4M1TA

Crystal structure of small molecule vinylsulfonamide 14 covalently bound to k-ras g12c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
163
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 63
structure length 163
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1tA00
2F1IA 2A2ZA 3QIAA 3C15C 2I3BA 2HT1A 4EPYA 3QEJA 5KTYA 1U81A 4S35A 3I72A 1ANKA 2BJWA 1JPNA 2OLJA 4A36A 4EIWA 5FPYA 4CDGA 3QEOA 3ADKA 4JLAA 1EG7A 5B64A 2GESA 2V54A 3LXRA 2IYSA 5B30A 1DBSA 2NZ8A 5DN6D 3THXB 3EARA 4DDTA 4FWIB 3W6NA 4IEIA 4AWXA 3K1JA 1TL7C 5KSYA 1CIPA 3BFKA 1ZNZA 4M53A 2D06A 3GLHB 2YWHA 2QG6A 1AZTA 1XZQA 3PIRA 2YYZA 4V0OA 3R8FA 3EPLA 4FIDA 1AA9A 2GXAA 4BZQA 2WAXA 3QXSA 1DADA 1UBFA 1X8JA 3CWQA 5H68A 4IEEA 4AY2A 3ZYCA 3MWJA 3SOPA 3L8YA 5CYPA 3OHMA 4TLAA 1U90A 1R8QA 2VO1A 2P6NA 2AN9A 3CNOA 5G41A 3KQHA 4A82A 2XZPA 1E69A 3OEED 4TYWA 3ZZ0A 1F48A 5LB4A 1P9RA 1MO4A 2J1LA 4FD2A 2OM2A 4PSVA 2W6JA 4WVFA 2W00A 1E32A 3AM1A 2PEZA 3TQFA 1TU4A 1C4OA 4HAZA 2HUPA 2FZLA 5SZIA 3FWYA 5J4YA 1Z6TA 3BGWA 4QOSA 5EE0A 1N6IA 2YWGA 4O0MA 2CHGA 4C0LA 1KO7A 1XFAA 4B3FX 1ZP6A 2C9YA 2EYQA 1HE1C 4IFBA 2J0QA 2BJVA 3V00A 4C0AC 2G77B 1NP6A 1W0KD 5SZJA 1Q1QA 2QMUA 3OIVA 2ZE7A 1H8HD 1ZM7A 2P6UA 3CBQA 2ZRNA 4IHQA 3CX6A 1XRJA 4R2IA 2R2AA 5FL7A 4JLVA 4G0NA 4ZCLA 3A36A 4DLXA 2OAP1 5B58C 1E9FA 2HF8A 3FMFA 3GFPA 3OAAA 4B2LA 1N5LA 3LV8A 4KBGA 4RD3A 5UKDA 2YOGA 1MRNA 1Z2AA 2BEKA 4PXAA 2OXRA 1R0YA 4PZYA 1QBKC 5E7JA 4PFSA 2ZI4A 1OXTA 2QBYA 4LK2A 3D6TB 4M0LA 2WPDD 3NBFA 4S2EA 3KXIA 4QM7A 4DLTA 1W7AA 1W36C 1FW6A 3P27A 4RZXA 4M8NE 621PA 1ZU5A 4NYIQ 2MSDB 4JT2A 5EP3A 1W5SA 2D7DA 2MMGA 2A30A 1A2KC 3REGA 4NZYA 2WBLC 1A2BA 2YVUA 4BGDA 3OIYA 1MT0A 5EP4A 2G3YA 4KI0A 2WICA 4C7OB 1JALA 2V8OA 3TJZA 1TMKA 4JBXA 1IY2A 4PR0A 4JJZA 2MSCB 4A0FA 3MMPA 2E1RA 2VP9A 2I4IA 3KKOA 4QHYA 5FTNA 1AIPA 1QDEA 4Q4AB 1R5OA 3A1SA 1XTSA 3EIHA 4TSFA 3NIBA 4ESHA 1VKJA 3BWDD 1SULA 3GLFA 4YC7A 2OFXA 3B1XA 5TV2A 3UANA 3SQWA 4BECA 3FHOA 3RDPA 2JLXA 2QPOA 3KB1A 1ZVQA 4DCSA 5FTMA 1W4AA 4MH0R 4A6XA 4IW3B 3AVXA 4W5JA 2FEMA 1I4LD 3CH5A 3GLGB 3PQCA 3F0TA 4LJ4A 3AKEA 2HLDD 4AKGA 5AJXA 3EXAA 1ESMA 1XDBA 4A4DA 2XTZA 5FL7D 1M7BA 4C0HA 4EKDA 4V0KA 4YMVA 4EPVA 2FSIA 4BUJA 1XPOA 3RC8A 5E4FA 3KKQA 1QHYA 1X8KA 4AK9A 2GBLC 1LY1A 4P4SA 3IIKA 4ON9A 1SXJE 2H8KA 1QHXA 1FOEB 4B71A 3FGNA 2RB4A 4PQYA 2DYKA 4OQLA 2GCOA 3RANA 2W83A 1HTWA 2GCOB 1S1CA 4RVCA 1UJ2A 4Q9IA 1NIJA 1IBRA 1OIVA 2ZRDA 4GP7A 4IFEA 1Q12A 5CLLA 4I1SA 3NC0C 5K8IA 3EC2A 3OFND 1G6HA 1CF4A 2PCJA 1G3QA 4WW0A 1E2PA 3JVUA 2OFOA 5KDLA 2AD1A 2QT0A 4PPGA 2HEIA 1QZXA 4B34A 3E5HA 3Q5EA 4Z8XA 2ZTSA 1CXZA 4D0NA 4ZKEA 4MQBA 4GP6A 4ZCIA 1NVVQ 1M7GA 1NL3A 4TMWA 1KOFA 2G6BA 4MRNA 4A15A 1GRQA 4BFSA 1RJ9A 2EFGA 1G7SA 3HU2A 3W3AA 2GF9A 5CDFE 4PC1A 1XNJA 3VX4A 1BO6A 3K0CA 3MLEA 2P2LA 3BBPA 1I4DD 3JZMA 1UBEA 2JA1A 3IIJA 1OT3A 4JLOA 4RD1A 2H57A 1DTSA 2QTFA 3GQBA 4CEIA 2O8FA 4QBFA 2RHDA 1A4RA 1CTQA 1EFRD 4FMDB 3I61A 2G83A 3P26A 4B2PA 3PEUA 3I5XA 4B3GA 3MG9A 3B1VA 2DWQA 2CJWB 1AN0A 3W8RA 4LJ6A 1WF3A 4M9XA 5DHFA 2JLYA 4R7ZA 1MO3A 2D2EA 2KJQA 4Q7MB 2BBWA 3WP1B 3CPJB 3VKWA 1YZGA 2O0JA 4A0RA 1VIAA 3SYLA 3EIEA 4MKFA 5EZ6B 1WP9A 2P3SA 1ZW6A 4TMZA 4Q9KA 4HLQB 1NBMD 2IYVA 1MABA 1NRJB 2ZSAA 4GZMA 3NDPA 4NHOA 5J4LA 4JLPA 1UBGA 1E79A 4PANA 3HDTA 1XB2A 1DE0A 1AGRA 1U99A 4N1AA 2ZE8A 2ZRHA 3IGFA 1W48A 4JLBA 1W2HA 5J4VA 1FP6A 3IILA 2GAOA 1WCV1 4DLVA 5FOTA 1KSGA 1T91A 2QBYB 1QG2A 1KJWA 1GTVA 5EUMA 4GOKA 4OBEA 3MWLA 5JFGA 2IYWA 4L4UA 3LW7A 1L7VC 1IQPA 2IEZA 3TK1A 5BW8A 2OEPA 4WXPA 3SE0A 1DELA 4ITRC 3GMTA 4D4LA 5K8UA 4KVGA 4E22A 4QBHA 4MRVA 4PQRA 2C78A 1RKBA 2ZSDA 2QMEA 2BC9A 4D6PA 3IUYA 4XSHA 3AVUA 4QHSA 4CEHA 4BFWA 2PJZA 1BKDR 2RH5A 3BXZA 5CIWA 6Q21A 2XGJA 2JGNA 4BFXA 1L4YA 1YR9A 4IXNA 1XF9A 4TQ9A 1RRPA 1XMJA 2QA5A 3SFZA 2LCFA 3O8CA 3UWOA 4KLNA 4AD8A 4V0ME 1KI7A 4ZCMA 5CJPA 1TQ2A 3MJRA 5H1YA 4TQUS 1CJTC 3GJ7A 3G0HA 2QT1A 4LYJA 1FL9A 2JCSA 4YMUA 3V4FA 3EG5A 1UKVY 4GI7A 3FFAA 2IL1A 1UBCA 2KBFA 2QP4A 4IOLA 1AS0A 2F6RA 3NEYA 2JLSA 4PZZA 2IS1A 3A4MA 3OIUA 1G3RA 2VH5R 2G88A 3IO3A 4LHVA 2BMEA 3BIFA 4WAUA 3TW8B 1KHTA 5LB2A 1X8LA 5CITA 5CK5A 1OKKD 4LCBA 3TAUA 4YMTA 3EZFA 4IXMA 2NPFA 2NQ2C 3A1UA 3DM5A 5AUOB 5CYOA 5FUWA 2VP6A 1COWA 2QQEA 2O8DB 2OCAA 4TZ6A 4M21A 2XJ4A 3HR7A 3AP1A 4US1R 3X1WA 5KYKA 1OHHA 3RS3A 3HWSA 3GLFE 2F1RA 4TTQA 3VNUA 2QROA 2W6ID 1ZMXA 2JAQA 2J0UA 4PQFA 3I8XA 3HR8A 3LXXA 3LVRE 2GILA 4FCVA 3PFIA 3U4QB 2WAYA 1VG0B 4MUBA 2PZEA 2W6IA 4G5OA 4IDQA 1AQUA 2IYZA 1Q1BA 1XTIA 3K70B 3KDSE 5L3RA 2ZI6A 3RS7A 3M0EA 4DEXA 1FTNA 2GK7A 4TL7A 1XMVA 1U0JA 3H84A 4C7OA 2ZS8A 1OYWA 2ZUBA 1YE8A 3SHFA 1KDRA 1KZ7B 4G1UC 4C0QC 4EJSA 3ASZA 3KXLA 4DT1A 4NCIA 2QSZA 3U3RA 4F4IA 5FPSA 5HZHA 1OB5A 1ZJ6A 3Q9LA 3PUVA 3EZ9A 1K8RA 4JSYA 2NG1A 4PAOA 1TTTA 1G3IA 3AP3A 4B32A 2AL7A 3B60A 1VCOA 1XTKA 1KDPA 1W4RA 4Q48A 3WYFA 1N3BA 4DDWA 4TT3D 1F2UA 1ZINA 4US2R 3RHFA 3E70C 4B35A 1OFUX 5FUVA 2XSZD 5A5GA 1CLUA 5DH9A 1RYHA 4LBZA 5ANRB 5G53C 1D5CA 4XVRA 4XD7D 1NBME 4DUGA 5EUQB 1B0UA 4DZZA 4BE7B 4R71A 2D7CA 4LZZA 3K0SA 2GJ9A 