4MH0R

Selective activation of epac1 and epac2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 39
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mh0R00
1Z8FA 2J7PD 1BIFA 1N0UA 3EC2A 1FX0B 2RHDA 2OBMA 4TYWA 1PVOA 4DLRA 2G88A 1AM4D 1XCGB 3OAAD 1RJ9B 2IEZA 3BD9A 3FMPB 3CX8A 4NHOA 2WICA 2EFDB 4V0KA 5ELXA 1NVWQ 1E1RD 3OEHA 3A4MA 1N6IA 3FGNA 4ZCLA 2BOVA 2BCJQ 4TWZA 3WYFA 4HB0A 1W5SA 3TNFA 2A5FA 2D3WA 4PHFA 5F9FA 2R6GA 1DE0A 3TQFA 2ZJYA 2BEKA 1XMSA 1KO8A 2QE7D 5L3SB 1F5NA 3BS4A 2ZRKA 1NVUQ 3I72A 4MRSA 3LNCA 3I3SR 2DCUA 3AF3A 1S3SA 4V0ME 1SVKA 3S1AB 4LJ8A 1GL9B 3GLIA 2RHMA 1DAMA 2ANCA 1KSFX 4LRWA 1QHYA 3REFA 4C0KA 5IT5A 3FE2A 2ZM5A 3SYNA 1KMQA 2IL1A 1QDEA 4TL6A 3TAUA 4D25A 3IIJA 1NVVR 1II8A 2LKDA 2N42A 2NGRA 4XTRA 1LTQA 3L82B 4BWYA 4Q1FA 4HAVA 5EZ5A 3DZDA 4AYXA 1XZQA 2P5SA 5KPJA 1R0ZA 2DFKB 1B0UA 1P4SA 4B3CA 4V0LA 4EFMA 1KSJA 2PCLA 5FPTA 3CNOA 1W2GA 2IHBA 3KKOA 3O8BA 4M1KA 3H86A 3RSLA 5CJPA 2CNWA 1TF5A 3RRYA 5L3RA 3ASYA 2HCJB 4HB2A 3FHCB 1DPFA 3W6NA 2V3CC 4AI6A 1OE0A 3A4NA 4HAZA 1T0JB 3X1DA 2GXQA 5FR2A 2ZU6A 2ZSBA 2GXSA 4JLBA 1NIPA 4DDTA 2BMDA 4BZQA 2BKUA 2O8DA 1YZQA 2RKOA 4LYAA 3R9WA 3PVSA 3NXSA 5EXSA 1Z47A 5UKDA 1OHHD 2DFTA 4G5GA 1TADA 3CH4B 4IOKA 1UADA 4KI0A 5CITA 2QQ0A 3MRSA 1SXJA 1G8HA 4R2IA 1XTIA 3CRQA 2ZREA 4W9MC 2QNRA 1JR3E 5JRJA 3K0CA 2R2AA 3HPQA 4Z8XA 5FOSA 3KTAA 2JJ1A 4Q5IA 2WKQA 5KNBA 3NC1C 4BUJA 1E2JA 4DCVA 4YONB 2RH5A 1E2IA 1IN8A 4IDHA 3GLGB 1CRQA 3CR8A 2GJSA 3QXJA 3LO5A 2G1JA 3RRZA 2DY1A 3KJGA 2IYZA 1OKKD 3RS4A 2NQ2C 1NNEA 3KFXA 3SJAA 4X8OA 4OL0A 4EFLA 5FBWB 2AR7A 5LB4A 1AQUA 3I1FA 2QY9A 4QBGB 1P9RA 1MOZA 1G8FA 1COWD 4JLAA 3EG5A 4DSTA 1EESA 1Z06A 3IILA 2ZSEA 1M1YE 4AK9A 1TQ6A 1D8TA 4GSYA 2OAQ1 3CUEF 3IIMA 3OIVA 1CP2A 2WAXA 1SKYE 3CPJB 4ABYA 5EE9A 3TR5A 2ERXA 1E9AA 3EIHA 5TMPA 2GBLA 2PZFA 1OT3A 2W0MA 3THOA 3CRVA 5G3YA 5BYKA 3GJ3A 1UEJA 4IDQA 5A5GA 4FINA 2R6DA 3QKUA 4TL8A 4EPYA 2VEDA 1U94A 5FI1B 4MYCA 1G20E 2WM9B 4JVNA 1Z0FA 1KHTA 1UM8A 4FMDB 2ZANA 4OHXA 1SKYB 2NO9A 1IJFA 5EE0A 2ODNA 2ZRAA 1RZ3A 3C16C 2Z4SA 5EJEA 3LY5A 4YDHB 3SS8A 1DAIA 4WZ6A 2BM0A 4Q4LA 4N0DA 3S1AA 1DAEA 5DYGA 1HV8A 4TYYA 4GPTA 3B85A 4DIEA 3CIOA 3SFVA 3T1OA 3F0TA 2DYKA 2QE7A 4C7OB 4M53A 3CNLA 4LHZA 1F2UA 3UWOA 1KI1A 4OQNA 3C7KA 4CEJA 1X86B 2IC5A 4ESHA 4ZI2A 2J7PA 3HYTA 4DCNA 3QF4B 3FFBA 4Z8YA 4AWXA 1FUUA 2HV8A 3T5GA 4TLEA 3K0SA 3NDBB 1VG1A 3R8FA 2GNOA 4JYCA 4PC7A 4IXNA 2DBYA 1U0LA 1JXOA 2A3RA 4O0MA 1CR2A 2ZRHA 3HPRA 4CYMA 2O8BB 5JMTA 1OB2A 2WSSA 2GJKA 1KO5A 4Q1AA 4W5JA 3R9IA 3AKEA 2QG6A 1RC8A 4JKYA 2G77B 3KXIA 4HAWA 4P33A 5AJYA 4TMXA 1D9XA 5J40A 2IYRA 3LVRE 1S1CA 3EA0A 1GL7A 2ZAOA 4B3DA 4MUAA 4A2PA 5L8VA 1AGPA 1VCMA 2C03A 2PLRA 3GJXC 3CONA 3LX8A 3KJHA 3SN6A 4TTRA 4AY2A 2JLYA 2W2XA 5JJLA 2JEOA 3EAQA 1GG2A 1VCIA 1E6CA 4FMBB 3K0FB 4GNKA 4PSVA 1SHZA 2OSBA 1IY0A 1W47A 2IYYA 1G6HA 2WSMA 1D9ZA 2HJGA 2J45A 2IXEA 2O0JA 4NYIQ 2YJTD 3WMFA 4D82A 4QKQA 1E69A 1VG0B 2AKAB 4MYUA 2ONJA 1YE8A 3BXZA 1F6BA 2QSZA 3A37A 3E2IA 3ZQJA 1K5DA 2XTZA 4RFVA 5BN5A 4Q21A 4JJKA 2VHJA 1R7RA 2AWOA 3M6AA 1EWQA 2C9YA 1CS4C 4HLUA 2B7BA 2AFHE 1I4TD 2ZPTX 1NJFA 121PA 1UKEA 2YWGA 1N5JA 2OXCA 8OHMA 1W1WA 1E2PA 1G17A 1P7CA 3T1TA 2F1RA 2IEYA 1Z5ZA 3FOZA 2ZSFA 2B7CA 2ZI7A 5FTMA 2RGBA 4BZPA 2VL7A 1W7AA 2CXXA 1FL9A 4LOAA 5B58C 2WMNB 1FW6A 5DI3B 1GKIA 3NEJA 4R98A 4YMUA 5FL3A 3IPXA 3PQCA 2OZEA 1Z29A 2O0HA 1F48A 1RVDA 1GM5A 4CEIA 3FDIA 1UFQA 1L2TA 1EFUA 3SR0A 5JS8A 3RSOA 2YOHA 3WHKA 5LD2B 3CBQA 4O3MA 3W90A 3C5HA 4B76A 2VSFA 2ZYWX 3HDTA 3Q7QA 1G5TA 3FHTA 2ZSDA 4FI3C 2F9LA 5JWRA 1GUAA 5FBLB 4EPRA 3QKSA 1P61B 4M8NE 4ZDJA 2BBSA 2QMHA 4IHQA 4WA7A 2R8RA 1VG8A 3EW9A 1WA5A 5EXXA 3VR5A 2FU5C 1AK2A 2A5YB 3UPUA 4DIDA 1P9NA 2YYZA 1VYVA 1XEXA 4JBYA 1P2VA 2GVZC 3EARA 4OK3A 4BPBA 1ZYUA 2ZJZA 5D3MB 2F43A 5G3ZA 5KSPA 1KAGA 1UBCA 2L0XA 4KCGA 1JEEA 3TBKA 3I92A 3PCRB 2NO6A 2DWQA 4ZDWA 2ORWA 4JLNA 4KFUA 4NH0A 2X8AA 5JCPA 1W36B 1KJYA 5CB6A 2ZITA 1ANKA 2FA9A 2JLUA 4QOSA 4QGHA 3PITA 5FL7A 2XJ4A 3IHWA 4IFBA 1DAFA 4FWTA 3NBFA 3WYGA 2IWHA 1GRRA 2GAOA 4DDUA 1ZIOA 2ZROA 1D6JA 4F92B 1G16A 1ZM9A 2QM8A 3SI7A 1KZGB 4FCVA 3L8YA 4M2LA 3T12A 1G7CA 3U4QB 1TU4A 4Q7JB 2FV8A 4CW7A 1KI7A 1KO7A 3UMFA 2V1UA 3OAAA 3HU3A 4HDCA 4Q4AA 1IY2A 2NG1A 4OI0A 3DM9B 1FTNA 1Q1EA 1TMKA 5HR5A 1LFDB 3RS5A 2AK3A 2EQBA 4ZPXA 4JKIA 4URWR 3AP3A 4KVAA 3QKTA 2Z6VA 1HYQA 1JPJA 4LBYA 4JVLA 5K8TA 4BLOA 5FR1A 3UMSA 1XPRA 4AKHA 1DADA 4UXJA 3ND8A 1YR6A 5FTLA 1ELOA 5FH9A 1P60A 4M1MA 4DKXA 3GD7A 3QVVA 2NPFA 3PUWA 2ASEA 4URVR 5BWMA 4I1SA 1N6NA 2FPMA 4IKEA 4ZO4A 2SHKA 3AEZA 1AA9A 4KODA 4EJSA 1KI8A 2V1XA 5FPKA 4UNPA 4Z51A 3KQKA 2RGDA 3BGWA 2QTFA 4LGMA 1N6RA 3SNHA 1VCOA 2ZVPX 2C99A 3C8UA 3H0KA 2J0UA 1GIAA 4XVRA 4BFSA 4TQUS 3W34A 5JSZA 3VKHA 4RZ2A 1DBSA 3RS2A 4YMSA 4OQXA 3K70B 3LV8A 1E1QA 4N0EA 4U7DA 4A15A 4UNQA 1Z3IX 1Z6YA 3RC8A 4GP7A 2WIAA 3U7HB 3BFXA 4QJ5A 2ZE7A 2ZUBA 3AKCA 3GJ8A 1I4LD 1SVWA 1U8ZA 3EZ9A 3TIFA 1Q12A 4YMWA 2HLDD 3IO5A 4NU0A 5FPSA 3VR2A 1YZNA 5FBRB 5DHAA 3VX4A 2CNWD 2H7VA 2GXAA 4I1OA 1YZLA 2QA5A 5FBQB 2ZRNA 4Q9LA 