4MS3B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the endogenous agonist gaba
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
418
structure length
408
Chain Sequence
PPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWECLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/agonist
total genus 146
structure length 408
sequence length 418
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B01
4ML3A 3O1JC 4MR8A 1Z17A 4JA2A 1ZDMA 5FWYA 2FMKA 5DCLA 3G1WA 2E4XA 3OLWA 2QV0A 3QK7A 2VUHB 4WT7A 1EWTA 3A0RB 2FLKA 1DG9A 2WJAA 4F12A 5T7BA 2HPHA 1YIOA 3LFTA 2GBPA 3MYYA 4WXEA 5JNRA 2P9HA 4QICA 4RXMA 4Z4CA 6CHYA 4RK6A 4G86A 4MQEB 5JNTA 3H6HA 3IPAA 5TQJA 2M1ZA 1JX6A 3OM1A 3TMYA 5GQSA 3H1FA 3Q15C 4RY0A 3H1GA 4W5QA 1W25A 1JDPA 4YCSA 2JB9A 4P98A 2FMIA 3CZ5A 4MS4A 3TB6A 5JNWA 3T8YA 3SNKA 3CZCA 2GWRA 3LKBA 3W9SA 4Y9TA 2IDMA 4LDAA 3TX6A 4N76A 2DRIA 5CNKA 5B3JC 3BBLA 2VYCA 1FQWA 2FTKE 2I6FA 5KWSA 3IP6A 1EHCA 2A9PA 5FWXB 1QNLA 2FQXA 2H0AA 2PKXA 3C3MA 4MR8B 5TQ0A 2E4VA 1M2FA 1JFTA 5E3JA 3QEMB 3T95A 1TLFA 3LKVA 5JS2A 1BDJA 5D2CA 1LK0A 4MRMB 1ZY2A 5TQ2B 3D02A 1EWVA 1Z26A 3F6CA 2L17A 4F3TA 5IUNC 3LUCA 3O1IC 3C3WA 1FSPA 5I4CA 3M6MD 1U2QA 3QLVC 4JOQA 2WY2D 4XASA 3L6UA 3UK0A 4RY8A 5DGCA 2IOYA 3IPCA 4LE2A 3HUUA 1D2AA 5EWLA 2GX6A 4PE5B 1QP4A 1PNRA 2NZUG 3M9XA 1ZVVA 1GUDA 3KCNA 4E7OA 4LE0A 4MYRA 4IGAA 3OLVA 3EULA 2P4UA 2JVIA 3Q7SA 1QO0D 4MS3B 3LUGA 4D6XA 1CEYA 2HJ9A 2WB4A 4UHKA 2A9RA 4EVSA 4NQRA 3RVQA 2E4YA 1F4VA 1MB3A 3H75A 3A0UA 5IUKC 2FEKA 3H5TA 3HDGA 3I42A 1TM2A 1YMUA 5FWXA 4MR7A 1Z2EA 3HO1A 4G0ZA 3RVSA 4N41A 3OO0A 1DBWA 1JFSA 2Q5CA 1Z12A 2FEWB 1JWLA 1BDHA 3KTOA 3B2NA 1P6QA 2YHAA 4ZMRA 5IULC 1WETA 4MS3A 4MLCA 2OENG 2RDMA 1SXGA 3RVKA 4Z0NA 3N75A 1YVUA 3URMA 2FSPA 4NICA 1QO0A 2O20A 4MR9A 2L18A 3HUTA 3N0RA 1RXEA 5HQJA 1L5ZA 3KKEA 2JBAA 3ROFA 2PMCA 5F64A 3DGEC 2ZWMA 1VLZA 5IEJA 1W9HA 2E4UA 1VRVA 4N03A 4PEVA 4LZLA 5IC5A 1YK1A 4DADA 4Z4IA 3C3KA 2R47A 3O2QB 1JHZA 5FWYB 2NUBA 2JK1A 3H5LA 4Z99A 1ZH2A 4HYEA 1QQBA 2JRLA 3JS5A 3MF4A 1SRRA 2RGYA 