3QG1A 5BN4A 1M74A 5E95A 4LX0A 4F92B 1AK2A 3B78A 4KO8A 3AF4A 2R6DA 3JVVA 4Q4JA 4Q4JB 3GJ0A 2VL7A 4X8OA 3ZGXA 3RSLA 3K9NA 3D7MA 3FDIA 1LVGA 5A4JA 2GTPA 2ZRBA 1YR8A 4QGGA 5HPYB 3B13B 1QHHB 5FI0B 3U61B 1KMHB 2DCUA 4NTZA 3OEEA 5FUXA 3FB4A 2OHFA 1S8FA 4ERNA 4ZI2A 5BXQC 1UPTA 4D80A 1O87A 1GVNB 4LHYA 1LF0A 4D82A 2GJKA 1M8PA 2ZE5A 2V55B 5BYJA 5C18A 3P1JA 3CM0A 3D3QA 1QVAA 1F2TA 1TNDA 2O52A 4MYCA 2QMOA 3QSYA 4Q02A 1KK0A 4B3CA 3T1TA 1PV4A 1YRAA 3NHBA 4CEJB 2ANBA 1HH4A 4QRHA 1M1YE 2VYFA 3K0AB 3IEUA 4JZKA 1II8B 3T1VA 2WJGA 2OCYC 3WRXC 5KDDA 3KQNA 4IKEA 1KJZA 2R62A 5FL3A 2OILA 1GRNA 2Z6VA 3TE6A 1K5DA 2FMXA 2WPDA 3L0IB 2CCGA 4URWR 5HE9A 3VX3A 5JS8A 1W49A 1OXSC 2C9CA 5HZKA 1E0AA 3M1IA 1IONA 1KO8A 1JI0A 4JSTA 3QVVA 4IJMA 4ILEA 1NF3A 2J5XA 5KO2A 2EVWX 5EE9A 1IHUA 3KX2A 3Q3JB 4PHFA 1AM4D 1E0JA 1KKMA 3QXXA 1O3YA 2CVFA 5DE3A 1OSNA 1Z29A 4AYXA 3GJXC 1G5PA 3EW9A 4N0DA 4Q4HB 1N0UA 3IBGA 5FBLB 3T35A 4A0GA 2QZ4A 2P5SA 2JLQA 5JZVA 3WP0A 3U2QA 1PVOA 4HLCA 5JEEA 3NKVA 3WNCA 2QL6A 3UMFA 3D31A 2WIAA 3THWB 3QF7A 4Q5IA 3RNLA 2IYUA 1OV4A 4QJ3A 2C8VA 2ZM5A 2OESA 4EQ6A 5C2JB 1ODFA 2NGRA 3TBKA 1DAFA 4HLDA 5FPTA 1KNQA 5LD2C 5DGXA 3DEFA 4FMCB 4M22A 1AS2A 3TUIC 1LW7A 1NY6A 1COWD 2RGEA 3TGPA 1M2OB 2XX3A 4D4JA 3AUXA 3EIQA 4RJLA 4V0NA 2P65A 4TTRA 3VR3A 1G17A 3P4XA 3BAFA 4B3BA 3GD7A 4DKXA 1T4GA 2FSHA 5B57C 5KUTA 4RD0A 4NYMR 4QNMA 1Y63A 1KK3A 1KIMA 1GZSA 2RGAA 3K9GA 3LBHA 1JR3A 1U0HC 3UKDA 2BVNA 3EPJA 1A82A 2CLDX 5DYGA 1G7CA 4F38A 4LJ9A 2CCJA 3A4NA 3TW4A 5L3QA 4KFRA 3R9WA 2H5EA 2GJAA 1WBDA 1E2GA 4AYWA 3GEEA 1ZIOA 5LPNA 4Q4AA 1GSIA 1G8FA 4DLSA 4M1WA 3QPUA 1CJMA 3UWKA 1S9DA 3CO5A 2H16A 2NTYC 3LX5A 4EFLA 4PAQA 2JLUA 2ZXUA 4RD6A 5EXSA 1RRCA 1B23P 2IYTA 1IM2A 4NKRA 3AH8A 2J7PA 1XEFA 1KNXA 1DAKA 2VP5A 1OFTA 2XNDA 3CWZA 3OAAD 5AJZA 4KJZA 5FTJA 4PC6A 3LWNA 1UM8A 3TVDA 2NIPA 3WYGA 2BMDA 4M9ZA 2J7PD 2XNDD 4DEYA 3MWKA 3M6AA 2AWOA 4NMMA 4C2TA 4JYBA 2QUZA 4DC9A 3VKHA 4BZXA 2B21A 1T0HB 1XD9A 4UXJA 2F3TA 5JCPA 3EPKA 1JAIA 2XAUA 1VG8A 4BEBA 5C1BA 1NLZA 1XP8A 2VIIA 3EZ6A 4L8GA 2FFAA 1ZM9A 2GAAA 4HUTA 1BH2A 1GOTA 4Q47A 1Z08A 3QBTA 4H1UA 2ZR7A 4P3YA 1QHIA 2CLSA 2QRZA 1II9A 2BCJQ 3GLIA 1NIPA 4Q1AA 2W0MA 2FJUA 1G19A 4KV9A 5AUQA 1NJFA 2O5VA 3FMOB 1D2EA 1ZUHA 2QRNA 2ZJAA 1OJLA 4UQOA 4PSKA 5JJIA 4V0LA 1KMHA 1OH7A 2IS6A 4TSFD 1SVLA 2ZROA 1ONBA 5DHAA 5JWOA 4KXFB 1R5NA 2ZJBA 4M1YA 4BZPA 4C0SA 3W6OA 3H4MA 4ASUA 4LSGA 3W34A 2WVJA 2ZYTX 4ESVA 3QKSB 5G3YA 3BORA 2YNMA 1CJKC 3QKSA 3NBXX 5CB8A 3L2OB 5EE5B 1E9AA 1DS6A 2ZYVX 2WJYA 1E1RA 2WKPA 4HB0A 2ZJ8A 5DI9A 4BLOA 4E07A 3G5UA 4ASUD 4JS0A 4QBIA 3W90A 4DIEA 5E7MA 5HCNA 2IYQA 2QPAA 2YC2C 4HAYA 1KSFX 3KJHA 4PAMA 1YKSA 421PA 1G4AE 4LGMA 3FOZA 2XB4A 3NDBB 4JVMA 1DPFA 4TT3A 2N42A 3SJZA 5HKKA 1DAGA 2C04A 1HV8A 4KLZA 4CVNA 2VEDA 2ZITA 1FMJA 5TXGA 3WXMA 1E2EA 2VP4A 1C9KA 4NYIR 1Q21A 2QM7A 3AKYA 1KK2A 1TQDA 2DBYA 1JEDA 5SZHB 2VPPA 4P4TA 4M1MA 3REFA 2O0KA 4IOMA 1MV5A 3QXHA 1XTQA 4P31A 1WB9A 1XWIA 2GXSA 2ZANA 1OXVA 1L2TA 1S2MA 2CL6X 2NOAA 3AF1A 3FVQA 2ZE6A 5K8LA 4IOJA 5DSZA 2ODWA 3GJ8A 2BM0A 3SC3A 4RFSB 4B73A 2A7QA 4RSGA 4U02A 5JSZB 3OEHD 1ZD9A 1TQ6A 2CJWA 4EPTA 3NBZC 2IT1A 3U5ZB 1EX7A 5IT5A 4C0KA 3ADDA 3BERA 4II7A 1EWRA 5FBWB 4IVPA 3Q8XB 2YINC 1T3SA 5JI3E 5DYIA 3SR0A 5D3QA 1ZM3A 2R6FA 4JKYA 2GA8A 2YJTD 5FBRB 5CM8B 2Z43A 3A1VA 5H70A 3L82B 2FFHA 3MSXA 3F3YA 2ODNA 1E9RA 2H18A 2VTKA 4L5BA 5GJWC 2BWJA 2RGNA 1G3MA 1C1YA 2ZRGA 1UEIA 4Q4LA 5C4GB 4DCNA 2QE7A 4RZ2A 1OKKA 4C4PA 5J47A 2ONKA 5H8WA 2OBNA 2XJ9A 1WMSA 4LI0A 3FHCB 1NKSA 3W3ZB 1LS1A 3U3JA 3VR2A 1N25A 5B2ZA 4DSNA 2AKYA 4LBVA 3AP2A 2J0UB 2BBOA 3FPAA 4KVAA 2NO1A 4XVQA 4GOXA 3K0CC 3S1AB 1NVVR 5FOUA 1AGPA 1RRFA 1N6KA 2EFDB 2X1VA 3X1YA 5KSOA 3BH7A 1R0WA 4HZUB 1OFIA 4QC2A 2AXPA 2CCKA 2Q9BA 4TMKA 2ZRJA 1G8GA 1E0SA 3CPHA 2FSGA 4D25A 3BB1A 3N5CA 2A3RA 4GZLA 3WRYC 2ATXA 1GIAA 2OCBA 4RKFA 3LDAA 2IYYA 5TDHA 4E09A 5HR5A 1XJCA 3IO5A 4A6PA 4RFVA 1KO1A 3C16C 2O8BB 2QQ0A 1AQYA 1NLFA 1R0ZA 1XX6A 4OQFA 3K0FB 3QKUA 1OIXA 1R2QA 5LD2B 1RE0A 1G291 1KI3A 4DLWA 1ZD1A 2WSMA 3I4LA 5FOVA 1SXJA 1GL6A 3E2IA 3ZD6A 4NPHA 3IHLA 2ZIAA 3A4LA 3HU3A 4G3XA 3KFXA 3QXJA 2K5UA 5AJWA 3QG5A 5FI1B 4BRUA 5JLJA 2J45A 2VSFA 4WIAA 4G5RA 2VSXA 2ZAMA 5DLQC 4EJSC 3OESA 1P72A 5AK0A 3UATA 2VBCA 3AF0A 1W1WA 2G1KA 5JRJA 2Y8EA 4D81A 2NZJA 2WOJA 1E2DA 3FKSD 1YZQA 2CDNA 2GXQA 4I4LA 4D2IA 3GLIB 4FWTA 2ZSFA 5HE8A 4HAVA 5IK2D 4JL6A 4DCUA 4HUQA 5BN5A 4PSAA 8OHMA 3A1TA 2JATA 2Q21A 4EPRA 4MDEA 1E2NA 1TEXA 1G5TA 2WWFA 1NSTA 3WMGA 1IN6A 3EAQA 4KCGA 2XOKA 4M9QA 4Z8YA 3BS4A 3B1ZA 4G5QA 1Z0DA 4X8MA 2ZJOA 3I1FA 4TMVA 1ZM2A 2YKGA 2WM9B 3KB2A 5F2EA 1KY3A 4HDCA 4UXIA 1JEEA 3AGPA 3CNNA 3L8ZA 1AJEA 1RW4A 4LV5B 2D3WA 1GP2A 2DFTA 3PG5A 5J40A 3B9QA 1PLJA 2ZI7A 4F93B 3RS5A 2ZSBA 2ZRIA 3CNLA 5EE3A 4Q66C 4ZDWA 4AKHA 3NWJA 3PUZA 1KY2A 5JBQA 1AS3A 2I1QA 1E0KA 1G21E 2AKAB 4A2WA 3CB4A 1ZYUA 3CRVA 3DHWC 3GJ6A 1ZUNB 4HB3A 4YMWA 4LUCA 4M1SA 3TAHA 2PT7A 4LHWA 4HAUA 5EP2A 1TX4B 3NG1A 3C5HA 1HT1E 2GCNA 1SQ5A 3ETLA 3LQQA 2N46A 3NC1C 2DFNA 4Q7LA 4P0TA 4TTPA 3TMKA 2FFQA 4ZDKA 