2GBLC 1GAJA 1VG9B 2JLXA 2WV9A 1Z2AA 3HYRA 4BFZA 3D7MA 2XZPA 4B35A 1MRNA 1CJTC 1GL6A 1N6LA 4TMTA 2MSCB 3C4JA 1R10A 4MYTA 2PJZA 1OH7A 1CU1A 2ZJOA 4IEEA 1M74A 1ZCAA 2D62A 1XWIA 4K8OA 2B8WA 1E0SA 5GJCA 4LJ5A 4US2R 1JB1A 2OFOA 4US0R 4ZIRB 4I1UA 1G4AE 2YWFA 3KX2A 2A30A 2O8FB 4C9BA 4LUCA 1CR0A 4V0NA 2HYIC 5IRCD 5AJWA 4I4LA 4MRRA 1W0KA 5E95A 5CM9C 3AM1A 1KO4A 2XTNA 2CK3D 4B74A 4AKEA 4XWAA 4BFTA 4UJ3A 3VNUA 2ZXUA 3L0PA 4WVFA 4G5OA 4DC9A 2ORVA 1J7KA 3SQWA 3SEAA 4B33A 4TYPA 1DVRA 4RKFA 3K9NA 4YLGA 2NO1A 1HT1E 3U4QA 1YVDA 5KO2A 4Q4HA 4TL9A 221PA 2VP4A 3LW7A 1IN4A 3O47A 4FCWA 4IJMA 3D8BA 4ZV4A 2WHXA 1NP6A 1P3JA 4BECA 4RFSA 2F7SA 4P0TA 4ZDIA 1TUEA 3TMKA 1OXSC 2PZGA 1NSFA 4IDPA 2AWNA 2OLJA 3GP8A 4UKDA 2PL3A 4D26A 1NMXA 2QT1A 3CH5A 1E1QD 5KSZA 1IXSB 1XPUA 1OYYA 2VTKA 4PHHA 1XTRA 2H57A 3GJ5A 4OJQA 4OQLA 4QNRA 1G8PA 4Q4JB 2WTUA 2GWHA 4M9XA 1X8LA 1UKZA 3MWKA 3KUCA 4MH0R 3RNLA 2H1LA 3NH6A 4PC6A 3PV0A 3TUIC 5HKKD 2P67A 1WDTA 5JFGA 2GK6A 2KWIA 2DR3A 4OKSA 1JR6A 4RZ3A 1DO2A 4LV5B 4ZKEA 3KQLA 5EXPA 4BZXA 5LD2C 5JWOA 3KQHA 3ZZTA 4G1UC 4LJYA 2FE4A 2FSFA 3HU2A 1Q3TA 1KY2A 4Q1BA 4JVSB 3R8CA 1WB9A 1UDWA 3JVVA 3OIUA 4Q9HA 4ESVA 2QL6A 4DUGA 1QZXA 2NZ8A 3K0AA 4Q48A 3EA5A 4NCJA 4ZI3A 4Q4HB 2VF8A 4M1OA 1V5WA 3TRFA 4R9UC 1ZW6A 3ETLA 3SBDA 3KQNA 3TKLA 1JPNA 3WBKA 2Z5FA 4V0MA 4WXRA 1P6XA 3CF6R 3BIFA 3W9YA 1A82A 2PH1A 2QEQA 4PC3A 4JIMA 1N6HA 1JJ7A 1OLOA 1NSTA 1NVXQ 3AB3A 1CJKC 2WIBA 1GFIA 4R2HA 2OLKA 4NE2A 2PZEA 2CE2X 1R0XA 5E4FA 2FG5A 3QKSB 5JECA 2FEOA 5LBIA 4RJLA 4MQBA 1YHNA 4GI7A 4JSTA 1IXZA 2GJAA 4EPVA 2OBLA 1QVAA 2QI9C 3FMFA 4PZYA 2ZE5A 1H8HA 4ON9A 3B13B 1FMLA 2NO0A 3I61A 5JSZB 1HQCA 3LW8A 4HZUA 4P31A 4MGYR 5HE9A 3G82C 1N6OA 1CBUA 2ECKA 1P2UA 3DDCA 3CX7A 2O8EA 2G1KA 2ZRIA 1Z28A 1SVMA 4C0LA 1VTKA 4HLQB 5KSYA 5EZ6B 4DCSA 1U0JA 2D2FA 4KU4A 4LC0A 4S35A 2NIPA 5HZKA 3VAAA 1FMJA 4URYR 4X8LA 3ADDA 2PT7A 2XOKD 3BFVA 3CF0A 4XVUA 4OK6A 4WZAE 4AURA 1P9WA 2Q3MA 3VTKA 4HDQB 1UF9A 1G8YA 4OJKA 1DG1G 1HE1C 3V00A 2ZTSA 2DPXA 1G41A 3WHLA 2ZIAA 2JCSA 2G6BA 3ZS8A 1XD8A 4M1TA 4QHYA 2C04A 2RAPA 3T34A 4DLYA 1XTKA 1E9DA 4KSCA 1Q1QA 1UBGA 3FMIA 3FMOB 4BFWA 1ODFA 1XCMA 2ANBA 3VQTA 5DNYB 2YOFA 1N25A 2IXFA 5KNCA 3GLIE 1KNXA 4A82A 3L0SA 1Q44A 3RRMA 4KYIB 3C5CA 3H2YA 3AVWA 3ZVNA 2W6IA 1IBRA 4PSAA 1UAAA 2RGNA 4LV6A 3OE7D 1ONBA 3OF5A 4ASUD 2EU8A 1TNDA 3SOPA 5GJWC 2CHGA 3U44A 4EQ6A 1OW3B 1C1YA 1D5CA 3P26A 2G9NA 3I8XA 2VSOA 3VU9B 3IQXA 2FZ4A 3LLMA 4B2IA 5CDFE 3SYLA 5C2JB 4C2TA 1S8FA 2HF8A 2QAJA 2PBRA 3QXCA 4KLNA 3WMEA 4A8JC 3GLGA 2WJYA 2GEVA 1AQYA 2I1VB 4JSYA 1GNPA 5B64A 2FSGA 3ZS9A 4FW9A 2YWEA 4LC1A 4BLSA 1KJWA 1OFUX 4TSFD 1MH1A 1JBKA 2XITA 1QG2A 2GZAA 1A1VA 1VYUA 2WOJA 2WMOB 3WXMA 1ZVQA 5FUWA 4DCUA 4XTCS 4AG5A 4C4PA 3E70C 5G53C 4EPTA 4NONA 1P73A 1TL7C 4EJSB 5J4LA 1GITA 5LPNA 1DO0A 5J4YA 1KI4A 1SVOA 2VHTA 2GF9A 4LJ9A 3JZAA 3UXMA 5GJVC 2NTYC 4HLDA 2ATXA 2ZJAA 3RS3A 4JL5A 1HE8B 2J5XA 5D3MA 5EUQB 3AV0B 1HH4A 4LBZA 4BFXA 1NBMA 3AF0A 1MV5A 1XJ0A 3JVUA 2QTHA 2ZSAA 3HR8A 3B1ZA 1MRSA 3B9PA 4K81B 4NYMQ 1CTQA 1MO5A 3MFYA 3RWMB 2RGCA 3KB2A 1EX7A 4C2UA 3CKLA 2XB2A 4DB2A 2VO1A 3KJIA 3KXKA 4Y0AA 3U3KA 3FKSA 3OEED 1ZUHA 3FPAA 1E2HA 3ZLJA 4OI2A 2O52A 2P6RA 2R6CA 1OFHA 5JHHB 1ESMA 2ONKA 2QSYA 5FL7D 4A6PA 4DB4A 1A5TA 1DAHA 1L4YA 1S3GA 4NCKA 1V43A 3O8DA 5K8LA 1LW7A 4JLPA 4DT1A 2ERYA 4JLVA 5BN3A 2AXPA 1SGWA 3ECCA 3UG6A 5B30A 1J90A 1VIAA 4TZ0A 2XEXA 1HTWA 3IUYA 4B3GA 3UMRA 3GFPA 3QI2A 2XZOA 2W6JA 1E96A 1G5RA 5C4GB 3SJBA 3ZVRA 4NMMA 1JAHA 2V55B 2W6ID 3QG1A 4O2LA 3ASZA 1U90A 2GCPA 2RGGA 2BMJA 4FMDF 5EUMA 2CJWA 4I99A 1E4VA 1ETUA 1WQ1R 1K8RA 4Q4JA 4YXWA 2QTVB 4RCZA 2KSQA 1JECA 3VFDA 1I2DA 4KFSA 3T61A 4A0HA 3AVUA 4AKGA 3GJ6A 1W0JD 3B2EA 3MJHA 4DHEA 1KKLA 5KDOA 5KU1A 3P4XA 1SKQA 2FFAA 4HZUB 3ICQB 5GADl 4RZXA 3BC1A 1F60A 2K5UA 2B6HA 4PZZA 4C0SA 1TF2A 3CW2A 5CIQA 1Z6TA 4M1WA 3T1VA 4O25A 4C0BA 2IK8A 4C0HA 1CJUC 5FI0B 1S96A 1YU9A 4CIDA 3MCAA 3NDPA 4GBMA 2WWYA 4MDEA 1M7BA 5CYOA 4PXAA 1E98A 2EYQA 3DO6A 1KMHB 1BKDR 1S9DA 2Q21A 4MRPA 1N3BA 2R44A 3QXSA 2P5TB 1W4CA 1R5BA 4AG6A 2WJVA 2H8KA 2ZJ8A 5DYIA 1SXJE 4D0GA 2TMKA 2GESA 2WZQA 4C0AC 2QP9X 3SE0A 4HB3A 1AS0A 2ODWA 5CDFA 2VA8A 4BFYA 4YDSA 1BH2A 2QQEA 1UPTA 4L9SA 2WOOA 1WCV1 4A0FA 1NKTA 4W5HA 2P65A 3J81k 2W0SA 1YZKA 3DHWC 4CT4B 3PEYA 4FXPA 2CL0X 2X77A 1TEXA 2ZUDA 3K0EA 2IYWA 1U98A 1U81A 3CRW1 5J47A 3U7FB 4POAA 1KNQA 2JLZA 2JLWA 4QGGA 2F1HA 1U2RA 4GOXA 2J0UB 4HEJA 2JLVA 4GOKA 3OFNA 1T8UA 4PAOA 1EFTA 2YC4C 1ZNXA 3A1UA 3QVUA 3Q3JB 5EP2A 3FHOA 4JZKA 2Q9BA 3DZ8A 3K0FA 2W6JD 4TLDA 1W49A 2XXAB 1G8GA 1Z63A 2VHQA 1KI3A 3K9LA 3THWA 1CJMA 1TU3A 4PHGA 4GZLA 1XTQA 1KAOA 3QIAA 4LK2A 3WNCA 3X1ZA 3TVTA 2B92A 3TLXA 1PLJA 1LVGA 2BHRA 3GLHB 5CYPA 1KK1A 4WOPA 4IDNA 4Q7MB 2JDIA 1R0YA 2F9MA 1RRGA 4QL3A 4JLKA 5L3VA 5SZJA 1I2MA 1KOFA 1IN6A 3VR6A 4DT1B 1UKYA 5AUQA 4BFUA 2JAQA 1EK0A 5CM8B 2D06A 2QENA 3AP2A 3U7EB 3KKQA 3CX6A 4Q1CA 4NYMR 1TPZA 1AZTA 2ZAMA 3I5YA 2YVUA 1FOEB 2CMKA 3WRXC 2NMVA 4PAMA 1P5ZB 1WP9A 2AN9A 1EFHA 2VP2A 2G3YA 1XEWX 3FVQA 1E9SA 4C0JA 1NBMD 4E07A 