SH0 A;  2W4D A;  4GC7 A;  2C2E A;  1EAR A;  3LF0 A;  1SB6 A;  2F8E X;  2ZDO A;  4OJG A;  4ECU A;  3HHL C;  4DSJ A;  1LFW A;  2XYP B;  4X4U A;  3RRG A;  4AQY J;  3I0S B;  1IKV B;  2ROG A;  1HBU A;  3KMS A;  4HAC A;  2GCF A;  5FJ4 A;  2C3P A;  3BGR B;  1EW9 A;  4M8L A;  1SQE A;  2CZV C;  2WOM A;  3FJ2 A;  1JK9 B;  1FKO B;  5DET A;  4DV5 F;  1LW0 A;  2E7V A;  3BN7 A;  3OTB A;  1O8B A;  4J9V A;  3ZZZ A;  3GV7 B;  4DR2 J;  2J0S D;  3N79 A;  3FEY B;  1HYS A;  5LIA A;  4N8O A;  3K57 A;  2WVE A;  3H4B A;  1PIL A;  2ZH8 A;  1XN9 A;  4Q0B B;  3RB6 A;  4F2S A;  2QLJ B;  2C3U A;  3R1L A;  5DDP C;  3MOJ B;  3BGF A;  5EX0 A;  3SZZ A;  4P52 A;  4C97 A;  3FEX B;  5CZX A;  4OYM A;  5D77 A;  2ANH A;  1JLQ A;  1UMJ A;  4O3R A;  1HQE B;  4RNF A;  4F04 B;  2BJ1 A;  3OUY B;  3GJQ B;  1GXL A;  4IOB A;  2ZVS A;  3ZZ0 A;  3QRP A;  2NXN A;  4DCJ B;  1U0H B;  4FXV A;  4NZ7 A;  2MZS A;  1X0P A;  2JFK A;  2B4O A;  3MTJ A;  3S01 A;  5KFH A;  4K4S A;  1SH3 A;  2AD9 A;  1BXN A;  3M6V A;  1MNE A;  3F73 A;  3CDE A;  2JH3 A;  1VLY A;  3GIR A;  4OYO A;  1YBA A;  4L6V 3;  2CQ3 A;  3KK3 A;  3H59 A;  3P5B P;  4H54 A;  4X2B A;  2M70 A;  4GC6 A;  1OYD A;  1YQH A;  3CIZ A;  3UW1 A;  3ZXW A;  3CPW R;  4JI3 F;  1J2V A;  2IVM A;  2LXF A;  4B17 A;  1OY9 A;  1KNZ A;  1CQN A;  2N3L A;  1TFW A;  1RYS A;  3DHW C;  3CE8 A;  3T6J A;  1RBA A;  1RA6 A;  1TEL A;  3R7B B;  4N56 A;  2P9C A;  2ILZ A;  3CDU A;  4LRE A;  5A76 A;  4B3M F;  1XMO J;  3ZTO A;  4KJG A;  3CJ0 A;  3GJR B;  2YX4 A;  2BW2 A;  3PJX A;  3T6B A;  5KFC A;  2J6S A;  2LCW A;  4QIE A;  2AV5 A;  3TX0 A;  1VQL S;  5KFR A;  3TOQ A;  1C0U A;  5GAE I;  2BE9 B;  2MZ1 A;  3BYP A;  1E1Z P;  2FGO A;  5LRN A;  5KG7 A;  2YKM B;  1JJC B;  3ITH B;  2DHG A;  5G0R A;  1KP6 A;  5H1S V;  5C5J A;  2FJW A;  4DWI A;  4LBH A;  2IM0 A;  5KG2 A;  1AA1 B;  2I9S A;  4O3Q A;  4TU7 A;  2B9W A;  3KLE A;  1K44 A;  3AFG A;  3NCQ A;  1RT3 A;  3JAM U;  2YKO A;  3TVY A;  4WZM A;  2ZNY