1P7CA 1S3GA 4OKSA 4MDFA 1T3LA 2IWRA 3KZ1E 3MAAC 4O3MA 3ZLJA 3BOSA 5A0FA 4B47A 3QPWA 5GVSA 4M4SA 1YR7A 5IDVA 3VTKA 3HPQA 2CE2X 1ZNXA 2C95A 3Q85A 4BFVA 3UG7A 3U3OA 4GT1A 5KNCA 3T1QA 2ONJA 1ZU4A 5L3SB 2F1JA 4IDHA 2XEXA 1VDZA 1ZM4A 1F6BA 5FR1A 1T8TA 5SZKB 4HB2A 2W2VA 2YWFA 4FINA 1KZGB 1GKIA 1US8A 4JVSB 5EE1A 1G1MA 4OI0A 4UNPA 1LF5A 4MGZR 3BB4A 1GG2A 3QI2A 2D2FA 2QSYA 1W2GA 2UZIR 3JZAA 4HSEA 1TADA 4LPKA 2XZLA 1G6OA 3ZZUA 1DVRA 4C2UA 3UIEA 4D4MA 2ZRFA 2Z4SA 3R9IA 2YC4C 1QG4A 3QF4B 4GPTA 4RCYA 4BQSA 1A1VA 3AVQA 1KKLA 3QPVA 2AD5A 2GETA 1VG9B 4GDFA 2O8EB 4GNKA 3GPLA 3BC1A 2ZRMA 4DCTA 1IXSB 2ZRPA 2RCNA 2GZAA 4OHZA 3IBYA 3EPHA 2BEJA 5TVKA 3LLMA 2RHMA 1A7JA 2GDJA 2VRWA 5LDDC 1E96A 2QEQA 3LX8A 5GJBA 3U6KA 4MUAA 3A37A 2GEUA 2FNAA 2KBEA 3MJHA 2QAJA 1E1RD 4EFNA 1N6LA 1YZKA 2OSBA 3RAPR 4LBWA 4O2LA 1CS4C 2DFLA 3PEYA 3QXCA 4WA7A 4BLTA 2FE4A 1P3JA 1CRPA 2WHXA 4Q7JB 2D62A 2EW1A 2JEOA 4HDOB 3LY5A 1QVRA 2BKEA 3B9PA 4Z1MA 5CLQA 2E87A 4PO9A 2XTMA 1U94A 1KYIA 4LY6A 4MKGA 3PEWA 1NMXA 1T5IA 3DZDA 3PUWA 4PTLA 4Q19A 2ZI3A 1EFTA 2J87A 2WV9A 3GLGA 1EXMA 3IEVA 1PLLA 4YXWA 5L3VA 3U44A 5DI3A 4Q21A 4DCVA 3ICEA 3O8BA 3U44B 2V7QD 4M1KA 2GVZC 1RC8A 4Q9HA 2WWWA 4WBSA 3K0FA 2A5GA 5FTKA 4PO1A 2J59A 1E94E 3BK7A 5FBVB 2WWHA 4B33A 1YQTA 3NBYC 4OI1A 1FNMA 2RAPA 5KU1A 3EX7C 3LA6A 3AB3A 3WYAA 1Q22A 3R8CA 2WOOA 4NH0A 4P4UA 4F91B 2FA9A 2QY9A 3PVSA 1OPXA 3Q72A 4MA4A 2GCPA 2RGNC 4EPXA 1ZCBA 4WZBE 4B48A 1G9XA 4ZV4A 2RMKA 3LD9A 4D0LB 4URUR 2CHQA 1VCNA 5C4MA 4IDPA 3I5YA 1DO0A 4BLQA 1CEEA 1UKEA 3J81k 4PC3A 2OE2A 3U6BA 1S4QA 3SEAA 2C98A 2CLCX 2JIZD 2VP2A 2ZRAA 1DAMA 3I3SR 4MYTA 4KFUA 4DXAA 1RVDA 3FKQA 1KI1A 4AI6A 4QBGB 4D0GA 1Z63A 1ZNYA 3U7GA 1PLKA 2RGBA 1JB1A 1U2RA 3KKNA 1JBKA 2PLFA 2ZJZA 2ZVQX 4G5SA 4PZLA 2BMJA 3L0SA 3A1WA 1EFHA 1RYFA 2ZQ5A 1Q44A 2ZU0C 3I73A 1KI2A 4PC2A 1EGAA 4EPWA 2BOVA 1G18A 2BM1A 3NH9A 2ECKA 2OUKA 2Z5FA 2NO6A 3DMDA 2F43A 1SVSA 1GWNA 2GRJA 4LDJA 4DT1B 1HEIA 2IUTA 4E03A 1KI9A 1NVUQ 1P6XA 1RFLA 2CVHA 4KSCA 4G5GA 4LJ7A 2B8WA 4ZI3A 1E9EA 1VCMA 1P4SA 1XMSA 4TLCA 3KUCA 4C3ZA 2QP3A 1HT2E 2CNWA 1SXJC 2FPKA 4RD4A 3QJYA 2FF7A 3GCGA 4AYTA 4LHZA 1BS1A 1N6PA 1Q20A 3P32A 3KFVA 3P4YA 1MKYA 4OL0A 3TR5A 3ZVMA 221PA 1SVKA 2R6CA 1CBUA 1T8UA 2R9VA 3TSZA 4A8JC 2R6GA 1OB2A 1XCPA 2KB0A 2PH1A 1T5LA 4TLEA 4A2QA 4O2RA 4JYCA 2J0SA 3SU8A 1OXUA 4UNNA 5HTKA 1M7HA 1E4VA 1GFIA 4CYMA 4EUNA 4U00A 2ZI5A 1MRSA 5DO9A 4IRUB 4KAXA 4US0R 4DLZA 2GNOA 3AQ4A 3U3KA 1F5NA 4NU0A 3B7GA 2ZR9A 1XZPA 3FMIA 2G9NA 3RSOA 2IYRA 3ZVLA 1VIYA 2KE5A 2HV8A 2UZ3A 4FXPA 5E7IA 1VYTA 3Q5DA 1RIFA 2EWWA 3SNHA 3V4RA 3PITA 3C5CA 4PPQA 2IK8A 3CX7A 3FMPB 1E2JA 1HE8B 4N0EA 1P60A 1E2MA 2GHIA 1FTSA 4K8OA 4A92A 2CL0X 1PUJA 4LV6A 4FI3C 1ZUIA 3R7WB 1E1QA 2UVQA 2QM8A 4OJQA 1E79D 4TL9A 1G16A 4AIIA 4NYJQ 4OHXA 3ZS9A 1G7TA 4AC9A 5JEDA 5F3WB 1Y3AA 4UKDA 1IAQA 1ZBDA 4NE2A 5D3MB 2BHRA 2V1UA 2HLDA 1SVIA 4C0BA 1VTKA 3B82A 3ZIAA 4JJKA 2X2FA 4PPNA 2JASA 2O8CB 4W5HA 4BLSA 4AKIA 3TNFA 2V9PA 2HCBA 1CR2A 4KYIB 3Q7PA 3SZRA 4OQNA 3ICQB 1FX0A 1JAHA 1ZNWA 5FOWA 1ZC3A 2FN4A 5HCIA 1VYVA 1X1RA 1TPZA 3KXKA 2ZUCA 4K81B 2OBMA 1JR3D 1Z0KA 2QP9X 3B85A 1XJQA 3TSWA 3MFYA 5J5CA 1R8SA 2JJ2A 4H9GA 1BIFA 1D8TA 1N0WA 3WY9A 2DWPA 1T0JB 2ZJYA 4HI0E 2HCJB 1RZ3A 3LFUA 3LRPA 1DARA 4Q1DA 3I62A 1XBTA 2BBTA 1IN7A 3T5DA 1TF2A 2A5YB 2EFEB 1IXRC 5DN6A 4GRAA 3GEHA 4TL8A 3OFNA 2J9RA 1SVWA 4QM6A 4B44A 2GKSA 4Y0AA 1Q3TA 2J0VA 2ZYUX 4Q1BA 4TL6A 1W4CA 5CDFA 3FFBA 4AKEA 1KSHA 1E6CA 3AF3A 2ORIA 1SXJD 3K9HA 3BRWD 2XB2A 1YHNA 1CR1A 2H17A 3W9YA 2YHSA 4BLPA 4TYNA 1UEJA 3ZQ6A 4M2LA 2Q0HA 3SJBA 3PJRA 2WJVA 2ERYA 5L3QB 3B8HA 3L0OA 5TB5A 2P6RA 3GFTA 4Q00A 1R4AA 4HAXA 3DO6A 1E2LA 1ELOA 2FH5B 4RY2A 5GJVC 3B6EA 4XTRA 1LB1B 2GWHA 3AVPA 3DKVA 3BE4A 3LNCA 4M1TA 4QKQA 1JR3E 3EWSA 3VR6A 2YZ2A 3EA5A 4NBSA 3CONA 1AKYA 1P2SA 2FSFA 2WJIA 4UJ3A 3CZPA 1OIWA 1E9CA 1XTJA 3WNDA 5E3HA 1ETUA 4GBMA 1H8HA 2D74A 3KQLA 2HJGA 3LW8A 2WJJA 4Z1MD 2AXNA 2DPXA 4GOJA 2OXCA 3N70A 4W5WA 2ASEA 1IXZA 1NN0A 3QOFA 2WSSA 1Z0AA 1GUAA 2ZR0A 4IOKA 4QNRA 4HB4A 4GMXA 1W5TA 3HJNA 2IF0A 1Z0FA 4LRWA 3HYRA 5LBIA 1P73A 3QENA 3LQRA 4Q1FA 3ADCA 2F9MA 1GKUB 2CBZA 1OYYA 1W0JD 3B1YA 1VECA 4Q4HA 4EFMA 4CEHB 2GVDC 4MGIR 3QQ5A 1A5TA 2J3EA 2TMKA 4A9AA 2B7CA 2I1VB 1S9HA 3CRRA 2AK2A 4LHXA 3GP8A 5JJKA 1F2TB 2KWIA 1HQYE 4TLDA 2HF9A 2C99A 3OEHA 1E9BA 1LS6A 1W47A 2ORWA 2VHJA 4BWYA 2WMOB 2ZS9A 2HXYA 1QHNA 4Q01A 3IPXA 4XTCS 4Q7KA 2WKQA 2P0EA 4R2HA 1YU9A 3UMSA 4Z51A 4FW9A 5KPDA 1K5GA 4FN5A 4LYHA 2WMNB 1LNZA 4XWOA 3ECCA 4R9UC 1Z28A 4PX9A 1Z0JA 2NO0A 3VAAA 2OG2A 3WHLA 3SDZA 2Q9AA 2OFWA 1P5ZB 2EWVA 2FGJA 2GJ8A 2WWXA 1EWQA 3RS4A 2OV2A 2IX3A 5AR1A 4B76A 4JLMA 1UKYA 1Z6GA 4M1OA 1QHGA 1FZQA 3ZDQA 2DY1A 1N6OA 2HT6A 2PX0A 3ZJYA 4BLRA 4D4KA 2O8DA 1V43A 1GNPA 4NCKA 2A9KA 3RYTC 1NY5A 2AR7A 1P9NA 4DLRA 1U0LA 1D2MA 5EQTA 3O8DA 4A2PA 3OE7D 4N3NA 1GITA 3VR4A 4U7DA 5JSZA 3CR8A 3QY0A 1PUIA 2XITA 2ZREA 4XSGA 1XXHB 4B2IA 3H86A 2Q3FA 1JECA 3T5GA 1NBMA 1QHSA 4LOAA 2FPMA 1IN4A 1HURA 1E2HA 2JLZA 1N0VC 1CJUC 1T3HA 4HAWA 4A8JB 3QUSA 2RGXA 3VU9B 5JI2E 1E9SA 