3GCGA 3VHLB 4C3ZA 1LY1A 3X2SA 5GVSA 4RD3A 3QF7A 3MWJA 3W5JA 1NN0A 2KI5A 3GEIA 3LXXA 3SZRA 1U0HC 4PR0A 4OHZA 4DSOA 1XMVA 2QMEA 3TE6A 3PJRA 5C4MA 4V03A 4OHVA 3QG5A 2YC2C 3LBHA 1E9BA 3PENA 3K9GA 4KVGA 1WRBA 4OI1A 5KHOC 2FFBA 2QM7A 1VPLA 4BASA 2ZYVX 2BC9A 3A1TA 3K1JA 2IX3A 2CVHA 3GJ7A 3QKRA 5FUXA 5C18A 4EDHA 1OV4A 4F7WA 3DMDA 3AGPA 2I4IA 3E5HA 1LV7A 2NOAA 4DCTA 1KDOA 3TQCA 5KYKA 1RRCA 2X19A 2ZS9A 4Q19A 1US8B 3BE4A 2QGNA 1NLYA 1R4AA 1NI3A 1MO6A 4BE7B 5F2EA 4B75A 2F1JA 3MSXA 3P20A 4IOMA 1G3UA 1OXVA 1N5KA 3AF4A 5HE8A 3BAFA 1Q3HA 4TN1A 4DWJA 3NBZC 4L16A 1M34E 4B6FA 3GLFB 3IPYA 1NLFA 3KKPA 2OXRA 3ZZ0A 4CEJB 3G5UA 4W7SA 3UG7A 4OHYA 2ZI4A 2QN6A 1IY1A 1E9EA 3UK6A 2RCNA 1RPZA 4QJ4A 2O8FA 4KAXA 4GZMA 1Z0KA 1RRFA 3Q72A 4Q66C 2CBZA 1NRJB 1E9RA 2REBA 2OE2A 2OFXA 1SVLA 4TSFA 4DVGA 2UVQA 621PA 3QSYA 3KKNA 4P4TA 2PLFA 4PANA 3WYAA 2IYVA 3CZQA 5KDDA 2IYTA 5A4JA 3RS7A 3QJYA 3GMTA 3MD0A 2KJQA 1QHIA 1II9A 3QEOA 4FMCB 1ZBDA 4HATA 4ZCIA 4GRAA 1W4BA 3KFVA 4BFVA 4HAYA 3KUDA 1G21E 1H8HD 1G291 1VKJA 3DMNA 1M7GA 1Q57A 3CM0A 2JJ1D 1GKYA 1SVSA 4EQ6B 5C1BA 2UZ3A 3SJCA 2JLRA 4EPWA 5G40A 4M21A 5HCNA 3OIYA 1YR7A 1A2KC 1Z0AA 1JR3A 3CWZA 1SVIA 2JIZA 4PO9A 821PA 1QBKC 3F5FA 4IW3B 1OIWA 2GA8A 3B5JA 4CVNA 5J4HA 2Z43A 1ZM2A 1G9XA 2IYLD 5SZHB 1TAGA 4KYUA 3ZZUA 1B23P 3SFZA 2H16A 1IHUA 2D4HA 1E2DA 2EWVA 1RW4A 4ZDKA 2YWHA 4LHWA 1MKYA 2QPAA 4B44A 2ZQ5A 1KZ7B 1YKSA 3BWDD 1ZINA 3BERA 3OIWA 4KV9A 2OAP1 3C15C 4BLPA 3WMGA 4P32A 4H1UA 1CRPA 4TZ6A 4DLZA 1FFHA 3GJ4A 1LF0A 3NHAA 3OESA 3LBIA 5E7IA 4ERNA 4XWKA 4U5XA 2G0TA 1OH6A 1N5IA 2FNAA 2ZRBA 4P4SB 4QC2A 1QHHA 3O8CA 1IQPA 1YJ5A 2WWGA 2CCJA 2BV3A 3UATA 1W44A 1ZRHA 2R6AA 4P4SA 2D7DA 3VHXA 4EFNA 3U3RA 1KI9A 2REXB 4NZYA 3M0EA 1OFIA 6Q21A 1YR8A 4KITB 1EFRA 2DFLA 2IUTA 2ZI3A 3WNDA 4CRWB 2O8CA 1CR4A 1YRAA 2WWXA 3K09A 4M0LA 4OQFA 2KB0A 1JAIA 1CR1A 1HQYE 2V54A 4R7ZA 1E0KA 1TUIA 2AL7A 4Q4AB 2ORIA 5JEDA 1XEWY 4TLAA 1MT0A 2MMGA 2CL7X 2IW3A 3DPUA 3PEUA 2F55A 3TVDA 1XMJA 2Q3FA 4ITRC 1FTSA 4D4KA 1YZUA 3MMPA 4M9ZA 3V4RA 1FPMA 2A2ZA 3QPVA 2XSZA 1MABB 1DS6A 1NF3A 4TYNA 5EE5B 4EKDA 2GJ8A 2FPKA 2WJJA 2X2EA 1ZMXA 5H1YA 3QY0A 5JCZA 4M22A 3I4LA 2ZS8A 3FB4A 3UANA 2PT5A 2Q6TA 5EE1A 2IS2A 1U99A 3MAAC 4YMVA 3V9PA 4TQAA 2WWWA 2P3SA 1PLLA 2RGXA 4DDVA 1ZNWA 1FP7A 4PPGA 4BGDA 1VYTA 1EFRD 1QHHB 1W36D 3QENA 1WBDA 3D6TB 3M4YA 1T5IA 3LQRA 5P21A 1OSNA 2CE7A 3TUJC 1T0HB 3THYA 3A1VA 3ZGXA 3AVPA 4DLVA 2OO7A 1P62B 1QG4A 4QBHA 2HT1A 2F6RA 3F8TA 3H84A 1L8QA 3NHBA 4II7A 4PHTA 3D31A 2J0SA 4B32A 3Q9LA 3JZMA 4BQSA 4P3YA 1E2LA 1ZJ6A 2A5DA 2ZI9A 4E09A 4PO8A 1OB5A 2IS1A 1OPXA 1XD9A 1U9IC 1XDBA 1ZNZA 3BH6A 2OUKA 3U6KA 1G6OA 1IOZA 4LPSA 1P2TA 3PUXA 3KZ1E 3AVTA 5FPYA 2OILA 2PEYA 3EX7C 2IYUA 1OKKA 5DISB 1HUQA 4FN5A 5FOUA 3VX3A 3B1XA 3U3OA 3W8RA 4J0QA 4LV8B 4G5SA 3VMFA 1UBEA 2I1QA 4B3XA 5JHGB 4L8GA 4LBWA 4D4MA 3WNBA 4JLJA 1N0WA 2X1VA 2J87A 4CT5A 4LYFA 1J70A 1GWNA 2XB4A 3OZXA 2CK3A 2FGKA 1NN3A 3B82A 3PUVA 4CEHA 4NCNA 2CJWB 1XRJA 4NYJR 4XSHA 2FX3A 3CLVA 1U8YA 2LCFA 3CR7A 1H8ED 1NMYA 2GCOA 2IWRA 1KDRA 1T9HA 1X1RA 1KK3A 2ZRCA 1XB2A 3VKWA 3TUZC 2UZIR 1T4GA 2YZ2A 1ZAKA 3K70C 1XTJA 2OEPA 4MKFA 4BLQA 1NIJA 3EZFA 5BQ5A 4RVCA 2VP0A 3AKDA 1QF9A 1Z6XA 4A9AA 5SZKB 2O8DB 2RGAA 4HUQB 1JXMA 4BRWA 2ZR7A 3K8YA 4OQMA 1T3SA 5CK4A 5JJIA 2E9SA 2VH5R 4WAUA 4DXAA 1GP2A 3L0OA 2LWIA 2WPDA 3U3MA 5JWHA 2Q0HA 1NG9A 2FDCA 1TEVA 3K70D 3QPWA 4PQRA 4M9QA 2ZRDA 4QXAA 2PJRA 5DIFA 2VBCA 4PPFA 2DHRA 2C78A 2VYFA 2C2HA 1LS6A 5J5CA 3NG1A 5JI2E 3O8RA 4LJAA 5HKKA 2DWPA 1D2MA 2LKCA 4IEIA 4LHXA 4U02A 4Q01A 2V6IA 3WRYC 2IS4A 4MKIA 1XD2B 5AUPB 2VPPA 4O2RA 3AQ4A 1GOTA 1XJCA 2AK2A 1A4RA 4DSUA 2P0EA 3I32A 1X8JA 2FSIA 3B1VA 4XJXA 2GAAA 5TDHA 2OT3B 4NCIA 4EJSC 4EPXA 1T3HA 3GLGE 4Q47A 3R7WB 2VQSA 1XBTA 4NPHA 4IDOA 1DAKA 2IYXA 2Y8EA 1R8SA 4JYBA 4PO1A 1T6NA 2H5EA 4NCHA 4MRNA 2G0NA 3TR0A 1GZSA 5E7JA 5GJBA 1W0JA 1YZTA 1Y63A 1BO6A 3ZJYA 2O8BA 1SQ5A 2PCJA 3HP1A 4F4CA 2EFEB 3EASA 2IUUA 3NKVA 4ZIRA 4MITA 1OIVA 1NL3A 2XGJA 2AX4A 4JLOA 5AJXA 2XXAA 3P1JA 1W4AA 5IK2D 1H65A 4PPQA 1RJ9A 4QGAA 4WIAA 3UKDA 2O8EB 3PEVA 2B21A 2C96A 3N2IA 4LPKA 4V0OA 2J7KA 1OIXA 1E0JA 4RD0A 4XH9B 3SJZA 4R71A 1AKYA 1CF4A 2EFHB 1NY5A 5JRZA 3THXA 2GF0A 4DZZA 1W46A 3GEHA 1J99A 1Y3AA 1ZD9A 3DOFA 3EPHA 1OFTA 3B7GA 2X2FA 2OHFA 4JLDA 1XNJA 5DI9A 1AN0A 1VIYA 1XMIA 2W2VA 1MO4A 3ZH9B 4KLZA 3RHFA 421PA 3ND9A 4RCYA 3CRRA 1E79D 1MABA 3GPLA 1HA3A 2MSDB 1XU4A 2QORA 4C7OA 3R20A 4GMXA 4FD2A 2HEIA 4HI0E 1KYIA 1J8MF 3TJZA 2BJWA 4QFMA 4DEXA 2DB3A 2NO7A 2QAGA 4JT4A 3H4MA 4YC7A 2XZLA 2QRNA 3F3YA 4D6PA 1W48A 4XD7D 5DN6D 1Z0DA 5DLQC 2KE5A 4F93B 3UWKA 1KK0A 5FOXA 1T8TA 2PX0A 1VCNA 5TY0A 5AK0A 2XOKA 2XSZD 4Z1MA 1QVRA 1M2OB 2DFNA 3QBTA 4HZIA 5HTKA 5TXGA 1GRNA 2QUZA 2HDNB 1F3OA 1DG3A 1KTVA 1VHTA 2WBLC 3A36A 4M9SA 3A4LA 3LFUA 1XEFA 1Z6AA 3N5CA 1DEKA 2F3TA 2WPDD 2XJ9A 2ZE6A 3LH5A 2CLCX 1KIMA 2FH5B 3RAPR 1RE0A 4Q03A 4XWOA 1BMFA 3LA6A 2QMOA 4ARZA 3NIBA 2CHVA 1M7HA 4Q9KA 3VU9A 2WVJA 2GJ9A 5E7MA 3Q8XB 2PMDA 1JR3D 5K8IA 2FGJA 3N70A 2NZJA 3IKJA 1ZC4A 1E2MA 4KXFB 