A;  4USI A;  1HI1 A;  2AZ3 A;  2QYC A;  2QTW A;  3NRB A;  1XJW B;  2MLY A;  1RTD B;  4ZVG A;  3EX7 B;  4K59 A;  1S9F A;  4EZ9 A;  4HKQ A;  3CJK A;  2J76 E;  2FJX A;  5DLT A;  4DX7 A;  4QWB A;  4I7F A;  1F9H A;  3M8Z A;  3BDH A;  3HFV A;  4GTW A;  4LF6 F;  3CO9 A;  4ZGA A;  4Q2M A;  1UA0 A;  2KRR A;  3DRS B;  2VIH A;  1NHK L;  1T3O A;  4N8N A;  3H5U A;  3C6U B;  2LEP A;  3TUJ C;  2JZ5 A;  4DLE A;  1U1M A;  1RAD B;  1N34 J;  1BUX A;  4RNH A;  1S1T A;  3ZNU A;  5LSO A;  5LJ3 Y;  1B0P A;  3QFW A;  1FX4 A;  1YWX A;  2D3Z A;  3AD8 C;  3FSX A;  1R8H A;  2CA9 A;  2UXC F;  2HQI A;  2X3D A;  1UEU A;  1DTQ B;  4U67 Q;  1LW0 B;  5EWG A;  4J9P A;  1AYE A;  2OPS B;  1NK7 A;  3IWN C;  3OVA A;  4ENO A;  1J5O B;  3D6T B;  2Y1I A;  3DLE B;  4N47 A;  4Y00 A;  1HBU B;  5F8H A;  5KFN A;  1KSP A;  2HNZ B;  1H7X A;  4KHM A;  4NEY A;  3AD7 C;  2KT5 A;  4RO0 A;  4Y6I A;  5AXL A;  5MLC V;  1O98 A;  4QIG A;  2X7I A;  2VKR A;  2B7C B;  2JC0 A;  2RSQ A;  5CZV A;  2YKN B;  2VFR A;  4JI6 F;  4CLW A;  1G1X A;  1IBC B;  3NGR A;  3FBC A;  3P5T L;  4URG A;  5EN1 A;  1DAX A;  1HNZ F;  2XHC A;  2VPZ B;  3GIM A;  3C66 A;  2FLO A;  4ELV A;  1Q0N A;  1S7I A;  3TQE A;  3RAM A;  3R5G A;  3TAR A;  1PGZ A;  3GON A;  1U8S A;  2H5I B;  1SJ3 P;  2LDI A;  5DM6 Q;  3UQS A;  4LF5 F;  2BVZ A;  1N8R T;  4ITS A;  3OQ2 A;  3VF0 B;  2C2O B;  2LMI A;  3F56 A;  3M8W A;  5F3T A;  2DHH A;  3HZG A;  4Y0F A;  1RAF B;  4J9S A;  1FEE A;  1LV5 A;  4B9V A;  3G86 A;  4C8L A;  2B4P A;  1F5A A;  4RUH A;  3EGZ A;  1V3S A;  1CJU A;  4WXW A;  1JKH A;  1N5Y A;  5K14 A;  3CJ2 A;  1MMN A;  2E1P A;  4U7U K;  5LJ5 Y;  1HPZ A;  2UU9 J;  3DLG A;  2C2D A;  2UXB J;  4ZPA A;  1KH9 A;  3W63 A;  3IR5 B;  2N3O A;  2M3D A;  4F67 A;  4LRD A;  4OI0 A;  1IKX B;  3HJF A;  4OYA A;  2DGQ A;  3NP5 A;  1EIY B;  3IRX B;  3CSK A;  4WII A;  4C48 A;  4LR2 A;  3ZTQ A;  5L9N A;  5KFK A;  3H20 A;  1N0U A;  5J2Q A;  4O23 A;  4C3M A;  3GU0 A;  5KFT A;  1VQ4 S;  1Y3K