5G3ZA 1XEWX 3EWAA 3RVBA 1D6JA 1FUUA 1MABB 2JJ8A 1N5JA 2MMCA 3IIMA 4I1UA 3WBKA 3BFVA 1W44A 2OCPA 3KL4A 5JHHB 1XXHE 4B43A 3C7KA 3AKDA 2NPIA 4ZPXA 2F1HA 3K53A 2ZJ2A 1LFDB 1TQ4A 2XNSA 1P75A 1SVOA 3PR1A 2YV5A 3FE2A 3AGQA 4C9BA 4DB4A 2R6AA 2JJ1D 3A8TA 5FTLA 1JXMA 1G64A 4KBFA 4XIGS 1UDXA 3KQUA 1EK0A 4HDQB 2Q6TA 3K8YA 2ZUDA 1I2DA 2J7KA 3U7EB 3UXMA 2NMVA 4C0JA 3T1OA 1JJVA 1E1QD 3OIWA 2IS4A 4NDZA 2LKCA 1Q1ZA 2ZAOA 2FWRA 3MRSA 3CF2A 2A5FA 3LBNA 1ZIPA 4NYJR 3DPUA 4ARZB 1WBBA 4Q9LA 4FMDF 4HZIA 3ZIAD 5AUNB 3C14C 4CT4B 3MD0A 3TH5A 3SFVA 5KPJA 4BFUA 2ZSEA 1R10A 2ZVPX 1EFUA 1Z2CA 4TYPA 2VHUA 5EXTA 1KTVA 1XCGB 2QMHA 1GM5A 3UMRA 2WZQA 3BH6A 1Z6XA 1J2JA 4QHTA 3S1AA 3M4YA 4Z54A 3NHAA 1ESNA 1MH1A 1NG1A 1UADA 1FX0B 4CT5A 1CULC 2CK3A 4WXRA 2WIBA 4LJ8A 1NMYA 1DO2A 1E2IA 3D8BA 4DSTA 1R0XA 5JJLA 2R8RA 5AJVB 4ZKDA 4ACBA 1G8PA 3Q7QA 2PMDA 4WZAE 1TEVA 1Q1EA 3N2EA 4BASA 1ZC4A 3PUYA 4A0HA 2R44A 3THXA 1ZAKA 1S1MA 2OT3B 3QBVA 5M04A 3GLHA 1G4UR 2KSQA 1ZRHA 1KSJA 1DEKA 1M6NA 2QTVB 1UKZA 3EA0A 1NN5A 5EJEA 4QXAA 2HYIC 2BBSA 2FEOA 1NLYA 3BB3A 3X2SA 4B3DA 4GSYA 1JR6A 1F60A 4LJAA 3AV0B 4YXWD 1NSFA 4UJ5A 3WMEA 2JDIA 2YOHA 4DJTA 1KAOA 2W2XA 1KGDA 1G5RA 4NCJA 3WMFA 1VHTA 3C4JA 4MKIA 4X8LA 1H8EA 3SHWA 3O8RA 1KI6A 5F9FA 3MCAA 1NN3A 2L0XA 1J7KA 1OH8A 3AVVA 1G41A 4HATA 3SJCA 2WWIA 1FFHA 1Z3IX 2IBMA 1GNQA 1TF5A 4PC7A 3TUZC 4TYYA 3I32A 4V02A 1X86B 3IDQA 1U9IA 3DOFA 1DAHA 4G01B 5DISB 4URYR 3W8NA 4B74A 4EJSB 1G7RA 1ZD8A 4OHYA 2IEYA 1HUQA 2JIZA 2B92A 5JCZA 3TVTA 1KAGA 1SKYB 2JLWA 2BMFA 2C2HA 3AVOA 1J99A 2CEAA 4XOIA 3W5JA 2XSZA 1J90A 1KO5A 1N6NA 4X8HA 4NCHA 3PCRB 3AVWA 1NVWQ 2RGDA 4JLKA 4YDSA 1P9WA 2H92A 3DZ8A 4CRWB 2QGNA 1WE2A 1DAIA 4MYUA 4DWJA 3DM9B 1SHZA 3U7HB 1W0KA 3LO5A 4MRRA 5IF9A 4I1VA 2VF7A 3KTAA 1JJ7A 5EP1A 3GLGE 5EZ5A 2IS2A 1CR4A 1VYUA 2VSOA 5AWFC 2ERXA 1AZSC 2Z4RA 2XXAA 2OBLA 4QFMA 5L8VA 1SZPA 4KFSA 5C46F 1Z6YA 3PEVA 4XWKA 2W0SA 3B2EA 1BYIA 3CRQA 4F4JA 3GFOA 3QKRB 2AX4A 4MRPA 4KU4A 3LVQE 3CPEA 4QGFA 2HXSA 2ZRLA 3IHWA 3BJIC 4DRZA 2BV3A 3A6PC 2ZJ5A 4BFYA 4ABYA 2QAGA 3VR1A 1JQJC 3PV0A 3VNVA 3ZVRA 3NH6A 4KHZA 2ZEJA 3FHTA 2HDNB 1T9HA 1II0A 2B8TA 3HPRA 4PPFA 3QNUA 4CEJA 3CZQA 1WQ1R 2GJSA 1H8ED 1J8YF 2VQSA 1YJ5A 3CF0A 4GFDA 2X77A 4F4CA 1EESA 4QG7A 1DAEA 3PXGA 1II8A 1KDTA 2XTNA 4WZ6A 1U8ZA 3X1XA 1OH6A 1XEXA 1ZCAA 4D26A 1IN8A 2FDCA 3K09C 4ZIRA 1NI3A 1XD8A 2ZETA 4ZIRB 5TMPA 4TYQA 2CHVA 4L16A 1E4YA 2FU5C 1R5BA 1W46A 4PO8A 2IHYA 3SYKA 3WHKA 4JLJA 1OF1A 4PHTA 3U4QA 3O47A 5BYKA 3ND8A 2DHRA 4F7WA 3NVAA 2REOA 4QL3A 1V5WA 1R7RA 4LC0A 2F7SA 4ARZA 4KSBA 2C03A 1UF9A 2AFIE 2BDTA 2B6HA 2F9LA 2KI5A 4FCWA 5D3MA 2EFCB 5AUPB 2PJRA 1IY0A 2W2TA 5CM9C 1SKYE 3SBEA 5GJCA 2Z83A 4OYHA 3RRZA 2VHTA 5BN3A 1J8MF 4JLNA 4TQAA 4J0QA 4JIMA 1VHLA 3GJ3A 3RS0A 3W5IA 2Q9CA 4C30A 2CK3D 2NO9A 1TU3A 4TMTA 2LWIA 2PBRA 3BFXA 1X6VA 4OHWA 4XVUA 4JVLA 4B6FA 5KNDA 2DB3A 4OHVA 3OE7A 1U8YA 2CXXA 3CIOA 1UFQA 2QAGC 1Z06A 3K9LA 1F2UB 1GAJA 4BFZA 2F43B 4YLGA 3ZQJA 3THYB 4RZUA 4LYAA 3RABA 2J41A 4UNRA 3DDCA 3W6PA 2WKRA 2OO7A 2IXGA 4MITA 3UK6A 4XJXA 2D4HA 3ASYA 3EZ2A 4EAQA 1J70A 3FYHA 3LH5A 3QVUA 1GL7A 2CL7X 1GILA 1QRAA 2W6JD 3RC3A 1CU1A 1GDDA 3MGCA 2FGKA 4NL4H 3NXSA 2JJ2D 2P67A 2GZHA 4RCZA 3IPYA 4PHHA 4HUQB 4GMDA 5ELXA 3I92A 1Q3HA 2QPTA 3CRMA 3NEJA 2FV8A 2PX3A 3E1SA 3G82C 1NJGA 3PUXA 2PEYA 4LBYA 721PA 4LC1A 1P62B 3OF5A 5HKKD 4HLUA 4JL5A 2JDID 1XD2A 1W0JA 2G0TA 4LWZA 4IVRA 2ANCA 1Z83A 3AVTA 4JVNA 5F98A 3TRFA 1KI6B 1IOZA 1YZNA 4R98A 1BMFD 2CNWD 2V4ZA 3BH0A 3KKMA 3LAWA 3VFDA 4YQFA 5F9HA 2BKUA 2ODBA 2Q3HA 5BWMA 3KQKA 1JXOA 3ZVNA 2IUUA 1E3MA 1N2CE 2HYDA 1GL9B 2CMKA 4MRSA 3BD9A 1MO5A 3VQTA 2E9SA 2GZDA 3EASA 3RS2A 2C96A 4BPBA 4YMSA 3F5FA 3K70C 4FMCF 2R65A 3RWOA 2IW3A 5DIFA 4YONB 3CF6R 1WXQA 3PENA 4RD2A 3AVYA 1CKEA 4KITB 1D9XA 4HYYA 3MWYW 3U60B 1W36D 5BQ5A 1Z5ZA 2Z0MA 4ZDJA 3QKTA 2V6IA 2QI9C 1FUKA 4ZDIA 1U9IC 1BOFA 4ACAA 2A5JA 4URZR 3WNBA 4RFSA 3N2IA 2ORVA 1GNRA 3L43A 1NN1A 4URXR 1PZNA 3CRW1 3UG6A 3SJAA 3HYTA 1E9DA 3L0PA 2VHCA 4DSOA 1Q57A 1XXHA 2NO7A 1OE0A 3HP1A 3K0EA 4XH9B 1N5KA 4QJ4A 1G8HA 5FPHA 1XEWY 3EC1A 3QKRA 3CX8A 4Q1CA 521PA 5JRZA 1T6NA 1QHHA 4OI4A 3ADBA 4IVQA 3VU9A 4Q9JA 1XPRA 3P20A 1N5IA 2F3RA 2QAGB 1HA3A 5AJYA 1MOZA 1XCMA 1YZUA 2PZFA 3ZS8A 1CRQA 1XPUA 4TN1A 1IJFA 4FMBB 1YR6A 2PMKA 4NYMQ 4JT4A 5DI3B 4IDOA 4YDHB 3T34A 4RKEA 3VMFA 2JJ1A 4AG5A 4DSUA 4NCNA 2SHKA 2B7BA 4KFTA 1HQCA 1AKEA 3DMNA 5JWHA 1VCIA 3GLFB 5EXPA 4KYUA 2LKDA 5TY0A 4LV8B 1TAGA 5KSZA 3VHLB 1WDTA 1RRGA 2AFHE 3VKGA 3NTUA 3GEIA 2O8CA 4DLYA 1QF9A 2H7VA 3B1WA 2IYLD 4JLDA 1F3OA 4I1OA 3TSOA 3C8UA 5J4HA 1Z6AA 2O8EA 2PT5A 3U3MA 1D9ZA 3FTQA 3VR5A 3ND9A 4CGZA 2CE7A 5KHOC 3CW2A 3H1TA 3FKSA 4P4SB 1SKQA 2G0NA 2BIFA 1R6BX 2IYXA 1DOAA 2FOLA 4MKHA 4Q1EA 2PCLA 2GF0A 5DNYB 1H65A 1XU4A 2QE7D 2JLRA 1L8QA 2FZ4A 4NP6A 2QGZA 3OZXA 3THWA 4AURA 3RRNA 5K8TA 1US8B 4CZ2A 4O25A 4OQXA 1NMZA 4OI2A 4DDUA 4PHGA 2BCGY 1MO6A 2QENA 3AUYA 4AG6A 4LYFA 3LLUA 1FQKA 4A8JA 1SXJB 2F55A 2EQBA 3CH4B 3TR0A 5EXXA 3ZH9B 2IUSA 2ZYWX 1SVMA 2YOFA 5J4KA 4BEJA 3DOEA 2FG5A 1N6RA 4P33A 3SI7A 