1OXUA 4E22A 2BBTA 4RD1A 3ADBA 4GL2A 4DJTA 5L3QA 4RKEA 1K5GA 1T3LA 3OE7A 2PMKA 4JMPA 4Q9IA 5JZVA 3NBXX 3ZVLA 1ZC3A 3CPEA 2XNDD 3TH5A 3U6BA 4S2EA 5KDLA 5C46F 2A78A 2FZLA 3U60B 2IS6A 3MWLA 4KJZA 4HLUC 2BMFA 2BIFA 2ZR9A 4GT1A 2JLQA 2VIIA 5JJKA 3P27A 4B3BA 1OJLA 2HUPA 3VNVA 1RYHA 1G18A 2H18A 5DI3A 1AZSC 2CLDX 4TTPA 2JA1A 5AUNB 3TK1A 4LWZA 4A36A 4QRHA 4QHSA 5AJZA 1X1SA 3GJ0A 2A5JA 3X1WA 2W2TA 4B71A 2PEZA 2V7QA 4M1SA 4QJ3A 3M1IA 4XD7A 3B8HA 3P32A 3EZ2A 4QGFA 5DN6A 4QG7A 4DRZA 5IF9A 3TGPA 2QP3A 1GKUB 3B1YA 1QRAA 1E32A 3ZIAD 3AVVA 4LJ7A 2MMCA 1Q21A 3MUFA 4WW0A 3GLIB 1OXTA 1ZM3A 3WBJA 1FNMA 2BCGY 1G3RA 1E79A 2KBEA 3FTQA 2HF9A 1JEDA 2V6JA 2ZVQX 2F3RA 3EPJA 5CIWA 3WP1B 2AHOA 2HCBA 4LYHA 5CLLA 3RC3A 3RS0A 5L3QB 2VSXA 2IA5A 1SULA 2BKEA 2GZHA 2O0KA 2ZRPA 3U5ZB 3AP1A 4MGIR 1ZM4A 1OH8A 1KSHA 1Z83A 3RYTC 2QZ4A 1PZNA 4A8JA 1DOAA 2ZS7A 1G4UR 1PUIA 1FX0A 3BH0A 3RLFA 5H70A 4HUTA 2REOA 5TV2A 2J0QA 1XJQA 1XXHB 3KDSE 4L9WA 1GNRA 4XSGA 3BB4A 1AS3A 2JDID 2IYQA 2ZJ2A 2VLIA 2HLDA 2ZRLA 1X8KA 5JBQA 3FKQA 3SC3A 4JJZA 3AH8A 4L15A 1XX6A 4D4JA 2RGNC 3H1TA 3T15A 1E2NA 3DVLA 3THXB 2B8TA 3Q5DA 1KJZA 5DHFA 3EWSA 3N2EA 2BEJA 4F38A 4GFDA 2ZEJA 1KMHA 1OYWA 4BRUA 4IVRA 3IEUA 2QP4A 2IT1A 1VHLA 2O8CB 2W83A 2GTPA 4Q7LA 5H8WA 4TL7A 1PUJA 2QPOA 1G5PA 4TMZA 1NBME 3TAHA 4G5QA 4PQFA 4A0GA 4PTLA 1CEEA 2ZRJA 2ODBA 4URUR 2WKRA 3SHFA 1JJVA 2A7QA 4QNMA 4LCBA 3RRNA 2P2LA 2XAUA 1XXHE 1C4OA 4FWIB 2RB4A 2QAGB 2BBOA 1X3SA 4BLRA 1AIPA 1NKSA 2QU8A 2F1IA 5BW8A 2QROA 4C30A 5CLQA 4RD6A 4LBVA 4RZUA 3EZ6A 5F9HA 3OFND 3REGA 1G7RA 1XP8A 3PIRA 3D3QA 2EYUA 3NEYA 4NL4H 2ZUCA 3MJRA 3L43A 3C41J 4CGZA 1Z2CA 3T06B 3Q5EA 2ZJ5A 4LJ4A 2G83A 4IVPA 3VR4A 2R65A 2H17A 1YQTA 3W3ZB 3LRPA 4UNNA 4GDFA 1Z08A 4MUBA 1XXHA 5DE3A 4HUQA 4IFEA 2D74A 2GHIA 2IBMA 5HCIA 4CDGA 5F98A 2J9RA 1D2EA 4WZBE 4LHYA 4X8HA 1DAGA 1S2MA 3FYHA 1WMSA 4BLTA 2QMUA 5FOVA 4Q00A 3TW8B 3QKRB 1R2QA 4QHTA 2YV5A 3LVQE 5AUOB 4FMCF 5L3SA 3QNUA 4F4JA 4Y0VA 3K09C 2P6NA 3ZD7A 4H1VA 2C8VA 1SXJC 4LDJA 1W36C 5KOYA 2QBYB 4TMKA 3SU8A 2ZE8A 3EIEA 4ACAA 4JL8A 3PEWA 5FPHA 4OHWA 1YZGA 4M1YA 2O5VA 1Z6GA 4F91B 1XD2A 2R9VA 5EP3A 1SHKA 2C9CA 2HT6A 1KI2A 4KFTA 4MGKR 3IO3A 4RY2A 1VDZA 1E0AA 5GVRA 5K8UA 1SXJD 4JS0A 4XOIA 5HZHA 3BK7A 3KJEA 5BN4A 2AFIE 4ACBA 3NH9A 1TF7A 1AGRA 2GEUA 4RD4A 4BEJA 3GQBA 1NN5A 4N1AA 3BH7A 1PV4A 5FTNA 2CLSA 1GSIA 5DO9A 4HAXA 1Q0UA 1N6PA 3MGCA 2VF7A 3IGFA 2IYSA 5AWFC 3EXAA 5SZIA 1O87A 3EPLA 4CEIB 1TQDA 2YOGA 1T91A 5DGXA 5G41A 4AIIA 3OEEA 4LY6A 1ZD1A 1J2JA 1BS1A 3P4YA 1S4QA 4L5BA 2YKGA 2OCPA 1UEIA 4F4IA 4UXIA 2HYDA 1CIPA 2FJUA 5M04A 3U3JA 1EX6A 2JATA 1DARA 2AXNA 1EGAA 4RFSB 3QQ5A 4A6XA 2VP9A 1RKBA 2ATVA 4B48A 4DLUA 4TT3A 4E5UA 2V8OA 2GCNA 3ZD6A 1HURA 2BBWA 2OG2A 4LSGA 2OM2A 1ZNYA 2WKPA 1GNQA 4EAQA 1QHSA 2FSHA 4YXWD 3QE0A 3A8TA 5EXTA 1P72A 3CWQA 2XNDA 3GLHE 4DDWA 5LDDC 1E3MA 3ZYCA 1JI0A 3NC0C 2FEMA 2J1LA 2Z83A 3QUSA 1E1RA 1BYUA 1OF1A 3OEHD 5B2ZA 3R7WA 1W4RA 1XFAA 4JVMA 4H9GA 4LI0A 3V4FA 4UNSA 1CLUA 4JT2A 3W6PA 3KKMA 4OBEA 3R9XA 4Z1MD 3HJNA 2OV2A 1CKEA 4A1FA 4KBGA 1KI6B 1Q1ZA 4TTQA 3W6OA 1NMZA 1NVVQ 4B3FX 2V7QD 2Q3HA 2IF0A 2JJ2D 1LNZA 1S9HA 3LLUA 2UKDA 4MGZR 2BVNA 1KY3A 3LAWA 3U61B 3HU1A 1XZPA 4AYTA 3IEVA 4P4UA 3QXHA 1U9IA 3IDQA 5AJVB 1NY6A 1COWA 1IM2A 3C14C 4Q1EA 4A0RA 4I1VA 4NYJQ 1E2EA 2ZETA 3W3AA 4HB4A 4QM6A 4Q7KA 5FUVA 1ESNA 4NBSA 4NYIR 1G3QA 1QHGA 3EZ7A 3NBYC 3KXLA 1O3YA 2R6FA 3IQWA 4LZZA 3RVBA 4M4SA 5KTYA 4PPNA 5BYJA 1ZD8A 3AKYA 1Z07A 4XVQA 3KQUA 5IHPA 3QBVA 4A92A 3T1QA 2WJGA 1TQ2A 2A9KA 1K6MA 4RSGA 3I5XA 3EIQA 5FTKA 1JQLB 3CRMA 5J4KA 1IXRC 1XF9A 4NP6A 1Z0JA 1BYIA 1G3IA 4TLBA 2P6UA 1XEXB 1EG7A 1AS2A 3L2OB 3L0IB 2ZJBA 3AF1A 3GFTA 1FNNA 3THYB 4WBSA 3ZVMA 1CULC 2FN4A 3PUZA 2GRJA 2N46A 1FP6A 3RWOA 1DELA 3SQXA 2WAYA 3VR1A 1T5LA 1RFLA 2JASA 1KO1A 1PLKA 5F3WB 1HEIA 1LB1B 3KTAB 1IONA 3K53A 4MRVA 3UIEA 4BEBA 2BDTA 1YRBA 1NJGA 1TQ4A 4FIDA 1SXJB 4KFRA 3I73A 3BB1A 4N3NA 4LHVA 721PA 1GRQA 2WWIA 3GFOA 4LX0A 4TQ9A 2FMXA 1E2GA 1RIFA 2JJ8A 1E2KA 4AYWA 1FUKA 3CO5A 3KL4A 4HYYA 2AKYA 3TSOA 4K46A 1CJVC 3DL0A 3ZIAA 2WSSD 4JBXA 4JBWA 3LD9A 521PA 3NTUA 2C98A 1GDDA 1HT2E 1Z0IA 4B6EA 3ZQ6A 1NG1A 3LWNA 3RDPA 2VHCA 2OCAA 3DKVA 1GTVA 1R8QA 3DOEA 1ZIPA 4KHZA 4JL6A 2IXGA 1BOFA 3BB3A 4AKIA 3CNNA 3A6PC 2GK7A 5TVKA 2CCKA 4IRUB 2A5GA 4FCTA 4MYHA 5DSZA 5CB8A 5D3QA 4US1R 3CB4A 1UBFA 3ADKA 2BMEA 1NLZA 3A58B 3L8ZA 2PX3A 4G0NA 1G3MA 5KUTA 1M8PA 1R5NA 2W58A 4OK5A 1P2SA 2ZYTX 4QM7A 3MLEA 3ONWA 2GILA 3CF2A 1U8AA 1UJ2A 1E9FA 1S1MA 4DLSA 2IHYA 1RRPA 3B9QA 1FZQA 1TX4B 1M6NA 2FWRA 2IUSA 1FQJA 4L4UA 1OXXK 3SBEA 1KK2A 4DUGD 4EUNA 5TARA 1KDTA 2ZR0A 3PUYA 4A2WA 1ZUNB 1E4YA 4PAQA 2C5LA 3PR1A 1FQKA 2ODEA 3W8NA 3B1WA 1TTTA 4UJ5A 2ZYUX 4DLWA 4NTZA 1N2CE 3THWB 1QHXA 1YR9A 4QBIA 1X6VA 3BRWD 3K9HA 2R62A 2J41A 5JS7A 2WJIA 1II8B 1Z22A 2RGEA 2QPTA 2YHSA 1XCPA 2GETA 1JNYA 4URXR 1BMFD 4IVQA 1D2NA 3X1XA 1H8EA 5H68A 3ADCA 3FKSD 4CZ2A 1C9KA 2Q9AA 2QGZA 2HXSA 4D0LB 2J46A 3ICEA 2QRZA 1F2TA 2GKSA 1IAQA 1F2TB 2CCGA 4ZCMA 1EXMA 5JI3E 3FWYA 2WWFA 4TYQA 3AVXA 2JJ2A 4KBFA 