A;  4BHQ A;  5F8N A;  3QLH A;  4WFB Q;  4ILR A;  2ZH6 A;  3SV4 A;  1NKB A;  3W5X A;  1JMT A;  3GLJ A;  5C7P A;  1S9G B;  1GAO A;  2Y1R I;  2MQM A;  3M30 B;  5BYQ A;  4XIU A;  4IG3 A;  4IRD A;  1TTH B;  3HHE A;  3TA0 A;  2EFO A;  4OYP A;  4USW A;  2Y8Y A;  3V81 A;  2DIU A;  2ZE2 B;  4KO0 B;  4OX6 A;  4OYZ A;  1RCX B;  4H4K A;  4MKB A;  4WFX A;  1C4A A;  1HD0 A;  1ZM9 A;  2C3M A;  3K5P A;  2JWN A;  3RB0 A;  1UFK A;  1S97 A;  4RU2 A;  1RTD A;  3TG0 A;  3VAF A;  3OHB A;  1JJ4 A;  4WKR A;  1CUL A;  8ATC B;  2KVI A;  2MKH A;  4PPD A;  2Z57 B;  1BMQ B;  4KGM A;  1U2R A;  3MFH A;  4DR4 J;  1LWC A;  2QA2 A;  3NNC A;  5BYS A;  1E6Y B;  4OJH A;  2G13 A;  2IBO A;  4DL6 A;  1P6T A;  2A3J A;  1NPP A;  1BE4 A;  1FER A;  4J7C A;  4RUA A;  1RSC A;  4IFY B;  2XNQ A;  2V0N A;  5DJB A;  5A6W A;  3HVR A;  3CCE S;  4ED3 A;  4LF8 F;  1C1C B;  1NHU A;  2GMH A;  2HWI A;  3HF5 A;  4LF1 A;  4M5L A;  5IWA F;  4DSE A;  1NPR A;  4CCH A;  3MK0 A;  4PXD A;  2KXN B;  4QWE A;  2BUN A;  5ETP A;  3BZQ A;  4OX9 J;  5KFJ A;  4FBT A;  5T14 A;  4L3N A;  1VI7 A;  1UP1 A;  1X4E A;  2BM0 A;  3G6Y A;  4DV3 F;  2DR9 A;  3PFO A;  3Q23 A;  2IY5 B;  1N52 B;  4E2F B;  1CJK B;  2CQC A;  2OMO A;  4ZKA A;  2VF3 A;  4HTJ A;  1YSJ A;  2XMV A;  4DMZ A;  2Y9H A;  2XMW A;  3L95 X;  1U2C A;  2ZH5 A;  3WZ0 A;  3LOU A;  2HRU A;  2AP6 A;  1N32 F;  3DDN A;  2DIT A;  2F40 A;  2BE2 B;  2W8K A;  3TX8 A;  2HK2 A;  2BQR A;  3H42 A;  1SJ1 A;  3NS7 B;  3OSN A;  3RJM B;  2UXC J;  3R7N B;  5AJ3 F;  3KK1 A;  4FS1 A;  1UL3 A;  2AJ0 A;  4ZJQ A;  4RW8 A;  3VZI A;  3T1Y F;  3P96 A;  1QAI A;  2RU3 A;  2R7X A;  1VK8 A;  2CNK B;  3BGR A;  5CQG A;  1VBZ A;  1U1P A;  3HVW A;  3VZH A;  1MMD A;  1B3T A;  4NWB A;  1TVR A;  2CPF A;  4LQ9 A;  1RWV B;  1WDT A;  5KFZ A;  1S76 D;  4PPZ A;  1CJK A;  3T5J A;  2AEJ A;  2ZUG A;  4CO2 A;  5A8K B;  4CI0 B;  5IXU A;  3DDK A;  3OL7 A;  2GSN A;  4P73 A;  5IM0 B;  3T5H A;  1FRJ A;  2V6A A;  1PO6 A;  4Z7C A;  