1JQLB 2FX3A 3KJIA 5FUYA 4CEIB 4I81A 2O8FB 1TUEA 2N1BA 3QF4A 3TIFA 1OHHD 2REXB 1JPJA 3F8TA 3K70D 1NNEA 2V3CC 4UXHA 1KI8A 1E2QA 3RWMB 2JLVA 1KO4A 4V0MA 3K09A 1RJ9B 4JKIA 4JBWA 2V7QA 2Q3MA 5G40A 2GXUA 4TWZA 2WTUA 3ZD7A 1K6MA 4GL2A 3SQXA 5KNBA 3GLHE 1E99A 3DVLA 1XMIA 3SBDA 2X2EA 2ATVA 3RRYA 5JWRA 4OJKA 2GK6A 1GRRA 1Z47A 1SHKA 4W9MC 2VLIA 1S96A 2EU8A 2A5DA 3IQWA 2H1LA 2V6JA 4DIDA 3MUFA 5IHPA 1OXXK 4TMXA 3UPUA 2EFHB 1VPLA 2VP0A 3CUEF 2ZU6A 1IN5A 3KUDA 4U5XA 5CIQA 1E2KA 1WA5A 2YWEA 3HU1A 4H1VA 4POAA 2WSSD 2OZEA 4QGAA 5CB6A 5FPKA 5KOYA 1Z8FA 2XZOA 3K0AA 1OH5A 4DDVA 4MGYR 2W58A 1M34E 1YZLA 3THOA 2ODEA 4JMPA 5FOXA 1FNNA 3AEZA 821PA 3QE0A 4CF7A 1BMFA 1KMQA 2FPLA 5JS7A 1DG3A 3U7FB 5CK4A 3H2YA 4URVR 5GADl 4B3XA 3EZ7A 2C77A 4LPSA 4QJ5A 3T12A 4BFTA 3R9XA 5IK2A 4L9SA 2ZRCA 2OAQ1 2REBA 1L4UA 1KJYA 1E98A 2PLRA 1FP7A 5FOSA 5JECA 3CR7A 2O0HA 1DG1G 4M9SA 1W36B 1FPMA 3I8SA 1E2FA 2IF2A 3C41J 1YVDA 2GEVA 3T06B 3THYA 3VHXA 1LTQA 3SS8A 5FBQB 2A78A 4HLUC 2UKDA 4WOPA 1UDWA 4CW7A 3V9PA 4LJYA 1OLOA 4B6EA 1G3UA 2IXEA 4W7SA 2C9OA 2WJHA 1FQJA 2MSEB 2QORA 121PA 3A58B 3KJEA 1YRBA 4K46A 3RRMA 2WWGA 2XXAB 3SYNA 1S0UA 3SN6A 1P2UA 4LJ5A 1X1SA 2P5TB 1TF7A 2PZGA 1D2NA 2RGGA 2ZI9A 1HY3A 1P61B 1CJVC 2QU8A 1I4TD 1JNYA 2ZS7A 4HEJA 2ZPTX 1EFCA 2DWOA 2VA8A 4MGKR 3TKLA 4E5UA 1Z07A 1WRBA 5CJ2A 5FFMA 2ZRKA 1LV7A 2VF8A 1YZTA 3X1DA 1XD2B 2AWNA 1XTRA 1CR0A 2RKOA 3KKPA 4EDHA 5JHGB 4FCTA 4OK3A 5L3SA 2EYUA 2V1XA 3B5JA 4UNSA 3DKPA 4DB2A 4V03A 3WBJA 3TUJC 5KSPA 1IY1A 1P2TA 3AKCA 4DHEA 1KDOA 3GLIE 1NKTA 1Q0UA 3T61A 3TQCA 4EQ6B 5JMTA 1XEXB 1OFHA 4JL8A 3IQXA 2IA5A 1GKYA 1KI4A 1P2VA 1I2MA 1TUIA 4NONA 1U8AA 4DLUA 1U98A 2X8AA 4L9WA 1SGWA 1W4BA 4Q18A 4RZ3A 1BYUA 4BRWA 1UAAA 1NVXQ 1X3SA 3DL0A 4ZO4A 1EX6A 4JBYA 1EFRA 2AK3A 2IXFA 4OK6A 2C5LA 4I99A 2HJVA 3ONWA 4MYHA 1Z22A 4DVGA 3ZZTA 5TARA 3GJ4A 3LBIA 2QNRA 4KODA 3RLFA 3KTAB 2J46A 2RGCA 3T15A 4L15A 3CKLA 1N6HA 3X1ZA 2X19A 2IHBA 1IJEA 3AF2A 2IWHA 3KJGA 4CIDA 1Z0IA 1VMAA 2G1JA 2IC5A 1PJRA 3IKJA 2DFKB 4XD7A 4DUGD 2QTHA 1S3SA 2FFBA 4HZUA 4QGHA 2GBLA 4TLBA 4OK5A 1XJ0A 4A1FA 4TZ0A 5KDOA 1CP2A 1MR3F 2AHOA 1G20E 4P32A 2VHQA 3TLXA 5IRCD 2WWYA 1HYQA 4XWAA 5GVRA 4IDNA 2PL3A 2XOKD 2O8BA 1KK1A 4B75A 4DBLC 4Q03A 5FH9A 5P21A 3R7WA 5FR2A 3GJ5A 4Y0VA 1VG1A 2DR3A 3H0KA 4OQMA 4UNQA 1G8YA 2OLKA 1RPZA 1FMLA 3CLVA 1OW3B 1NG9A 2GEDA 2QN6A 3R20A
chains in the Genus database with same CATH superfamily
1NYRA 1YB7A 2VQEB 5K01A 1A50B 2B4RO 1YCFA 4C14A 3QEJA 4NEHB 4D9CA 3OMWA 3QX8A 1U81A 3WLJA 4OX9B 2AZDA 2NU7A 3G8DA 3JZDA 4HQ6A 1JPNA 1OQAA 1J6UA 1XQYA 2IH2A 4NBLA 4EIWA 4DV4B 1X77A 2V03A 4KX3A 4CDGA 1JFRA 3DE2X 4EEXA 2O5EA 5JAHA 2V54A 5HFNA 5K2MA 3LXRA 5IX8A 1XZIA 1UR5A 4CUZA 4C6SA 1I5EA 1WS6A 5AVZA 5H3LA 2EP7A 3TZKA 1C3OA 1W34A 2VNHA 2VYVD 2NZ8A 3FSGD 1JG6A 5DN6D 4JHLA 4G4IA 3EARA 4KTTE 4MK4A 4MWEA 3W6NA 4IEIA 3OLYA 5DSXA 3K1JA 1A5BB 3NI2A 4ESEA 1NV8A 1CIPA 3BFKA 5KSYA 4C88A 4M53A 1I9CA 2Z9BA 1DC6A 2PS1A 5TMBA 2QG6A 5CLIA 4BWFB 2PZ8A 4AS1A 2VG8A 1B73A 1AA9A 4JODA 2WAXA 3TXYA 3UB3A 1X8JA 3ZE7A 3ADPA 3F74A 1V8FA 2EBWA 3KLMX 3LRTA 3NBQA 2VKTA 4X92A 3SOPA 1U90A 3NYQA 4JX8A 1K8ZB 4DIOA 2AN9A 3KQHA 1MT3A 3AQIA 3E3NA 1E69A 1ND5A 3OEED 4N12A 1K7CA 3UJ3X 2G80A 1P9RA 2A1TR 2Q50A 4N7MA 4UVIA 4BPRA 1QXSA 5HTOA 4WVFA 2W00A 4NZMA 3RC9A 2FX5A 5KJ6A 1O94C 1TCVA 3L46A 5CVCA 5A4AA 1YTUA 1QHFA 2AEJA 1WXEA 3CISA 3G59A 4MUNA 5EE0A 3RASA 2VJYA 4B3FX 5IM4A 1FRZA 2C9YA 2GBPA 2QUJA 1WW8A 2V5UA 2HCTA 4I4TF 4AJ2A 3KSRA 2PSFA 3V00A 1WJGA 3VZDA 4TV8A 3ZGNA 3RJTA 4XB1A 3TIGA 3OIVA 2ZE7A 1H8HD 1E59A 3AJRA 4RHFA 2GPSA 3BHIA 3K3PA 3KYCA 1O6FA 2ZRNA 4IHQA 1Z88A 2WTEA 1C1DA 4ZD6A 4R2IA 3DTVD 5FL7A 5JDCA 1PFUA 5ENZA 1Z2NX 3M3PA 4BKRA 1FP4A 2ON6A 4GKKB 3A36A 4DLXA 1WU7A 1XYYA 2OAP1 2HF8A 4CTOA 1W1IA 4X1IA 4A26A 4HWSA 4RQTA 1GARA 3AERA 3JU3A 4KW7A 4C1NA 4HT3B 3AYXB 1MRNA 2TMGA 2XH8A 4M9UA 2I7VA 2FRDA 2OXRA 1S2OA 4OXIA 4PZYA 5E7JA 1YC5A 4YP1A 4DCOA 3K30A 4F06A 2UV8A 5FEUA 2ZI4A 4F8EA 3QVTA 2Z58A 4M36A 3ESXA 4LK2A 4E2XA 1RMQA 3D6TB 5JO0A 1HL7A 4JGIA 4FJ0A 3FBWA 3E3OA 1RP7A 4R68A 3KXIA 1XZLA 4QM7A 1H9BA 3KZNA 1W7AA 2W2MA 1OYVA 1YIDA 4BCCA 1FW6A 3RF6A 4XPIA 621PA 3NEPX 1ZU5A 2VZ8A 4IMRA 3WK9A 1TUGA 4NYIQ 4D6XA 1FDRA 3F4BA 3MCZA 4JJAA 3EOBI 4MV8A 1N2CB 5CDGA 3IH5A 1U0RA 2GASA 2MMGA 3KT6A 4GIBA 1YC2A 2AN4A 4NZYA 2YVUA 3KTFA 5J2UF 5ED4A 5SV2A 1D2HA 1JQEA 1IZYA 2VDPB 2YASA 2BKAA 3DT8A 4MS3A 1GYRA 2H2FA 2V8OA 5DCUA 4C7OB 4FP9A 5D1NA 4JJZA 2RBGA 3BZUA 2FEPA 4A0FA 2D0PB 1XG5A 2PM8A 1ZL2A 5EHIA 1AXGA 5FTNA 3MS4A 1QDEA 4CG1A 4P7BA 3HVIA 3EIHA 4Q9AA 1HYBA 4TSFA 2GD1O 3NIBA 1Z2DA 4DEVA 1XRLA 3DOOA 3ES9A 4QBKA 3GLFA 4DSAA 3G2OA 4MUJA 1EQUA 3UANA 1T1IA 3B3JA 1MIOA 4LE0A 3SQWA 3KZKA 1LBHA 2JK1A 4ROSA 5K3FB 2FPPA 2C61A 4MPRA 2QPOA 5KX5F 2JLXA 5FCDA 1D0IA 4BAZA 5FTMA 1W4AA 1K08A 2CV1A 4EO4A 4LVCA 3W2TA 4W5JA 3KKKA 1EXDA 4QYMA 1GYPA 4FWBA 3F0TA 3KUUA 2MSWA 2ZXEA 2HLDD 2WZBA 4JENA 2VT7A 4S1PA 4YJ3F 5CH5A 2BSXA 3DFKA 1QGZA 1WHTB 1XRMA 2B5WA 3LTEA 4YMVA 5BN1A 3STYA 2ZBEA 3E15A 3ZWAA 4BUJA 3RC8A 3KKQA 