2ZRGA 3LXRA 4KO8A 4NKRA 1J8YF 1P75A 3U2QA 4TT3D 3EWAA 4CF7A 1N0VC 5EP4A 4JLMA 2F43B 1G7TA 3QXXA 3LX5A 3WP0A 1LS1A 2D7CA 3A1WA 4G01B 1KGDA 3QPUA 1KI6A 3BFKA 1G19A 4HLCA 4ASUA 1G1MA 3GLFE 3HR7A 3RANA 2CL6X 5CK5A 3TW4A 4ARZB 3AUYA 2AD1A 5KNDA 4B34A 3I8SA 2HJVA 4LYJA 3T35A 4XIGS 3SDZA 3NVAA 4D81A 3BORA 2RMKA 3K0CC 1Q22A 1CXZA 4TMWA 3I62A 2CDNA 1OHHA 1E2FA 2FFQA 2ZI6A 4D2IA 4MDFA 1ZU5A 1ZUIA 5FTJA 4B73A 5TB5A 4ILEA 2C95A 4IOLA 3IBYA 3VR3A 3CZPA 2YNMA 3G0HA 3OHMA 3MG9A 1E99A 3EPKA 2NPIA 2FFHA 4DBLC 3U7GA 3EC1A 5FOWA 5LB2A 4TMVA 3X1YA 4UXHA 4DEYA 3SHWA 4HDOB 1II0A 5B57C 2BM1A 2I3BA 2KBFA 1VMAA 2XNSA 2VP6A 4MKHA 2ZU0C 4MKGA 4OYHA 3GEEA 5IK2A 2OFWA 3AUXA 2GXUA 4UQOA 5DH9A 4A8JB 2ZRFA 1AKEA 1W0KD 2OBNA 2Q9CA 2J0VA 3QEJA 1E94E 3HWSA 2JLSA 1RYFA 1IN7A 4OI4A 2EW1A 2J59A 3ZDQA 1ZM7A 1KDPA 3IIKA 4GP6A 4A2QA 1QHNA 2FPLA 4PX9A 3VKGA 2GCOB 1G64A 4AC9A 1A7JA 3QOFA 4Z54A 4G3XA 5CJ2A 1Q20A 1KKMA 3KB1A 1ZP6A 5EQTA 2CEAA 3SYKA 3A1SA 4KSBA 2QT0A 1WF3A 2CVFA 1VECA 2FOLA 2Z4RA 4A4DA 4UNRA 5JLJA 1GVNB 4Q02A 2W00A 1UKVY 3LQQA 3DEFA 1UDXA 1WBBA 1IJEA 1US8A 2GEDA 3BBPA 5JEEA 4EIWA 2FF7A 2V9PA 1F2UB 3T5DA 3BOSA 1HY3A 2VP5A 1ZCBA 1PJRA 2JIZD 3E1SA 1R5OA 4IXMA 2EWWA 5ANRB 2OCBA 5E3HA 3QF4A 3BJIC 2DWOA 1MR3F 4URZR 4NDZA 4PSKA 4PQYA 1MO3A 4LJ6A 4IOJA 2XTMA 5IDVA 2C77A 1NN1A 5FFMA 2EFCB 5BXQC 1JALA 4Q1DA 2E87A 2GVDC 1GILA 2EFGA 2XX3A 4PC2A 4HSEA 3W5IA 4C0QC 3NWJA 1W2HA 4B2PA 4Q9JA 5EP1A 2N1BA 4PC1A 2Z0MA 4D0NA 1S0UA 2E1RA 5A0FA 3DM5A 2VRWA 3AVQA 1A2BA 2MSEB 1W5TA 2H92A 3TSZA 3TSWA 2D2EA 1ZU4A 2IF2A 4W5WA 4DSNA 2BWJA 2ZRMA 4GMDA 1OH5A 2HXYA 1AJEA 1E9CA 5AR1A 2GZDA 4D80A 3AF2A 4B43A 4PFSA 3DKPA 4E03A 3CPHA 1L7VC 2AD5A 3K0AB 4D4LA 4PZLA 1IN5A 2YINC 3MWYW 3PFIA 4V02A 2OCYC 1I4DD 3LDAA 3B6EA 3GLHA 3IBGA 4U00A 4B47A 4WXPA 4DLTA 5KSOA 3U44B 3B60A 3PXGA 2V4ZA 2J3EA 4B2LA 2WWHA 3Q85A 4AD8A 4QBFA 4TLCA 1G7SA 4YQFA 1EFCA 1EWRA 4RD2A 5J4VA 1N5LA 4X8MA 4HAUA 4ZKDA 5HPYB 3LBNA 3AVOA 2OESA 1JQJC 2BJVA 3PG5A 3AGQA 4I81A 5FUYA 1WE2A 4MA4A 1XPOA 2QBYA 4GOJA 3RABA 2QAGC 5FBVB 2CHQA 1Q1BA 2JGNA 5KPDA 1XTSA 4CEHB 1L4UA 4YMTA 3Q7PA 1DTSA 3IHLA 5EE3A 3GLFA 3B78A 2EVWX 1R6BX 5FOTA 1E2QA 4G5RA 3AVYA 2WJHA 1SZPA 1KSGA 1WXQA 4DLXA 3FFAA 1N6KA 2ZI5A 2VHUA 1LF5A 3WY9A 1R0WA 4Q18A 2C9OA 2GDJA
chains in the Genus database with same CATH superfamily
1Z8FA 3KJFA 1BIFA 3EC2A 1M1XB 3O31A 1WULS 2FPIA 1K88A 1N9ZA 2B2NA 3G2MA 4HDKB 5DLPA 4DLRA 4M87A 1XCGB 3HB1A 3OAAD 1YC5A 1I80A 5DASA 5BT9A 2IH2A 1GKKA 1I1QB 2PKQO 1F8FA 2B0JA 1EDOA 2Q7OE 3LK6A 1E1RD 3OEHA 3GIWA 5CFNA 3GHHA 5HQ3B 5ENVA 3HJTA 1KYQA 3D6HA 4ZCLA 3LK7A 1USWA 4TWZA 2ZB7A 4F6RA 3DYIA 4BMOB 1CFJA 3M6IA 1D4OA 3PUJA 1OLSA 3JD3A 3HE3A 3B6IA 4PHFA 5F9FA 1DE0A 1JE1A 1NHGA 1YONA 2WHEA 4NFHA 2BEKA 1JZQA 4D3XA 2R5FA 3MC1A 4MR9B 2E4AA 1WXIA 3I72A 4MRSA 3FLEA 3A2MA 3LC1O 3LNCA 3DEJA 4GXRA 1CY8A 3WGOA 1TK3A 1YL7A 3AF3A 3OT1B 3O38A 3PD7A 4FGSA 3UHPA 5CCXA 1H94A 2V7UA 4OGGA 5TVGA 5BW5A 3GLIA 1XC7A 3DKIA 1QHYA 1ZGGA 4Q12A 5IMBA 5IX8A 1M6VB 2GPAA 1JR2A 5MGBA 2OZLA 5BSVA 2IL1A 4IJUA 4TL6A 3RUDA 3LQ1A 3NYQA 1NVVR 4RWEA 5K4GA 1C7EA 1IWOA 3G2KA 3KKEA 4FNMA 4COKA 1JBEA 3K4HA 5GMOA 4WOJA 5EZ5A 3RIHA 3WGNA 3DZDA 5JNSA 1S2GA 2P5SA 3KAQA 4K8RB 1B0UA 1P4SA 3JQQA 3VI3B 1H1TA 3CNOA 2IHBA 2XB6A 5T3UA 3RJTA 1Z5UA 4DIKA 4V3BA 2W2LD 4JJ7A 2NUBA 5CJPA 3R5JA 2D2XA 4ZXPA 3M2PA 4M8SA 3FHCB 4DUPA 4YJFB 3FUUA 3CE6A 3CVYA 3WJ1A 5KYUB 3WSTA 4CKBB 5EIXA 3ADPA 3FIUA 2P8JA 1SOMA 2EJTA 4FR5A 1QNLA 3CQ9A 5AOVA 5IC5A 3VR1A 3GPCA 4JLBA 1ECLA 3COZA 1NI5A 1L1QA 2HPZA 3Q7SA 1U7PA 2BKUA 4XGRA 3RE1A 2RKOA 1DBRA 2O2DA 3R9WA 1SK9A 2WUVA 5C8YA 5EXSA 1Z47A 5JVDF 5UKDA 2FZEA 4G5GA 4IOKA 4WZAA 1ZL2A 1Y1PA 3OU6A 2WVGA 1RCFA 4G0YA 4HADA 3MRSA 5TMDA 4R2IA 2C4TA 4GMKA 4C7BA 5U9CA 4E2XA 2X5JO 4W9MC 4S0ZA 1ORHA 5IBRA 3N2NA 3QA3E 3B1FA 4Z8XA 1LC0A 5FOSA 1AQJA 1I8TA 4MUJA 2IFTA 3JV7A 3OJWA 4Q5IA 4RZIA 1QB8A 2WK1A 1CNMA 2D1RA 2FQXA 3IP5A 3WZ2A 4CM8B 1RMTA 1EVZA 2P5YA 5CDTA 5JYEA 1ZWLA 2J30A 1E2JA 1UFRA 4QUGA 4AFNA 4YONB 1MZVA 4BUJA 5IASA 2RH5A 4PZEA 4B3IA 3WAJA 1WB6A 1IN8A 2JW5A 2XPCA 2DP4E 1G20B 4FZ5A 1DBPA 1HYEA 3AZPA 3QU9A 1Y1SA 3LO5A 4KUGA 4CKWA 2PUAA 2G1JA 3OZFA 4PSDA 2W70A 2VKTA 3FSEA 3KJGA 5E6UA 4RXTA 3R7BA 1OCEA 2PMWB 3KFXA 4IRMA 4N6GA 4OL0A 4UD2A 5FBWB 4EFLA 1W85B 4G8DA 3OCYA 2QY9A 4QBGB 5E3IA 4PLPA 1AURA 4J0GA 4PXSA 3NOQA 4HAOA 1MOZA 1G8FA 2MIIA 3H6GA 3STTA 2J31A 5BUQA 1YAJA 1QO9A 3VV2A 2PGOA 4DSTA 1EESA 5DHTA 1EPUA 3MA0A 3KE9A 1M1YE 2HO4A 3DMFA 3I1YA 4IYRA 4AK9A 1TQ6A 2BFWA 3MCZA 5KYUA 2C2YA 5TGDA 5JZOA 4E7OA 2O9JA 4GGPA 3WIUA 2NACA 2OK8A 3VHXB 2ERXA 2CLOB 2G06A 2XUJA 1RLUA 1N2CB 1QO7A 2ZCUA 2I22A 2PZFA 4KQJA 3KDAA 3TLGB 2CMDA 5KVSA 3P0JA 1QYWA 1W88B 1T2EA 3JZDA 3DF9A 3L84A 2RHRA 2AFHB 3N2GA 1T9KA 1W76A 1LA2A 5BQ3A 5FA5A 1N4AA 1M1YB 1Q0TA 2Z1MA 1U7HA 2VEDA 3LT1A 1JHVA 2WU3A 4M46A 5BSFA 5KYNA 1RJWA 1UH5A 4BNKA 4AJ1A 1Z0FA 3WKDA 1PT5A 3L0YA 4OHXA 1QE0A 3C6ZA 1IJFA 1FUYB 3S4YA 4JJ8A 4JI6B 3E48A 2E21A 2Z4SA 3GZTB 4RACA 4YGYA 1E5XA 2W8BB 3SS8A 3WMWA 3C85A 1YOBA 