3G87 A;  4DQP A;  1E6V A;  2CZ9 A;  4CNZ A;  1TL7 A;  2AJ4 A;  4PCQ A;  1VQY A;  2QC3 A;  4B02 A;  4EYI B;  3TI0 A;  5EWE A;  1U1R A;  1C0T A;  2BJ8 A;  2R8H A;  1SJR A;  5KG4 A;  3SDE A;  4UPI A;  2R7O A;  2A10 A;  3AJ1 A;  3SCL E;  2VOP A;  2VD3 A;  3OFF A;  3Q8Q B;  1JLC B;  1TL3 B;  1LWX A;  1U2F A;  2QGF B;  3I31 A;  1TL5 A;  4U6P A;  2MQO A;  1FXR A;  2EBE A;  4PQA A;  3NCR A;  1IM4 A;  2XEX A;  4JOU A;  4X4P A;  2ZH3 A;  1YIJ S;  1J5E F;  3BBB A;  1CJV B;  3CD5 A;  1QJH A;  3LAN A;  2XG8 A;  1JJH A;  2LEA A;  2UUT A;  2JLF A;  2WBM A;  3BH6 B;  4P75 A;  3QSY B;  4NMX A;  1RGV A;  2KDO A;  1S0M A;  2NQP A;  4RW9 B;  5L46 A;  3JTO A;  4LBP A;  4B9M A;  5A6P A;  2K2P A;  1YRU A;  1CUL B;  3D68 A;  4NX9 A;  5L1J A;  1U24 A;  2KHC A;  1FRL A;  3HUL A;  3RBX A;  3RBE A;  1ZAW A;  4LIW A;  4DDF A;  3D0I E;  1ELY A;  1FFW B;  1UWB A;  2M88 A;  2MKC A;  3OT9 A;  4Y28 C;  4ZPD A;  2YVS A;  4OYB A;  2OP5 A;  3DC2 A;  5KG1 A;  4JV1 A;  2I1R A;  3BM7 A;  4JV2 A;  1S0O A;  4E98 A;  2HZC A;  1IUJ A;  2H5E A;  2V8D A;  2C3Y A;  4F0M A;  5HMW A;  1HNV A;  3T3F A;  2NSB A;  3T00 A;  2A0F B;  5C2C A;  2ALZ A;  2F8M A;  5AE2 A;  2FZG B;  4A8O A;  2RE1 A;  4H4O A;  2DGS A;  2OSR A;  4ED5 A;  3H2V E;  1RDR A;  3VQS A;  3QT5 A;  3KDN A;  1JLF B;  4HHJ A;  5F0W A;  2GGP B;  2DBB A;  1TMJ A;  1ROF A;  1U09 A;  3EVM A;  1HI0 P;  1N5Y B;  4A8F A;  1SUQ B;  4KKO A;  2Q6B A;  3NLC A;  3Q8S B;  3MPD A;  4A47 A;  1TV6 A;  4A8S A;  2KJW A;  2WVB A;  3PEH A;  4KIA A;  2FVS A;  4C8Z A;  2ZBP A;  3WAW A;  4CYR A;  3LGN A;  4KR0 B;  1ZAX A;  4J9R A;  5JUM A;  1FES A;  4AUK A;  2OIH A;  4LF7 J;  4J91 A;  1RCO B;  2LA4 A;  4CLU A;  5I3Q A;  3EXC X;  1UVL A;  2ROP A;  1VHF A;  2QA1 A;  5KT4 A;  1WKL A;  5FDL A;  2E9R X;  4M5D B;  2QT7 A;  1REG X;  4LF4 J;  3NNH A;  4M5H A;  2K3K A;  4PQU A;  5LXR A;  1EX8 A;  3T1H F;  3VHQ A;  2F65 A;  3S1T A;  4JI6 J;  1WF2 A;  2PEB A;  2FUG 9;  5JVH Q;  3LP1 