3QLJA 4WOJA 2EF1A 2HA7A 1VRCA 4PZUA 1LY1A 1QC5B 3IIKA 1WV0A 4ALIA 1XCOA 2A67A 1NPYA 4MO2A 2DYKA 3NWBA 1NBOA 1RADA 2I2AA 2XUDA 3FUCA 1PL6A 4V1CB 2YBEA 3ITDA 4NDNE 3RU3A 4LDQA 4RVCA 4Q9IA 2HU8A 3EXFA 1IBRA 4M8IA 5HF6A 2E4VA 2JH3A 5ALUA 1MA3A 3T5PA 5IT9A 5CLLA 4E88A 4I1SA 4LXHA 4E5VA 1A4UA 1GGFA 4ZCRA 3E7FA 3ABZA 4RA6A 2NLOA 3GT0A 3P9NA 2BONA 5F5XA 3A2KA 1GXSB 2IUYA 1M6EX 2NTJA 2RAVA 2Q3JA 5KQRA 2VA9A 1AKWA 3K96A 3KBOA 4UASA 3VU0A 4EG7A 3ZXXA 2AD1A 1W87A 1K4YA 2FUCA 4IMIB 4L57A 1K5PA 4PPGA 5TE9A 4AG3A 2JAHA 3K1YA 1TU0A 1PFWA 1QZXA 2QV7A 2HBRA 4H7PA 4RYDA 5DM2A 5GWXA 1OAKA 3U39A 3BWEA 4HGNA 1J39A 1V8ZA 5AQ1A 4DR7B 1KMMA 4JLWA 3W9UA 4ZCIA 3QMVA 2LIVA 3UGTA 4ARCA 4R41A 2X9LA 3NBAA 1QH1B 1L5VA 2MJLA 4LDAA 4RVDA 2XT9A 2YV2A 3KXPA 4BNNA 2H7YA 1EBUA 1Q2XA 4MYDA 4WEQA 4L8LA 3W3AA 4M8LA 1P0PA 5DHRA 1EE1A 5FHQA 4D8YA 4DS3A 1JQBA 1PP4A 1XNJA 4YV2A 1BO6A 3K0CA 5CDFE 3KOYA 1Q7BA 4RY0A 1I4DD 3T7IA 3R5XA 4DNOA 4YQYA 1UBEA 5U9CA 4DA0A 2JRCA 2H57A 2I76A 2QTFA 4D99A 4QBFA 2RHDA 2REQA 4M3NA 3BK1A 4RVOA 5JD6A 2VQFB 3CUUA 2G06A 2OY0A 3CF4G 2GX6A 3H5TA 4PAGA 4B2PA 3GF4A 3PEUA 3I5XA 3NGLA 4EF4A 3RQIA 3B1VA 2EIHA 3VVMA 2P6MA 1ORDA 1SBCA 1XROA 2CJWB 1IZZA 3L04A 4IILA 4LJ6A 4M54A 1YQQA 2CUTA 1O89A 4QRIA 2DUWA 1DX4A 4ZFNA 1L7DA 3PXAA 4ZO7A 3PA6A 1PL7A 1N3YA 1E58A 3CZAA 3P0HA 2KJQA 4N8DA 3RRJA 1B43A 3VOAA 3WP1B 5F23A 4OO3A 4RGYA 1X87A 3BEOA 4F60A 3EIEA 3NCHA 5MN6A 4NAUA 5JXGA 1ZW6A 2F8SA 5FWYA 4FIZA 4FGLA 4HLQB 1MABA 2H65A 4GZMA 4RMIA 3UBTA 4QFCA 1MB3A 3SSAA 4K9KA 4DAEA 3C6KA 1WSWA 1ZK4A 4JLPA 4AQYB 4YASA 5EVJA 1P19A 1XB2A 2GN2A 4MI9A 1NC3A 3RC2A 1GZ3A 2XXJA 4O6VA 4YQEA 2X41A 5J58A 5JD5A 4KZPA 2RARA 1JFFB 2L18A 2AS0A 2YZKA 3OECA 4N1AA 1ILEA 1W48A 2Q41A 3DTVA 4UFOA 3VZQA 1KEEA 1XK6A 1M2EA 3FYDA 3LWZA 4IRMA 2GAOA 1WCV1 3HB5X 3VR5H 5B4UA 2RI6A 2ZJ4A 2PX4A 1QQ6A 2QQ5A 2YJNA 2AYYA 2PKQO 5I7UA 1JQ5A 1GTVA 4GOKA 4OBEA 4OFBA 4QTZA 4RGQA 3WK6A 2P6OA 3UK2A 3F9IA 3JVDA 3GZTB 3C70A 4F96A 3EZYA 4PYQA 3SE0A 1ZX1A 3MJFA 2Z3WA 3UWPA 3GMTA 4RXTA 4TGLA 4D4LA 1INLA 2W2LA 1KXZA 4KVGA 3KPUA 4QBHA 3RD5A 3M1AA 4PQRA 5LQAA 5DCYA 1NNSA 2FK8A 3PPIA 4Z7QB 3ZHOA 3OY7A 4LHSA 1FRNA 1KYZA 3AVUA 4QHSA 3FNFA 3E27A 4H7FA 4NR0A 1M67A 2R6JA 3K73O 3HVUA 4GPAA 4REQB 3Q7SA 2PRYA 3DF7A 5JAMA 1YR9A 3EHDA 3A7DA 1EEHA 1V7ZA 2MINA 4XJTA 3RODA 1RRPA 2BF7A 4BVHA 1YRQA 1JE0A 5D85A 4V0ME 4AD8A 4KWTA 1KI7A 2B8NA 1GNSA 2QTNA 4L3WA 4DMRA 5H1YA 1RWNA 4PIMA 4TQUS 1IWPB 1CJTC 3CX4A 2VDNB 4NATA 2VUSA 4J3NA 4YCSA 4LYJA 2JCSA 1BG6A 4DOMA 2GCIA 3FFAA 4GUAA 2UU9B 3HFJA 3WDSA 2IL1A 2V0GA 1AF4A 3F1LA 5DBFA 1VE6A 2H2AA 4K2AA 2HSGA 2JLSA 3U81A 1JIVA 1VZ2A 4H3VA 1CE8A 4ND8A 2IS1A 4RSMA 5ALNA 1OUMA 2BMEA 4LHVA 1SFRA 4EJ6A 1C1DB 1KHTA 2B7LA 3EMBA 4O4HA 1QG6A 1X8LA 3W77A 1ZISA 5KYXB 3IP7A 5CK5A 5LXTB 4WFQA 1OKKD 2PO5A 4GX0A 1FDTA 3HKBA 4YMTA 3EZFA 5H59A 4BB0A 3HHEA 1JLKA 2DFVA 5CYOA 1P0FA 1GRVA 1COWA 1LZKA 4CN9A 1P6QA 3S5JA 2OCAA 4B6PA 1G0NA 1F20A 4TZ6A 2XJ4A 4US1R 3AP1A 1YK1A 1OHHA 3IQZA 4X1IB 3TTVA 1LBIA 2FAXA 3RS3A 3SZUA 2H1VA 5J2UA 3CC8A 3S2GA 4AZ0A 1BXGA 3O7MA 4TTQA 5AI4A 2QROA 2W6ID 3PQ3A 4M1ZA 2F8TA 2JAQA 1VYHA 5CDYA 4WK4B 4PQFA 4DC0A 3I8XA 2I9KA 3DW1X 1A5ZA 5FPPA 1N8SA 2X0IA 2Z08A 1WXDA 3TRIA 2WAYA 4IS3A 4MUBA 2HLPA 4P2BA 3ZKWA 2RE8A 3OM1A 2AZTA 2GK4A 2IFTA 2AVDA 3KDSE 5L3RA 5DWDA 3LCVB 3M0EA 1P74A 4BZWA 1FTNA 1VI6A 3PQ6A 2Q5LA 4HG2A 3H84A 1XQVA 1C7IA 3VZCA 5A03A 4C7OA 3E7PA 3H2ZA 3U80A 1KZ7B 3Q0IA 1JHPA 4G1UC 5NLLA 4EJSA 2BH2A 3ODGA 2X40A 1KVQA 3MD9A 3RVMA 3ZXSA 3T5TA 5FLYA 1R8XA 4F4IA 5HIAA 2FW7A 3HKCB 4MCHA 1ZJ6A 3OOEA 2NG1A 1I01A 3OE1A 4JBGA 4F85A 2R751 3HTXA 4CODB 3DB1A 1G3IA 4GICA 4B32A 2AL7A 1TMYA 3B60A 3P0JA 3RBZA 1BS2A 1KDPA 1XTKA 1JIKA 1N3BA 4N3GA 1NDHA 4L50A 1SZDA 3L5OA 3OM0A 4DDWA 1TVCA 2QV0A 2Z1DA 3RHFA 5F7OA 1FU8A 5E7QA 4B35A 5BXQC 2Y93A 4UMVA 1ECLA 1R37A 4XWGA 3VPCA 1LI7A 4PY2A 3H1GA 5G53C 3IC5A 4XD7D 2WUWE 4DUGA 5BWCA 1B0UA 5AK6A 4YR9A 3HJFA 2D7CA 4TYMA 3K0SA 4DYVA 2GJ9A 3QG1A 2QZJA 4JFRA 3W3AD 3JPYA 4MWZA 1M74A 2C4NA 3LPLA 4L6AA 4LX0A 4U1RA 4KO8A 1MOSA 5I7OA 1SUSA 3S40A 3WWCA 1L4EA 4ZREA 4PG7A 4Q3EA 4M9CA 4COKA 1FE8A 5KTNA 4D3XA 1LVGA 3B89A 5A4JA 1JEJA 5B55A 3RROA 4AWAA 1PEDA 2PUBA 3G89A 4MLCA 4WJZA 3VYWA 1WQ4A 3U7QA 2CD9A 4MLPA 2GTIA 2ALJA 3BJRA 3HM2A 4MRMA 3VNSA 1XK7A 1T6YA 2FMIA 5E0KB 4LHYA 4D82A 1CRZA 4K1XA 5CM2Z 1ULZA 2F3PA 2GJKA 3WZMA 2V55B 5IDWA 3JRNA 3CM0A 1BWRA 1Y7TA 2VJAA 3D3QA 2A9QA 2PK3A 3HNPA 4ZHSA 5ICEA 4MYCA 1FP4B 1UZMA 2WAAA 2XDQA 1KK0A 1SQ6A 4CEJB 1XZCA 4UVDA 2Z8YM 5YASA 3OETA 2GMWA 3K7EA 4TVBA 1I9GA 4OHOA 5G0VA 3SLRA 3TBHA 2RC5A 2ZWAA 3PC3A 4JOQA 3V46A 2JVKA 2VUHB 5BXYA 2VAXA 1D4ZA 2YVQA 3QGMA 1C29B 1DDOA 1X19A 2OCYC 1IYZA 1RXEA 3OHPA 4RBNA 2E4AA 7AT1A 3USCS 4UEJA 1GRNA 1XNGA 5IJAA 2AI1A 3AU8A 2WU0A 3VX3A 4URWR 2RI1A 4QOIA 4U7WA 5JS8A 1E0AA 2C9CA 1UP4A 2PMBA 1UFOA 1Z17A 3IT1A 1SBNE 3GPCA 4KQ2A 1NSYA 4ILEA 5AW3A 4YY3B 1RFGE 1NF3A 2EVWX 3INGA 1G8KA 4DWOA 4P93A 2HHJA 4K26A 4RPLA 2JK0A 4PHFA 4R8RA 5DK4A 2HMUA 2W4QA 3KK0A 3O8QA 3M6XA 2HH9A 4ZV7A 2I4OA 1GNVA 