2YXBA 3GBSA 5F64A 2BM0A 5HJ2A 1SXPA 1C1XA 3TZEA 1N5DA 4XQGA 3S1AA 1N1DA 4ZJUA 2YWXA 3HJFA 3BL6A 4EHDA 4TYYA 1YFJA 3JQAD 1E58A 1RXIA 1SPXA 1UBOS 3B85A 1ZXBA 1XHLA 4JQZA 3RF6A 4DWWA 4NFSA 4P7JA 3T1OA 3F0TA 4GL4A 4UTZA 4YAIA 2BGGA 4BGEA 2QE7A 4C7OB 3D1JA 1KYTA 1VPEA 3EEFA 1W85A 3TTSA 1F2UA 3AZQA 4DDHA 3RT7A 1KI1A 2CBGA 2AI1A 4OQNA 2D1QA 4TTTS 3D3EA 2A3NA 4U7PB 3LPNA 3ZE2B 5H82A 4CEJA 1VSUA 3U7RA 3BIOA 1ZRNA 3NIDB 5IT4A 2HV8A 3NDBB 3L6OO 4KIFA 3WB2A 2F1KA 3LXMA 4CLRB 4PC7A 4YUZA 1WQ4A 1AO0A 2H4ZA 2R00C 2A3RA 4U7FA 4H7EA 4C6TA 1CR2A 1F0NA 2O7VA 2ZRHA 3NGMA 3TQQA 1N2CA 4RVHA 3V1TC 5FDFA 4CTOA 3M5DA 1ZVJA 5EKUA 4JUFA 4HQ0A 1RXYA 1Z4LA 3KUKA 4FD3A 4W5JA 1JEJA 1XLUA 2JI7A 2QG6A 5IDQA 2G77B 3WRVA 3F49S 4EO9A 1IOVA 2CNLA 3DTVA 1RXVA 3BBLA 5K3OA 1QQBA 1Z7WA 2AC2A 2BN4A 3IV9A 4YCMA 2UZ4A 2H5LA 4OYRA 1Y9EA 1D9XA 2JI6A 3LVRE 1S1CA 2JHPA 3A7DA 3EA0A 2ZAOA 3LO8A 3SXUA 5L8VA 4EG4A 3SHVA 2C8JA 3ZY6A 2PLRA 4ZCQA 5I3CA 3LX8A 2AEJA 3SN6A 4A2CA 1U28C 4TTRA 1ORDA 5I7RA 4YJ3A 1E7MA 1VCIA 1E6CA 1T43A 4C3OB 3ZUPA 3IQFA 2HA5A 1VL0A 2GYVA 2WSMA 3OUZA 1DXHA 4M1ZA 2I87A 4OPMA 4BVBA 3M5CA 4YWJA 3RSQA 5LP1A 5F76A 1RHUA 1C81A 1XVTA 3QUAA 3U0BA 4J75A 4D82A 2Q41A 3WLKX 4QKQA 3D1LA 5HIKA 2G1AA 4JBHA 3DV2A 4MYUA 3T3OA 1XEAA 3ZKAA 4FDAA 1YE8A 3BXZA 1PTKA 1F6BA 4YP9A 2OK7A 2GR9A 1XZKA 3VAZA 3VTAA 1CC1S 3Q2IA 4JR0A 4HMQA 1EVQA 1VGVA 1T0BA 2DT5A 5EZYA 1ZH6A 1POXA 2OORC 4RFVA 4Q21A 3SR4A 4E3ZA 1HDCA 1BWQA 1JBQA 2AWOA 3M6AA 4ZWNA 4DNQA 4K28A 3VYSB 1PDVA 2P9ZA 4MPRA 4EHFA 1UKEA 5D2CA 4J76A 4ZAVA 1C7ZA 1VOTA 4CMEC 4GUAA 2OXCA 3L46A 3U49A 2YVAA 4C08A 5JTUA 3TQTA 2W4MA 1G17A 1F38A 1P7CA 3T94A 4UU7A 5JSKA 4C2AA 1IZ7A 4GF5A 4D98A 4F3CA 3FOZA 2HCTA 2Y6VA 5FTMA 3X1JA 2RGBA 3LQ4A 4LYEA 4BZPA 1Q74A 3UN1A 5HOQA 5IU6A 1W7AA 3TDNA 1FL9A 3FOAA 1J8DA 1OAOA 2ES4A 3O74A 4GEKA 2GA9A 4X44A 3RV3A 5B58C 3CCFA 2PKXA 4XM0A 1I5RA 2AOUA 5GONB 2HY7A 2AYZA 1TCUA 5INTA 1WAMA 3OKFA 3BXXA 1BHJA 1HRKA 4D46A 1YZHA 2H3HA 3FM9A 3CW8X 1F48A 4R7GA 4RENA 3QWBA 2GEKA 1XKXA 2NPOA 4L3WA 1USUA 2VWGA 1A9XA 3SR0A 3V2HA 3TDMA 3JATA 5HTOA 1YUMA 1V7QA 1HDZA 3AOGA 1VZ2A 1RWQA 2UZ1A 3IEPA 4JD5A 3CBQA 3RSOA 3WHKA 2GAJA 2VK4A 5HZGA 4O3MA 1DRJA 1SAYA 3QKWA 2QRUA 1L5VA 3C5HA 4P0QB 2BEUA 1K75A 2ZYWX 3FHTA 2BP7B 4G5YA 4GZ5A 3E03A 2FPUA 3BVPA 2J9XB 2OO5A 1GUAA 2M98A 3OWXA 3G6KA 4GPEA 5ENDA 5FBLB 3QKSA 4DLNA 1JSZA 4EPRA 3ZNQA 4CM9D 4Q9AA 4X6XA 2EZUA 1UJBA 1FMFA 5BR8B 4NU6A 5LA6F 2A5YB 4KDRA 3RRXA 4C4SA 4D96A 2BTQA 4DIDA 3Q0EA 1FB5A 1VYVA 3QOYA 4K9DA 5ALPA 4JC5A 2QUJA 3RUIA 3OIFA 1P2VA 2GVZC 4RKQA 1WBJB 4LN1A 1P2GA 5CD1A 5E4YA 4LE2A 3OZWA 4YV7A 2FUNB 4RA9A 1XG5A 4EA8A 1UBCA 4U4AA 1XQ9A 1JIKA 3RSSA 4NVRA 4ZYVA 3O7MA 2Y92A 1UANA 1Q2UA 3C7TA 1JSLA 4K88A 1H6CA 3ODGA 1JMVA 4NH0A 1W36B 1ENYA 3I76A 4PV7A 4H0NA 1RKXA 4D1YA 5EHXA 3BWVA 1C7IA 3OC6A 2AS0A 2GUGA 3GRCA 6ABPA 1ANKA 1ISMA 5IM4A 1NRWA 2YN4A 2FCAA 1B15A 3MHTA 2QLTA 1UAYA 1KORA 4GSLA 4R6XA 3PQDA 5LP6C 2IWHA 1GRRA 2X4IA 1QDUA 5KQSA 1XKQA 1UXIA 2ZROA 5EJ7A 3HVRA 4BV9A 1G5QA 2MINB 1G16A 3AM4A 1PJQA 4MW6A 1QFSA 3KAJA 1MNAA 4FCVA 1X9IA 4HFJA 5EQFA 3HA3A 3T12A 2FK7A 1TU4A 1U3FA 2G71A 1B8UA 3A14A 4Q7JB 4CW7A 2AZXA 3CX4A 3RUFA 5AVTA 2J5BA 4GLJA 4GXQA 2VKQA 3DDWA 1Q1EA 5HR5A 3ILHA 1QIMA 2CUNA 4WKPA 5A9TA 3HSSA 2J67A 4ALNA 4URWR 1LDYA 2I62A 4P5PA 2W6QA 2WIKA 3FJ1A 1HYQA 3DDOA 2XKAA 2WIDA 4LBYA 4HQ6A 5LBTA 4D4IA 4Q1VA 1FJGB 1HM5A 3PKJA 4RK4A 1Z33A 1YR6A 1TA9A 1ELOA 3BCUA 3IAS1 2KYRA 3ML1A 3OM9A 3GD7A 3QVVA 5TPZA 2JKVA 5LUBA 1B2RA 2ASEA 2NPFA 5DIZA 3T9FA 2F3UA 3QPCA 1X15A 1JDTA 4IKEA 4IILA 4ZO4A 4L3VA 4G6ZA 3AEZA 3EODA 1AA9A 1YB6A 4B9EA 2J09A 4KODA 4IEFB 5FPKA 2V1XA 3PRJA 4A5OA 4RXUA 3L92A 4G86A 4CF4A 3OE1A 2QTFA 4LGMA 4E11A 1NW6A 4H6PA 2HSDA 3PWSA 1ZLYA 3E7PA 2ORYA 1GIAA 4KB5A 4UHEA 4UBOA 4B3SB 4MWZA 2OTCA 3KSZO 3F8SA 4YECA 4UM9B 4IXTA 4RZ2A 1L7NA 2FRDA 4LSZA 1PVDA 4YMSA 1FFDA 3IFSA 3K70B 2WIJA 3LV8A 1IWBB 4MICA 1NURA 3R3WA 4N0EA 2O5CA 1H4QA 1J9EA 4ID3A 4GP7A 3RI3A 3ZWNA 4P86A 1WG8A 4QJ5A 5K0EA 2GFQA 1KZ1A 3FMGA 4H7KA 3PJDA 2BRUA 1U8ZA 1SVWA 4BMXA 1CZHA 1Y82A 2CB9A 3DGEC 2LDBA 2HLDD 3VR2A 4NU0A 3LF2A 5K7SA 3FYDA 1YZNA 1LI4A 3E82A 5KBYA 3I39X 4LK3A 4TKVB 1Q6ZA 5DHAA 3O9ZA 4J2OA 2GXAA 5HK9A 1YZLA 5FBQB 1N2OA 4Q9LA 1V5GA 2IU6A 2YXNA 3PFNA 5C7LO 2X5NA 2PBZA 1M9NA 3HCWA 1UEXC 5SY9A 4PVCA 2HPVA 3VOTA 3OU7A 3C7CB 1VKNA 1PJSA 1MRNA 4QXOA 4KQEA 4L08A 2WJAA 1GTZA 1N6LA 3I9V1 4P7BA 4FFVA 4R0VA 3T5TA 2MSCB 1E20A 3C4JA 2I8LA 3O4HA 4HHEA 4CQMD 4RY9A 4RK0A 1C3OB 1WWKA 2WNIA 4IEEA 1F2DA 1ZCAA 1IEQA 3H13A 2CLEB 1GTSA 1NDQA 3PT5A 4LWOA 4US2R 3F90A 1JB1A 2OFOA 4US0R 4H0CA 2H2FA 5AKGA 2AYYA 1F8GA 3UENA 4C9BA 1LQTA 1ORIA 1IRXA 3A7EA 1QK3A 4OLAA 4V0NA 5AVSA 1S2IA 2HYIC 5C3UA 2CXOA 2F9FA 4TX1A 5AJWA 3E9YA 4CQMA 3QU4A 2BUBA 5E95A 2H1RA 1M5TA 2XTNA 3EIXA 1L1RA 4ENRA 3DLHA 2I33A 4G25A 1NFRA 3NHRA 4CQMB 4NHEA 3ZGZA 1NJ5A 4XWAA 4I5EA 4U7JA 3VNUA 4O08A 3EGXA 4XRGA 1JS1X 4G8BA 1LBTA 3WHIA 3WWCA 5J2UF 3RVKA 3URKA 3QVOA 4Y2PA 1P8JA 5CA0F 3PYXA 5IJ0A 3K9NA 1Z6QA 4LQDA 1HT1E 4ZHQB 