A;  4G1P A;  2IFX A;  2ZH4 A;  4RNN A;  2D1G A;  3W2V A;  3IBW A;  2MHE A;  2R2T A;  4QR2 A;  4Q5V A;  4U8V A;  4M94 A;  4IOA Q;  5HL7 Q;  1GMV A;  3M8Y A;  2NCK L;  4D3G A;  3K5N A;  1JNZ B;  4JV5 J;  2GLQ A;  2ACY A;  2H4W B;  1CVJ A;  1S6P B;  2NXC A;  2QG9 B;  2FLN A;  1V6H A;  3DN9 A;  1T9W A;  3EIC A;  3Q83 A;  3HHD A;  3ZZU A;  4QPX A;  4FF4 A;  4ZG6 A;  1VCT A;  1OQ3 A;  1T95 A;  1VLO A;  2IRX A;  2KT3 A;  3OR1 B;  1T3N A;  3P49 B;  4PWD A;  2W9C A;  3TAM B;  3BQ0 A;  1S7H A;  3LP2 B;  4Z2X A;  4DQI A;  3QGH A;  2B51 A;  1MRO B;  2MLX A;  4N41 A;  1EP4 B;  1NZA A;  4OL8 A;  1MWQ A;  1EET B;  5J1E A;  1UWA A;  3QPI A;  3QWU A;  1S6P A;  2I2Y A;  4B08 A;  1T7P A;  1IM6 A;  4KBI A;  4OJ3 A;  5MAO A;  1A6L A;  1GNK A;  2AJQ A;  5GOV A;  4LFA J;  1JLB B;  3P4U B;  2BXJ A;  4DQR A;  3MM9 A;  1TK8 A;  2HIQ A;  2J8A A;  3OR2 A;  1HBO B;  4PWU A;  2E1R A;  1URR A;  1WUU A;  3T9Z A;  4IO9 Q;  2IRU A;  3DM2 A;  3T1Y J;  1R0A B;  2XB2 D;  2N82 B;  5EGE A;  1N5T A;  1REV B;  4ZCI A;  2I5J A;  1LOU A;  2PII A;  3DRR B;  5E3C A;  1R0B G;  4O3P A;  3N4W A;  2H65 B;  5B09 A;  5D3G B;  1JXL A;  4MKA A;  5KT6 A;  4IR9 A;  1SKS A;  2DGO A;  1RHM B;  2IHR 1;  2MSS A;  2YY3 A;  1L3U A;  1J5E J;  3PO4 A;  1V9O A;  5C24 A;  3UE2 A;  5M2U A;  7FDR A;  2OUG A;  2CQP A;  3IDD A;  4GTX A;  3BSC A;  5HQM A;  5LMN J;  4DI6 A;  2HHQ A;  1KON A;  3MTK A;  4BS2 A;  4ED0 A;  1N88 A;  4WF9 Q;  5CYQ B;  3H25 A;  5J2P A;  1FCA A;  1RT2 B;  2WVD A;  4NCG B;  4QIW D;  5C42 B;  5HSP A;  5CHC B;  4NI2 B;  4UY8 T;  1QAY A;  2AT1 B;  3SCJ E;  3BDP A;  1PC4 A;  3HMJ G;  1EB0 A;  1FJ7 A;  2FTR A;  1AUK A;  3PCO B;  5F8M A;  4ANE A;  3D54 A;  1R0A A;  2KM8 B;  4LVO P;  4ZVS B;  1R6V A;  4UPH A;  4UOF A;  4NXN J;  1U7L A;  1LXN A;  1RT7 B;  1RZM A;  2JSX A;  4NA3 A;  1VC5 A;  2ZJR Q;  3OHA A;  2N4C A;  1N2K A;  1VRT A;  4QW8 A;  2AX1 A;  1O5J A;  5JMN A;  4P6Q A;  1FVS A; 
#chains in the Genus database with same CATH homology