3VHXB 1MENA 4I36A 1FLNA 1VQ1A 3HXTA 2WTAA 3W2IA 4BNVA 4QEZA 2QS9A 5A5EA 3T35A 3REQB 2QZ4A 4A0QA 2JLQA 4PCLA 3URMA 4A0GA 4QQFA 3QHQA 3GRYA 4XCXA 3LUKA 2VLBA 5JEEA 3WNCA 4AZVA 4L9RA 3UMFA 3PWKA 1QAOA 4DY6A 1PDWA 3D31A 2ZZMA 4NMHA 4Q5IA 2IYUA 2XUKA 1OV4A 3X43A 3IP3A 1LU9A 4V0QA 4QJ3A 3H9UA 1I30A 4D9HA 1PWEA 2X13A 2OESA 3HZRA 3N1UA 4EG0A 5C2JB 1ODFA 1A7AA 2NGRA 1F2DA 4HLDA 2OGTA 4MQLA 3TBKA 4G41A 4QUJA 5JISA 3DEFA 1KPGA 1N34B 1QTIA 2IE0A 2OGSA 4PZAA 2HHHB 4ADSG 1GQYA 3FBTA 5GTDA 4J1TA 1NY6A 5EYPA 4M76B 2EEPA 3TUIC 4MXDA 3ZYZA 3KYJB 3TGPA 1MEEA 2ACEA 2X9GA 3AUXA 4V0NA 4EI8A 3MRVA 4M0FA 2H5JA 4DKXA 1T4GA 5KC9A 3AILA 3GA7A 3OJ0A 2AMVA 2P2NA 3PXCX 4FE3A 4GR5A 4IS2A 4RD0A 4MPJA 5A4MS 3UM9A 4DQUA 4Z4HA 3PGJA 4IUYA 2CGEA 3EMDA 3LGAA 5KWEA 1JR3A 1QRDA 4OGKA 4OQ4A 3NATA 4F6CA 2BVNA 3IUPA 3T1YB 1A82A 3RRXA 2XF2A 5DT2A 1WPRA 4TWJA 3WGIA 2VUIB 2WT8A 1CVRA 1YZFA 2CCJA 2P9QA 3A4NA 4JUDX 4Y6OA 1WP4A 4JX9A 4L51A 1AKNA 2NACA 4HK4A 3RVOA 1BJTA 1RAIA 2RAUA 1EFPB 1GY8A 2DBZA 2GJAA 4MAMA 2WIDA 3RC7A 2J9ZB 3COSA 4AYWA 4EKGA 5J3JA 1CUJA 1B0ZA 1FFAA 4I6EA 5C8ZA 1NPTO 1Z8NA 3OP4A 1IWBB 4M1WA 2DP4E 4MVCA 2RB5A 4G9BA 1CJMA 2FE1A 3JQ8B 5A3SA 4FEEA 4KO3S 1HFEL 2G1AA 1M10A 4OH7A 4ZARA 4NHEA 3TLBA 5IT0A 5DNVA 1VRVA 1OLUB 1L7XA 1ULSA 2H16A 2J0EA 2LW7A 3LX5A 4ZVNA 3T4XA 1MX5A 4BNDB 4WV3A 1NNLA 3OLZA 4FXOA 5E9QA 5BNFA 4YRBA 1KKUA 3PZBA 4FMPA 4TXHA 4MQ5A 5EXSA 4MUYA 3FPKA 1X39A 3IOMA 3CWZA 3Q7IA 3Q11A 2VP5A 2G7MC 4D80A 1CUBA 5FTJA 4KBYA 3U1BA 1Z0UA 1V26A 4YRPA 4K86A 1BVRA 3WYGA 2BMDA 2PAFA 5KCMA 2VNIA 2XNDD 2C2GA 3FNHA 5JTUA 4GSKA 2DUNA 4I55A 2YCBA 4NMMA 3ZDEA 2FMUA 2QUZA 4FQ7A 4K6FA 1JIQA 5AMXA 4BZXA 3VKHA 3FWZA 1GLVA 3CT4A 4XGRA 4QQKA 1T0HB 2WV7A 2C5SA 4BJ1A 2L69A 4OL9A 2L2QA 3NHMA 1HDIA 2D4AA 3EBLA 3PJFA 4UXJA 4V3BA 5FO1A 4BGEA 1KAQA 1Z4NA 1LC0A 2C3OA 5CNKA 2PNJA 4JC0A 1VZ3A 4RVUA 4MW0A 5JDCC 3WYNA 3U9TA 2A35A 1OASA 3FY4A 1Y6QA 3GGDA 1NLZA 3QU2A 4HFMA 1T0PA 1XP8A 4R9RA 1PFQA 1RM0A 5HEKA 1QQBA 4YCMA 1TMGE 1GPJA 2FFAA 1NLMA 1ZM9A 3ASVA 4CL0A 4FYWA 1BH2A 1QQTA 2JIMA 5AVTA 3S2SA 2Q0SA 2W6QA 2CLSA 3OSZA 2O0MA 5B12A 2BCJQ 3ROZA 3L8EA 3SZGA 3ULKA 5F78A 1NXWA 3G49A 3JQBC 5H0IA 5C7OO 1NJFA 2O5VA 1KFKB 1M6VB 1PVVA 3JASB 2R00C 1D2EA 1ZUHA 3HQ4O 1O9BA 4FN4A 5EHQA 1C1XA 1TM5E 2IE8A 1BW9B 2HPAA 3T3DA 3IXMA 2VDUE 2GBGA 4V0LA 3KSAC 2CFRA 3WB2A 3ZLVA 2Y92A 2IS6A 2JB9A 3ETJA 1ISMA 1SVLA 1ONBA 3CLSC 1I4EB 4GM0A 1OX5A 2VAWA 3H11B 3RUEA 3JVIA 2C0CA 2QXUA 1DCFA 4LSGA 3W34A 2ZYTX 3W6OA 2G4LA 3QKSB 1BMDA 1TQHA 3TDMA 1E4EB 1W8IA 2VXOA 4XR4A 4LOLA 1MOPA 1PR2A 2JFBA 3D6AA 4CDNA 5EE5B 3DBRA 5KMGB 4TV9F 1DS6A 4M6WA 3ZI4A 3R6TA 3AEYA 3VSEA 4ZGGA 4B6JA 2WJYA 1E1RA 1K4MA 5KNBD 4QG3A 4HB0A 5DI9A 1CUDA 2HJRA 2XUQA 2A9OA 2I2CA 2JFGA 3G5UA 4ASUD 2F4NA 4XFDA 1OILA 1RACA 3P9YA 2XRMA 1JSZA 3C3XA 2BFFB 2X0JA 1Q91A 4W6ZA 1FP2A 2FN8A 3OX1A 4HAYA 4Q15A 1JKXA 4J0CA 1T3TA 1SCUB 3Q87B 4NDAA 16PKA 1U3DA 4O29A 4OJYA 3RYHA 4YAKA 2PY6A 3RK0A 3UQZA 1AHPA 1U2GA 4D9KA 1RNLA 5EKSA 4CF5A 4TT3A 3SJZA 3FGZA 1OGIA 2B20A 3ZJ4A 1DAGA 5C8XA 1QZ3A 2ZITA 4G36A 1FMJA 2FWJA 1E2EA 4V39A 3V3KA 4YFYA 1BNCA 3FNGA 1DXHA 3E3MA 2DBYA 5B1YA 4P4TA 1J5XA 1BQEA 3DKKA 3IDAA 2O2EA 4RU1A 3T3GA 4P31A 2ZANA 3AC0A 4UM7A 3UJ8A 1S2GA 3T1NA 2ZE6A 4AMUA 4IOJA 4WNCA 4RJKA 5TMDA 5LOVF 5B3AA 3TLZA 1PTJC 1RAEA 1U1DA 4B73A 2OB1A 4ZHQB 3IOEA 1YI0A 3WTBA 2FSPA 3GIDA 1FDWA 3IV6A 4J7XA 4QLOA 4RSGA 4YGYA 5JNSA 5JW6A 2E0IA 1SHTX 1TQ6A 3I0NA 1USIA 2BTEA 5AXCA 2V97A 1E20A 1MTOA 2Q2OA 4CLRB 4XWWA 2IGTA 2YWDA 4YP7A 3IUSA 5EJMA 1DX9A 3MIZA 3O26A 4LC9A 1SOAA 3RFTA 4ENUA 1T3SA 4H7JA 1YB2A 1ZXBA 3WYBA 3IP5A 3SR0A 3LA8A 1MB2A 5DNDA 4QTYA 3TNDA 4MHSA 2JFPA 1ZM3A 3ANMA 5K3FA 3RUFA 4W82A 4H4EA 3LIPA 1ZUD1 1GZVA 2V5VA 2Q5HA 1NUTA 5LIRA 1E9RA 1VE7A 1JUDA 1U2QA 3PC4A 4N5LA 4DXHA 1T34A 4L5BA 1GJRA 2HB6A 3VSCA 1G8JA 3HI4A 5GJWC 2BWJA 1LQ2A 1G3MA 4BVEA 4YUWA 2H3EA 2ZRGA 1USKA 1C7FA 5C4GB 2J9YB 2AE1A 2QE7A 1O57A 1L5QA 2X4IA 1MX1A 1OKKA 3LL4A 5J47A 3QTTA 5H8WA 4X20B 2DQYA 1ULHA 4RHUA 3LL7A 2NAFA 2V7PA 3ZNQA 1EXVA 4JJ4A 2R96A 4C4TA 2MYPA 4P2GA 4IIGA 3KE9A 5AKLA 1T5OA 4C87A 1FSPA 5LUBA 3EQ8A 3FPAA 3ONNA 4KVAA 3B70A 2R8YA 2EZ4A 3VOSA 1XVUA 5MHTA 3AI3A 3I6ZA 3I8OA 5F77A 3S1AB 3K0CC 1EHYA 3NV9A 3O3MB 3CRZA 1A7UA 5AVQA 2XYVA 1HZZC 1I1NA 2FP4B 4Q34A 4X7RA 4CTJA 1QR2A 4CV2A 3KJXA 4TX1A 5AT1A 3S1SA 4GPBA 2CCKA 3PHCA 4MUEA 3RIGA 1MC8A 3LNTA 4TKVA 1G8GA 3G6WA 3H8VA 5EKTA 2Q3LA 4YYZA 2AA3A 1U0FA 3MTIA 1SB9A 3R6GA 4WLNA 4H35A 2C5EA 4YTEA 2ATXA 3WRYC 2OCBA 3X1MA 1EVKA 3U4MA 4RKFA 5DXAA 3LDAA 5ALQA 1KIAA 1FY2A 4BBJA 3NDRA 4E09A 2WU4A 5GINE 1SXPA 1CZNA 1KO1A 1DBRA 1Z7GA 3U16A 4Y6QA 3PNBA 4HNHA 1LNQA 2JFQA 4JI3B 4K9OA 1NRIA 1OIXA 1R2QA 1LJLA 1MAHA 1T43A 3DMPA 4RQUA 4ESOA 3BGIA 5LD2B 3OWOA 1G5HA 4FC7A 2CXUA 4OREX 2BMWA 1ZD1A 2OL4A 3OQHA 3NEAA 3OPMA 5HFAA 3JYNA 3S5UA 1N77A 4B6QA 3RGWS 1V37A 1XN4A 3OPYA 4MB6A 3HBLA 4CKBA 3ZD6A 3IHLA 2RHRA 3A4LA 3WLNA 1I3MA 3DZFA 2K5UA 1KHHA 3QG5A 2OMEA 2NNLD 3A3PA 2VSFA 9MHTA 4N0PA 2XBLA 3B3QA 5DLQC 3DFIA 1V9LA 1JG2A 1P72A 3WLMA 5KYUA 