3UICA 3KZMA 4YX9A 4L9RA 3U4QA 1J25A 1BFDA 1ISGA 1HT3A 2PJUA 4Q4HA 3W4JA 221PA 3LW7A 4WL0A 1IN4A 1UZNA 4ZV4A 3D8BA 3P9KA 2GDZA 2WHXA 2XA9A 1M0TA 1FDWA 2PPLA 5ALVA 2CHUA 2F7SA 1U0TA 2B0CA 3QELB 1BWRA 2YY5A 4BMSA 2JFYA 3TGWA 5KVCA 4P0TA 3KKLA 4UTXA 1TUEA 1V8FA 3Q7RA 4EJ0A 1OXSC 1KJ9A 1NSFA 1K1EA 2H85A 3GUCA 3Q8WA 4R8SA 2P62A 3OZGA 1NT4A 2PL3A 3L7CA 4DQUA 2HLNA 3P9ZA 3PNKA 4KFCA 3G5LA 3QM1A 3LQKA 3L7MA 2DTEA 4CNBA 1I3CA 4OJQA 2H57A 2AJLI 4RK5A 1HLGA 5H80A 2PGDA 5HDQA 2ONZA 2Z9DA 4RMIA 4MVXA 4RGQA 5K0TA 2IYPA 1RZVA 3ORQA 3UB4A 1O97D 2LGJA 2GWHA 3KWJA 2YZGA 3MWKA 4QQ8A 4H7FA 1DBIA 5AHOA 1NUPA 2OV3A 3RNLA 2Q49A 2PU7A 1LPAB 2I3ZA 5B5SA 3ZHRA 4E2ZA 1PK8A 2X7XA 1GCOA 4PC6A 3PV0A 4BDSA 1NUTA 1RHQA 4XEHA 2C4WA 2GK6A 1MC8A 2GTIA 2KWIA 2WW8A 3KQVA 5DX0A 4BMPB 1JR6A 4ZAYA 1YB5A 2XECA 2NNWB 5SYAA 2F67A 5LD2C 3SP1A 4Q3AA 3KQHA 4L9AA 2FSFA 4GXTA 4MYSA 4MWBA 7AT1A 4Q1BA 3R8CA 2IYEA 1JZTA 1UDWA 4TWBA 2B5OA 4Q9HA 4CKXA 4ESVA 4ARCA 1XDUA 2PXXA 1NOIA 3TNDA 2DEUA 2GZ1A 1YS2X 2AYXA 1ZIYA 1V45E 4KE6A 2QMZA 3O1LA 4Q48A 4QDZA 4RORA 4A16A 4D9MA 4YRNA 4NCJA 4ZEMA 2ODAA 4ZI3A 3BJMA 4Q4HB 2VF8A 4M1OA 1V5WA 3ZLBA 5JAHA 1I0IA 2DOKA 1N9KA 2VBGA 4OHCA 4R9UC 1AKMA 4CM4B 3ETLA 3O4JA 3P0IA 2PH7A 3DOJA 4E4RA 5KNDH 3PQ5A 3A6FA 1JPNA 4K9RA 4RTSA 3O21A 2GERA 4AICA 1JG4A 4WXRA 1P6XA 2WP8J 3CF6R 3R5KA 1Z15A 2QUAA 2PH1A 1NXXA 4PC3A 4R40A 3RV4A 2PSSA 1N2JA 2AG8A 5AW1A 1X14A 1ZJ4A 4YAJA 1OLOA 5ALRA 1NSTA 1NVXQ 2C58A 3AB3A 3KSMA 2WIBA 3HBMA 3FIJA 3PNOA 4LHSA 4FJ2A 2D00A 3K1AB 3N8GA 3P5SA 2PZEA 4WRRA 3RJZA 3N3AC 1KXJA 4YRBA 1DWQA 4H3SA 4CWAA 4DM7A 4ONEA 3L6CA 4Q15A 1FCJA 4WESB 3LCJA 4J0HA 2OBLA 5CA1F 3GGJA 3FMFA 4HNRA 1N2IA 1H8HA 3AUKA 3B13B 4XOUA 2ZSKA 4AVYA 7MDHA 4ESOA 2RI6A 1OA1A 3JPYA 1UC9A 1HQCA 4HZUA 3RFVA 5BW4A 4R51A 2HZBA 3K9QO 4MS1B 1CBUA 4PYQA 3SHTA 3VTZA 1P2UA 2B78A 3KRTA 5T6BA 3HWRA 5AK6A 2ZRIA 4KBYA 4D8WA 1EAYA 1Z28A 2UVDA 2VDPB 3A9TA 4N54A 3C3BA 3BSWA 1VTKA 1AMOA 1U0JA 4M88A 4KU4A 4RQAA 1JEAA 1QHEA 2ZSHA 3ZCSA 5HZKA 5KTOA 3DE1X 4X8LA 3N59A 1BAPA 3CF0A 4RMNA 1H2XA 4L7QA 5MF6A 1VIVA 3DCJA 4WZAE 5YASA 8GPBA 2EXXA 4AURA 1QH8B 3P2JA 1PV1A 1QE3A 3QPDA 3IEMA 2Q3MA 2FQYA 3QE2A 1V95A 2VF5X 4FZRA 4ZT3A 5BVGB 1OVMA 2FEWB 1UJCA 2C4VA 3ANNA 3MERA 1HE1C 4FYXA 4QXQA 4R4JA 1P1RA 1G41A 4JLUA 1JU4A 3OOSA 3WGGA 3G8CA 4BVJA 3DW1X 1JV2B 2GBGA 3ZS8A 3JASB 2BM9A 2WJ3A 3DC2A 5LQMA 2XKBA 3FUTA 4YUXA 3LT0A 1L5YA 2YJ6A 3DLPX 4KVFA 3WISA 2J8ZA 2K7ZA 2PS3A 3EXHB 3EQ9A 1PQYA 2AFIA 2XRYA 2EHJA 1XCMA 3LUCA 4N40A 3RC7A 2Y0CA 3PIDA 2PT6A 5AW8A 1J0BA 5KNCA 1XTPA 2FR0A 5ITZA 5CNJA 1KDVA 1KNXA 4A82A 1Y4SA 2ZBDA 4KTVE 3UW1A 1FVFA 1GNTA 2NZVG 1NAHA 4E4YA 5DNVA 2AKEA 4UHBA 1KEPA 1JFVA 1QHFA 1T6BY 3BKWA 3SHQA 4XYEA 4AKTA 2W6IA 3HGTA 2WYVA 3I2FA 3V48A 4NBWA 2B9VA 3OE7D 2B34A 1N2XA 2Z5GA 4NDNE 2ADOA 3WZLA 1TNDA 5GJWC 1CUIA 3P26A 4M0PA 3VU9B 3I8XA 3T8YA 3IQXA 5FD8A 4NRDA 3WK8A 3LLMA 2V5VA 5ALTA 2V65A 3PDIB 2G5TA 3HUUA 3LUJA 3SYLA 2DAPA 3PNSA 4DARA 2WJYA 3EXIA 1AQYA 1SKAA 2I1VB 1YACA 5IFLA 3H5TA 2GT1A 5LA6B 5B7QA 1V9LA 5E38A 4C1NA 4QJBA 3EUFA 1X74A 3JQFC 5GIOE 1QG2A 2GZAA 5HXAA 4BMDA 1Z7EA 2Z98A 3WYNA 3QWIA 4F06A 4I5DA 1YGPA 1LD3A 5FUWA 4I4NA 2L2QA 2X4GA 4H1TA 1IK6A 4EPTA 1L8XA 2FP4A 2MYPA 1TE2A 1TL7C 1YJAA 3ESDA 3Q9SA 4J1TC 4PU0A 2J07A 4BMZA 3OZBA 1ZX1A 1ZCFA 4YHBA 3AFIA 2GPSA 4KQIA 2JGRA 4LJ9A 4CR6A 3VVBA 1A97A 1EX9A 2FWPA 4NOMA 3BK1A 1H05A 2ATXA 3ZCXA 3RS3A 3BHIA 5DYNA 2BKAA 1HE8B 2CY0A 4B7XA 5D3MA 4EHIA 4JDUA 1BDHA 4G81A 1QV6A 3HJBA 2NN3C 4PZPA 4YCBA 4BFXA 4OHPA 4DABA 1T2DA 4UD6A 1XAJA 3JQGB 1PL8A 4XFDA 1XJ0A 1KEUA 1UBLS 1UQUA 1Y9JA 4S12A 2JCBA 2XMDA 3RH0A 3O4FA 1QQ6A 4FYJA 3LDGA 5AT1A 1MO5A 2IBSA 2DZDA 4C2UA 1U2DA 2A0UA 3KB2A 3W3AH 3FFWA 9LDTA 3GVIA 5DTEA 5JANA 5CX4A 3KXKA 1FYFA 3T7DA 3R3YA 1CE8A 1ZUHA 3U9LA 3FPAA 3OQ6A 5CH3A 1PWYE 1G20A 4OI2A 5AOCA 4NMLA 4B8YA 2R6CA 2Y9MB 1E7YA 1OFHA 3TLBA 2NQTA 5IAOA 5LLTA 1ND5A 2QSYA 3I37X 3FNIA 2LCQA 1JDSA 1L4YA 3PQEA 3OQMA 1ZISA 5CLFA 4PINA 3O2NA 4JHLA 4PGHA 1QIDA 4QSMA 5K8LA 5DMXA 4RE5A 3T9BA 3ESQA 4DT1A 3W0LB 4YCSA 5CT4A 4F3NA 2XMBA 3AOEC 9ATCA 1VIAA 4DY4A 1GA6A 1RPNA 1A9ZA 2V7EA 5HK8A 4BN5A 3EY4A 3QI2A 5IS2A 3U37A 5CBPA 1KEEB 5ESDA 2IZ7A 5LQJA 1O97C 1ZMOA 3GT4A 1Z8NA 3QG1A 3S2IA 1U90A 5T4HA 5KQRA 3JVIA 3FD8A 4FMDF 5EUMA 4LKRA 5KTPA 3L3BA 4AS1A 1E4VA 4KLRA 5AXDA 1MP0A 4Q4JA 1MFPA 4DW8A 2IVFA 5CLIA 2FQ1A 3L7IA 4O2BA 3AR2A 1U8CB 2P90A 1I2DA 3T61A 5E2AA 2YXDA 1MVOA 3B2EA 1ISPA 1CHDA 2ADMA 3Q4GA 3P4XA 2PQ2A 1SUEA 3EXFA 2MYUA 1SKQA 3GLKA 3B6JA 3ICQB 4RMJA 1KC3A 2Y1LA 2YIDA 1HE4A 1F60A 2K5UA 1OTYA 2GYUA 5CIQA 1MPTA 2QN2A 4XJSA 1EWVA 2NW6A 3C6KA 3DZJA 1AB6A 1LSUA 5BNTA 1JJFA 2QRJA 1TVMA 3CMCO 1EP2B 3KJXA 4GBMA 1UJ5A 4MDEA 4CMKA 4PXAA 5TJHA 3RVQA 1E98A 1AQNA 2WZCA 2JAXA 2Q3CA 1S9DA 3ZJTA 1VBFA 1Y9AA 3MB8A 3CVVA 3ST7A 2GK3A 4BNVA 2ZWOA 3F8WA 3QXSA 2P5TB 1RQNA 1ZH4A 4O1MA 3SBOA 5DYIA 2QR5A 1QBGA 1D7AA 1CZOA 1HZZA 3HA5A 4WVLA 3K9CA 2BE9A 2GESA 2H11A 1U9YA 3HCAA 2G4CA 5FHQA 3SE0A 3MWFA 3CR3C 4HB3A 5G1PA 1VFNA 5C81A 2IOQA 2DKFA 