 4GTZ A;  5TJ3 A;  3SZY A;  2W5W A;  4LR2 A;  4UOP A;  3NKR A;  5INH A;  1ANI A;  1O99 A;  3T00 A;  1AJD A;  3CMR A;  1KH4 A;  2RH6 A;  5HRT A;  4MY4 A;  5AJ9 A;  3A52 A;  3B5Q A;  1SHQ A;  2IFY A;  1KH7 A;  3IGZ B;  3UN2 A;  4UOR A;  4ZG7 A;  3TG0 A;  1ED9 A;  4LRC A;  4UPL A;  4LR9 A;  4ZG9 A;  3TWZ A;  5EGH A;  4LRE A;  1HDH A;  5IJQ A;  3WAW A;  4CYR A;  2W5Q A;  4KJG A;  5L0K A;  3NVL A;  3TX0 A;  1ALK A;  2W5T A;  1EW2 A;  3WAY A;  1E1Z P;  3T01 A;  3UNY A;  3Q3Q A;  5LRN A;  3M7V A;  2W8D A;  1E2S P;  4KAV A;  3WAX A;  3IGY B;  1B8J A;  3MK0 A;  5IJS A;  3UN5 A;  1URA A;  1URB A;  5LQQ A;  3NKM A;  3T02 A;  3UN3 A;  1ZED A;  1P49 A;  4B56 A;  2D1G A;  5DLW A;  3ED4 A;  1Y6V A;  4MHX A;  1KHJ A;  3M8Y A;  1K7H A;  2GLQ A;  5DLT A;  5LRM A;  3M8Z A;  3BDH A;  4GTW A;  4ZGA A;  4NWX A;  4ZG6 A;  4QAX A;  5L0B A;  2W5S A;  3NKP A;  1ALI A;  4KAY A;  1KHL A;  4YR1 A;  1SHN A;  4LR7 A;  1AJB A;  3DPC A;  1EI6 A;  3NKN A;  1FSU A;  2GA3 A;  4LQY A;  1E33 P;  3WBH A;  1HJK A;  1HQA A;  1N2L A;  4CXU A;  3NKO A;  4LR8 A;  4LRB A;  4MIV A;  2GSO A;  4NWJ A;  4TN0 A;  1ELX A;  4FDI A;  5GOV A;  1EQJ A;  1ZEF A;  2GSN A;  1EW8 A;  1O98 A;  2X98 A;  1E3C P;  2IUC B;  3MK1 A;  5GRR A;  5EGE A;  4KJD A;  2W5X A;  4N7T A;  4GTY A;  3BDG A;  4FDJ A;  5KXA A;  5L0E A;  1AJA A;  1ED8 A;  1ANJ A;  3LXQ A;  4UPI A;  2VQR A;  4GTX A;  3IDD A;  3E2D A;  1ALJ A;  2W5V A;  1KHK A;  3WAV A;  1EW9 A;  4KM4 A;  1AJC A;  2W5R A;  1ALH A;  2GSU A;  1KHN A;  3DYC A;  2W8S A;  4CXS A;  2G9Y A;  4UOO A;  3M8W A;  5C66 A;  3BDG B;  3UO0 A;  5LIA A;  1ZEB A;  2ZKT A;  1KH5 A;  5DLV A;  1ELZ A;  3KD8 A;  1AUK A;  3NKQ A;  3MK2 A;  2IUC A;  2XR9 A;  4CYS A;  2QZU A;  4UPH A;  4CXK A;  1KH9 A;  3SZZ A;  1ELY A;  5K4P A;  4UPK A;  1N2K A;  2ANH A;  4LRD A;  3BDF A;  3OT9 A;  1EJJ A;  2XRG A;  4LRF A;  4LRA A;  1Y7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...