2IUFA 4UPVA 4ND2A 1O9GA 3EXHC 3F96A 3INNA 4KR6A 5JH7A 1KQPA 5EQDA 4BXOA 1YZQA 2G25A 4I4LA 2JARA 3SYKA 4CTMA 4XPZA 4IUBS 5ALHA 4M88A 1X7ZA 1KFBB 1CPYA 5E8RA 2AEMA 5TGZA 5B36A 5BN5A 3OZAA 2IHJA 3DV0B 1CZUA 4JT8A 4PSAA 4JA2A 1GZ4A 2JATA 8OHMA 4YQZA 3AFHA 2QN9A 3IBFA 1NSTA 5AVKA 1RI5A 1M1YB 3EAQA 5E8JA 1IK6A 4WCVA 4Y7CA 3ELYA 3BS4A 3B1ZA 4G5QA 1ISIA 1YO6A 1C3VA 1Z0DA 2WILA 3GFVA 3L6DA 2ZJOA 4X8MA 2APJA 1KPIA 1QGED 1ZM2A 4AF6A 1TC2A 4FBLA 1BA3A 4XDHA 1KY3A 2YYAA 3LKVA 4J9VA 4UXIA 4UM9B 3BRCA 1DWQA 2PTGA 3WLOA 1QFZA 3BJEA 3UJPA 2D3WA 5I4CA 1AJEA 3UMMA 1UMDB 4JC8A 2XA1A 4PONA 2ZSKA 3ZHYA 3L7DA 1GQFA 2NYAA 3G5LA 5EE3A 1F5SA 4NZ9A 2OCLA 2G0AA 3EDMA 3DTVB 3PUZA 4D9EA 1KY2A 5EMKA 5BQ3A 1AS3A 2I1QA 2AKAB 1NF9A 1EAYA 4LJSA 1VKRA 2HO5A 4A2WA 4CPDA 3HCWA 1ZYUA 5EC8A 3ESDA 3DHWC 3QWAA 3F46A 3GJ6A 3ZEIA 4EZBA 2GN4A 1GA1A 5EP2A 3V1KA 1TX4B 1OZHA 1HT1E 2GCNA 1RTKA 1EDEA 3FOCA 3LQQA 4Q7LA 1YJBA 2PRSA 2Q2WA 4REMA 3DQQA 3R44A 2FXVA 4OKSA 1CVLA 2NYUA 3D7KA 2P9YA 5TJ9A 3MAAC 1FTWA 1OR8A 2Q62A 3SXPA 4CM5A 3OCUA 4O3MA 1H4VB 1JNXX 2R8EA 3O93A 5A0FA 3JCZA 2WQ7A 2AZ4A 3DAFA 2IPMA 1R3DA 3PDWA 1NDUA 2VYVA 4G5XA 3HPQA 5DGIA 4YRMA 4ZAWA 1SUBA 3UG7A 5CHEA 2F64A 4Z4IA 3AI1A 2BEUB 1FYWA 4J76A 5EQFA 2ONJA 3QFFA 4IDHA 4O4JA 2XEXA 2NU6B 5SZKB 2PSHA 1T6XA 2O8NA 5LQKA 5KNCH 1PR4A 7ABPA 1KZGB 4F6RB 1JHAA 1US8A 4JP3A 4P92A 3L4JA 4OI0A 3BVPA 2QYSA 3URKA 1OTYA 3QI2A 3SC2B 3M5DA 2UZIR 2C83A 3TJMA 1SC1A 1JHYA 2G6TA 3KYBA 3Q4GA 4QDJA 4RV9A 5D1HA 2PQ2A 2AJTA 4KO1S 3CZCA 1Z13A 4KMMA 5D5PA 1LD3A 4H7IA 3ZZUA 2PGOA 1EU1A 5LU9A 3GAAA 4KH0A 2Z4SA 3QY9A 1A2OA 1KOJA 1UM9B 2YC4C 1QG4A 3FJ1A 3EVFA 3LUGA 3QF4B 3AVQA 4NC9A 1VG9B 4BQOA 1BCRA 1MX3A 1FUEA 5B1DA 1BGWA 2ZRPA 4RKRA 4WA8A 1MDFA 1Z4OA 3PYLA 2W48A 2BEJA 5TVKA 4DG9A 3LLMA 2RHMA 1A7JA 1CIVA 2VRWA 1ZJJA 1X7DA 3K35A 3N6XA 4IG9A 4CJXA 3BIWA 2KBEA 4YJDA 4EFNA 1E1RD 4ZCTA 5FA6A 1KP2A 1L7RA 1THMA 2Y4NA 3GEBA 4MW4A 4R84A 4C21A 4WBNF 4O2LA 3FNQA 5CT6A 1IMJA 5LZ9A 3O9MA 1GT6A 5KTOA 3MEQA 3V7NA 2DF8A 3C87A 3P19A 4WA7A 3C7TA 1P3JA 5A6SB 5BR7A 4Q7JB 2D62A 4FGSA 3HBNA 1SU4A 4B40A 1Y6RA 3HO8A 3LY5A 3FF4A 3T4EA 5CLQA 4PO9A 2XTMA 5H80A 4UNIA 3PUWA 1ODLA 2AFIA 5REQB 4JNKA 4BP3A 1SD5A 3RT7A 1UJ5A 4DA7A 1H22A 1RYDA 3O8NA 1PDVA 1UBLS 1UOOA 3KT0A 3OOYA 4L4ZA 4J29A 1RWKA 3BEDA 4NQZA 1W25A 2RDMA 4M87A 1EXMA 1FXWF 8ATCA 1OX6A 3DT6A 4MVJD 1OMOA 5IN5A 3BD6A 3L5KA 1EUYA 2AJDA 3T38A 1XQ6A 4XIIA 4Q9HA 3WGVA 1EPUA 2J9XB 2A5GA 5T4EA 4G4JA 5FI3A 3UW1A 4C06A 5AVVA 4PO1A 3SDBA 1EZZA 2QLFA 3BK7A 2VT6A 3GGJA 3YASA 1FSGA 1DWOA 2QX4A 1QNFA 1X1EA 3NBYC 1WCYA 4OI1A 2BFDA 2O1EA 3LA6A 3AB3A 2PKEA 5K3OA 4B3TB 3I9FA 1RIIA 4P7GA 5EFZA 4MCJA 4JJ8A 3A1FA 3Q72A 4J2OA 3DE4X 4HYQA 1S3IA 1ZCBA 3DL7A 3IE2A 4DFDA 1SIUA 3LD9A 1QTRA 2CHQA 4LNHA 5KSWB 2IEGA 4LTDA 4BBZA 1L3IA 1WCIA 5AOVA 1PR5A 2OE2A 3U6BA 2E37A 3L92A 1J20A 2JIZD 3QWHA 2N3ZA 4RW0A 2P9GA 2Y1GA 5ALSA 1RWVA 1ZH8A 5JZSA 2ENWA 3BRWA 4DXAA 2Y0CA 1AGNA 3VGJA 2FQQA 2Q3DA 1DGQA 4TTTS 4QOGA 1WCXA 5IJ9A 1Z63A 4ID3A 3G85A 3U7GA 1L5KA 1JYFA 2H1HA 3TQSA 4DJFC 1HC7A 1QYWA 1EDBA 2ZVQX 4MNTA 3DONA 1E6EA 2PGNA 3ZWXA 1JIXA 4OLHA 3AR7A 1A8HA 3VPHA 3L7KA 1Q44A 4J0GA 3SQMA 1KEZA 4D6YA 2H3HA 1NASA 1A77A 3I73A 5IXJA 4GMHA 5EJGA 1L9XA 4LCEA 4ISCA 4IEFB 4L07A 1Z4MA 1Y8QB 2R6ZA 1KRXA 1JN0A 2IHZA 3NH9A 1SBYA 1MV8A 3ECSA 5JCXA 2CUKA 5I8WA 1L4HA 3OIFA 3TG8A 3WWPA 1RWXA 2R7KA 3RARA 4CM8A 4E03A 4KSCA 2F00A 1ADGA 2AZMA 1JEOA 4G5GA 1E9EA 1VCMA 2CKMA 1JTVA 1JT9A 1QIFA 1QO0A 2PKRA 3FSGA 3GW8A 3NYWA 3PGVA 3S1LA 1DCTA 1E89A 3PTAA 3ZNPA 5GIOE 2XUGA 4C3ZA 3SC6A 3NGXA 2CNWA 4WKBA 3U62A 2FPKA 2C4UA 2PN1A 4LQ4A 1DINA 3GCGA 4TWRA 2Y6VA 3U37A 3KOUA 1IY8A 1BS1A 3AEKB 1Q20A 3P32A 5DHTA 4ZVOA 4JVOA 4MO9A 3RBXA 3FRIA 1NOJA 6LDHA 3T3EA 4R05A 2O2JA 1SHJA 3ZN2A 1PX0A 221PA 3OT1A 1UL1X 4RE6A 3ZVMA 2PUFA 1CBUA 2R9VA 3TSZA 1MC5A 4G8JA 5L4LA 4W9RA 1GV0A 2EV9A 2RHOA 5COAA 4FZ3A 4A8JC 4EY3A 3T95A 4C05A 1GPMA 5KYUB 1WUTA 1FQWA 1R0KA 3BRQA 4TLEA 2H8GA 4O2RA 5HMMA 5BV7A 3E2MA 3MMZA 5HKOA 4UNNA 1UBJS 2B98A 3MWEB 3PTLA 1K88A 3UUGA 1PYOA 3OOSA 5BV2P 3D0RA 3CLRD 1E4VA 1GFIA 4O4HF 3AR3A 3LQ2A 3WQBA 2HBYA 4R2WA 3ONEA 1IATA 3BPSA 4N9WA 4R8MA 3DMYA 4US0R 5DTQA 4AJIA 5HDBB 5K0BA 3WA7A 3G9ZA 3IA2A 4NU0A 3C3MA 5LA6B 2CXQA 3WIOA 1PFGA 3JQFA 5HOQA 2C5BA 1ORHA 4X95A 4GYKA 3BD7A 1FK8A 1VIYA 4D5EA 4EELA 1BU5A 3NNNA 5KNDD 2I3AA 5E7IA 1NR5A 4UATA 2EWWA 3SNHA 1JILA 4AROA 1HI9A 4IDCA 4PPQA 5CLGA 3FMPB 5DLYA 1J1ZA 5ARBA 1RAGA 1YBHA 4J0KA 2Q8PA 2NVUB 3C7DB 2I2BA 1KZHA 4NIMA 5EKXA 1BSVA 1L5GB 1ZUIA 3OC0A 5C8YA 3WLQA 1FSFA 1REQB 3ZW7A 4ICIA 3AF6A 3A1DA 4RH1A 2W37A 4PG5A 1AQ6A 3DYBA 5TS2A 3HBJA 1E79D 2O2DA 4QYXA 4BO6A 2ECPA 3MSCA 5F3WB 5E4TA 4UKDA 1ZBDA 3ERCA 5EJ2A 1P1HA 3DLHA 2V1UA 1Z5NA 2HLDA 1SVIA 4L7VA 4NK4A 3KHTA 3A3NA 4Z4QA 3S28A 2B78A 3TW6A 4K9QA 5C53B 1XNQB 4DUZB 1Y3HA 2C2BA 2IIBA 4PPNA 2XCIA 1PF7E 1D4FA 2JASA 4PYNA 4XQ9A 1P81A 3P0RA 4AX4A 4BLSA 4Z49A 4R2JA 4GLOA 4LVOA 1YJQA 2WHQA 3GUYA 3Q7PA 4ZZIA 2OD7A 5JAOA 3WWOA 3GCXA 1XKXA 1O0CA 1RLMA 2HRQA 2Q8QA 4CQMB 2QL9A 3ZCV