4EGSA 1UPTA 1V11B 1EVLA 3MQ2A 4PYLA 1BSVA 1KZ6A 2IKQA 2J3IA 2AZMA 1F1BA 3JWJA 1BXGB 4K6GA 3N75A 4W5HA 4H59A 1NVTA 2W0SA 4C7MA 3J81k 1QP7A 4E6EA 1LBEA 4BO1A 1YZKA 1TIBA 3F6SA 4CT4B 4C20A 2CL0X 5CVJA 5IKXA 4UMDA 1TEXA 1I9GA 4IX1A 1TUBA 3N7AA 4L76A 4MKXA 1KS2A 4X45A 4G0UA 4I5FA 1EUYA 4D42A 1KNQA 2XMSA 2G9RA 4IIEA 2JLWA 4QGGA 1E1CB 4YAKA 1ODLA 3JVEA 3M33A 4W8OA 3CW9A 4GOXA 3ZW9A 3U09A 1WTCA 4NIMA 3QYFA 3N8IA 1R12A 4GOKA 4K86A 5F7JA 4B4UA 4R3UC 1XQYA 1NLMA 1T8UA 2NYVA 1ZNXA 3L7YA 3BMXA 3QVUA 5JU6A 3NHKA 3ANXA 3VYWA 2Q9BA 3I34X 1B6GA 1JQBA 4GBGA 2A59A 3CXUA 2VHQA 3T7IA 3I6ZA 3JZFA 4LTMA 3K9LA 4RABA 3WNCA 1XTQA 4AXXA 3X1ZA 3TVTA 2B92A 4JX9A 3TLXA 2I03A 4NAVA 4BVLA 3WGHA 2BHRA 5IAGA 2R66A 3AO0B 5JQWA 2YMPA 4Y2QA 1KK1A 4IDNA 4JOBA 2JDIA 3OCZA 3LUAA 5CPFA 4EBBA 3F9CA 3M2TA 4YAWA 1UPXA 1I14A 1OAAA 3PWZA 3ZU6A 3LECA 1QQTA 2WQ7A 1TAUA 3AEKA 4BFUA 2UZ1B 2JAQA 1EK0A 1KEZA 1IEXA 5EY5B 3U7EB 3ZHYA 1T2UA 3D8TA 1AZTA 3ZY2A 5AW7A 2YVUA 4GLLA 3S99A 3WFZA 3QPAA 3I5YA 2CMKA 4NV3A 5AVOA 3WRXC 4PNEA 4JP1A 1Q0QA 3D7NA 4NMXB 5B3LA 1WP9A 1K27A 5CFLA 2B1IA 1XEWX 2JFPA 3FVQA 1VPTA 1M67A 3FYUB 1Q3KA 3MOSA 5FH9A 2GX6A 2GH1A 1B8OA 3AR5A 3DVSX 1LY1A 4DIMA 1BS2A 4MPJA 5GVSA 3QF7A 3W5JA 1PFKA 4PR0A 4F1KA 3LIIA 1XMVA 3ZWQA 2YHIB 2QMEA 1MVNA 1QIKA 3JYHA 1LLCA 4NJMB 2VTBA 3PJRA 3KVYA 3L5OA 4V03A 1SN7A 3QG5A 1GNVA 3CFYA 1C2YA 1W9MA 3PENA 1BJRE 1QC5A 1FDTA 5KHOC 4TMFA 3BTVA 1VPLA 2J6BA 4YRIA 3WQHA 2BC9A 3JYNA 3A1TA 2IX3A 3GOQA 2YVLA 2P9CA 1Y33E 2I1LA 2YN0A 1BE8A 2EERA 2VSYA 2VZ9A 3QKRA 4LDQA 1U11A 5A03A 5JAIA 2CV0A 3EBLA 2ONYA 2IUFA 3HZRA 1W75A 1Z2DA 3DMDA 1K68A 2I6GA 2W2NA 4JJFA 2Q28A 3RHTA 2XA1A 2NOAA 2PQ6A 4CLOA 5KYKA 1RRCA 4JI0B 3QTBA 1OT5A 1KQOA 4Y6RA 5ECDA 3PRKE 2PT9A 5E4JA 1XZ8A 1MO6A 3LZ6A 4B75A 2F1JA 3GN1A 2DBQA 4L74A 4IOMA 3UOAB 5A3JA 1XO1A 3B2NA 4TN1A 1FXUA 4DWJA 4L16A 2XCLA 3QRWA 1M34E 1GFSA 4MCHA 3TD9A 3I9FA 4R9VA 1IYZA 1NYTA 3KEFA 5AM1A 3ZHSA 3KKPA 4IFIA 1EQAA 1K7YA 2ZUVA 4EY6A 1UWCA 3BD7A 2ACKA 4W7SA 2BFCB 1E9EA 3H87A 1E8MA 1DQYA 1TMYA 2IYFA 3FYCA 4UOQA 4KAXA 3EJWA 4GZMA 1T4BA 5J9FA 4H3VA 3Q72A 2SCUB 2HDOA 3K1ZA 4Q66C 2CBZA 2YV3A 3FPGA 3A1DA 3Q40A 4YRTA 4YRJA 3W78A 1M6WA 4RPIA 3PL1A 621PA 3QSYA 1ECGA 4P5EA 3KKNA 3WYAA 5KDDA 1L5HB 1LSJA 2G1UA 2IYTA 2RGWA 3BMNA 3I04A 5TNXA 3ROPA 3TRIA 4CQLB 4U5QA 3MD0A 1CNFA 2BR3A 1II9A 2Z8YM 2WG0A 3M6VA 4ZXFA 3T7KA 4R8VA 4KRXA 1Q6YA 3UHJA 4G0MA 2J5KA 1YIDA 4GECA 4GRAA 4E13A 5AVVA 1WUYA 1U63A 3V6LA 3MT7A 3TPFA 3GZNB 4KLCA 1G21E 1KDZA 1G291 3ZNPA 2Q5EA 1WNTA 3VU0A 5CP8A 2BRUC 2TRSB 1AHPA 4B6PA 1K8XB 2PRYA 4JGBA 5E1BA 5C1BA 3RVSA 5KWSA 3B70A 3AJRA 1R88A 1P8AA 3F5SA 4WY5A 5BV1A 5F51A 3UF0A 3Q3VA 3QVJA 3HBNA 1SVIA 1J2TA 4GR9A 1CUJA 1KQPA 1YJ8A 5AKYA 2D54A 3D8NA 4YK7A 4XQ9A 2VZ8A 1BWPA 2D3TA 2IITA 1G9XA 4Y7CA 3ESYA 2V45A 4RGYA 4BB5A 1QFZA 4X1IB 1V5EA 5DM0A 4RHTA 3OCUA 4X95A 3MJEA 4OUDB 1N1EA 2YWHA 1ADFA 1MKYA 3AUJB 4LPSA 2BELA 4YRRA 1RQLA 1YKSA 3I09A 4JUDX 2ZTLA 4ZVPA 1U7WA 3LOUA 5LU8A 5EJAA 1BRTA 2B4TO 4TZ6A 1CRPA 2I66A 4JGIA 1LF0A 3IDSA 4JNCA 3LBIA 4ERNA 5JS6A 1H5UA 3SF0A 3AW9A 3U31A 4XWKA 1D3AA 4JB2A 2G0TA 5JPIA 3O8CA 4K6KA 4CDNA 1PS0A 2C5FA 3JWIA 3EGOA 2JJYA 2WWGA 3MEQA 2DWCA 4ENQA 2R6AA 3AXTA 5AI8A 4RF4A 5AVWA 1RQGA 2IZ6A 2REXB 1AKUA 3M0EA 1OFIA 6Q21A 3JZIA 3IHTA 4XYLA 3ZOKA 1EFRA 4G1VA 1YJXA 2DFLA 2IUTA 2ZI3A 5IVDA 2FKNA 3NBQA 2X0EA 1YRAA 2WAAA 3H5IA 3DNPA 4OQFA 4R2WA 4MEAA 4YRMA 3W9BA 5AI5A 2MSKA 1E0KA 1Z3CA 2E89A 3KPYA 3S70A 3MWEB 3PJGA 5EJ9A 1WCIA 4C7VA 1XLVA 3DAYA 2ORIA 3FVWA 3R6GA 4IQGA 4QZVA 2NVOA 2OBXA 4RLHA 4RH3A 1B26A 1RQ7A 1JDVA 2Z3VA 3TVDA 2IE8A 2F55A 1PR9A 4UMFA 1YZUA 3IH5A 5IDYA 4DMMA 3N0WA 1VJRA 3GL9A 1QIHA 1UZLA 4BNDB 1G5FA 4OHMA 1NF3A 2ZK7A 3U4AA 4X1IA 4FDTA 3OJEA 2SKEA 2WJJA 3PFGA 2X2EA 5BN5B 5K5EA 4JWKA 1I6KA 2BFNA 4M22A 2OUIA 4TS1A 3K6SB 3JRNA 2DC1A 2HADA 4AY5A 2IOFK 3EHEA 2HKIA 2PT5A 4FGWA 1J24A 1V1RB 4D0SA 2AOXA 1GYPA 3MAAC 4RPLA 1CJCA 2GLUA 4JB8A 1ZNWA 3TOXA 3NU1A 1Z75A 4L51A 4PPGA 5K0FA 2FPPB 1W36D 3EVGA 3QENA 2PN1A 1XHEA 3V34A 5JG7A 1W1UA 1T5IA 1TKAA 4P3PA 1OY1A 5P21A 2WIGA 1LPNA 2VAMA 3AM3A 3TUJC 4OX9Y 1GAWA 4GKJB 1P9LA 1PD1A 1PW5A 2OBFA 1ITZA 1YI0A 4DLVA 1S8OA 4QBHA 3ZHBA 3ZPXA 2HT1A 3HNOA 3AM1A 5F3RA 1UOQA 4AJIA 2I4NA 4EI2A 1CYDA 3H84A 1WVIA 4II7A 4PYKA 4BE9A 3EEQA 1L8LA 1E2LA 1OBHA 2VYVA 2OOKA 2R7KA 4MIKA 7MHTA 4WJLA 1XD9A 2FRXA 3SVLA 4FBLA 1U9IC 1ZNZA 2P9TA 5CW1A 1ZJWA 3BH6A 3ZU4A 3KSBC 1XDSA 2R1VA 3I6BA 1GTG1 4HGYA 2PVPA 3FSJX 3MWDA 1QF7A 3TQHA 2ZYGA 2OILA 5LYJA 4BO5A 2QDXA 1OKKA 3WA6A 3RKUA 5DISB 3IVRA 1HUQA 3T0IA 3W8RA 4OXRA 4NBKA 3U3OA 2DPLA 5IH7A 4J0QA 5AK3A 3IAAA 3L6EA 1H2RS 3NIWA 2ZG6A 4I7EA 4MP8A 5I7AA 1UBEA 3DDHA 3D6UA 3QWHA 5EZQA 5HBRA 3K30A 4B3XA 3I23A 3OX3A 4BQPA 4KO2S 3WL5A 4ZD6A 4D4MA 4MLPA 2BFBA 1J70A 4S0XA 5TT1A 1NXQA 2GQ0A 3PUVA 1ZONA 3D2CA 4AZVA 2AOTA 2KMLA 2D4AA 4UDOA 5B1DA 2F8LA 3KPJA 4PZ9A 1MIOB 2VC2B 1W29A 2R68A 3D54D 2LCFA 3T95A 3HXOA 2ZVJA 1AKVA 1P1JA 1T9HA 4CFSA 1E60A 4NOKA 1BE6A 1GZUA 2ZRCA 1XB2A 4E5YA 4ETWA 3GBPA 3HCBA 1XTJA 2O