2HQRA 3N53A 4MAAA 2MSKA 4LRQA 1E6MA 2AYXA 1PEYA 4Q7EA 3CHYA 4EUKA 2CHFA 1KRXA 3Q7TA 5EWLB 2QW1A 4PZ0A 3BRSA 1CYEA 3HS3A 4ZYLA 2GI4A 5DTEA 3I45A 4G0QA 4KVFA 4EY3A 4KRFA 4YR7A 1TJYA 3HZHA 3GT7A 2QVCA 4MPTA 3QELB 2PL1A 4FE7A 1XWWA 4GNRA 1L5YA 1S8NA 4MRMA 5ED4A 5HKOA 2PL9A 4KQ9A 1C4WA 1NATA 1OXKB 4LX8A 3L49A 4MLDA 4YP9A 4N0PA 2LIVA 3FGZA 4XARA 1DC8A 3H5WA 1Z2DA 3OO1A 4KFCA 5JNSA 1NXXA 2PJUA 3UUGA 2FMHA 1GLGA 2B4AA 4Z9BA 4N0QA 1ZESA 4RK5A 3C6QA 2CD7A 3ROTA 4EGSA 3QX8A 1NXSA 4XFKA 1TMYA 2HQOA 1EAYA 1ZITA 4W5OA 5EWMB 3LTEA 5TPWB 4TN5A 4Z4GA 4HNQA 4ZPJA 4RY9A 1AB5A 3MQ4A 3HM9A 1Z18A 3DBIA 4RV5A 5TPWA 1E6LA 2FEPA 3TO5A 4EYGA 4W5TA 4Z4HA 1JH9A 4KMRA 1NXOA 5JNVA 1NY5A 2RJOA 2R4QA 3KLOA 2FN9A 2VUIB 3N0XA 4G0YA 1SXHA 4JP1A 4RWEA 1URPA 1RNLA 4G0XA 9ABPA 4H3KB 5EWJB 1MAVA 3GV0A 4EYKA 1M5UA 3A3KA 1FFWA 3IP7A 3QLUC 1ISSA 2J48A 3GYBA 1D1QA 1M2EA 4YV7A 3NHMA 1DCFA 1MB0A 1DCKA 1Z15A 3CU5A 3FFWA 1BVHA 3OQOA 1RXIA 5PNTA 1LBHA 5JNUA 4OTZA 2XDYA 5CHYA 4KNYA 2NT3A 1USIA 1DBQA 3A10A 1K68A 3KJXA 2BGGA 1GCAA 5BR1A 1ABFA 4G0OA 3KG2A 2CHEA 7ABPA 2PUDA 4G0PA 4OG2A 4GPAA 3F6PA 4O1IA 3RVNA 3HK2A 1CHNA 3CRNA 1P2FA 5ABPA 4KPYA 1YMVA 3H5IA 3T38A 3NBMA 3IDOA 4FE4A 4P1ZA 1PNTA 4WUTA 4JASB 3NNDA 4YGXB 4XLTA 3KHTA 3KYJB 3Q41A 2IPNA 4Z9AA 1R8JA 4YWHA 1YS6A 4MGEA 1Z25A 3JVIA 3O2SB 5KQMA 5FBHA 3CG4A 3JPYA 3SQNA 4MQFB 4HNSA 2PUBA 2WWVD 2R48A 2L19A 1NXWA 3RVMA 4XAQA 4NV3A 2LPMA 1VPWA 2TMYA 2B1JA 2MSWA 3EGCA 1ABEA 1PEAA 4G97A 5GOTA 3RH0A 3DLHA 4LE1A 5KI6A 3IP9A 5B3JA 1JF8A 3QLVA 5C5CA 2FMFA 3NNNA 1SXIA 2A9OA 5TQ0B 4D74A 2PE5A 4RSMA 2MYPA 2IPLA 4IILA 3ILHA 5HM6A 5IX8A 3DLBA 4DN6A 1XHFA 1AB6A 3VNAA 5KC9A 1BAPA 3DGFC 1DBPA 1USGA 4EYOA 4M88A 1QPZA 4XXHA 2OQRA 1APBA 1QQAA 2H3HA 2JBAB 2FVYA 1J56A 3KYIB 2PUGA 3G85A 1HEYA 3C97A 3RVPA 2IPMA 4F11A 3HDVA 3F7NA 1OXBB 4OLBA 5EWMA 3HVRA 3RVJA 1A0OA 2QXYA 3CNBA 3E3MA 4E7PA 4NCBA 3OQMA 3BRQA 5HSGA 3N6VA 4OBBA 3RVRA 1NXTA 1U8TA 3F73A 1LJUA 3UKJA 4H60A 4EVQA 3CS3A 4LDZA 1YTUA 4OATA 4RKQA 1PHRA 3HCWA 2QZJA 3BREA 1SD5A 4IRXA 5KQPA 3MIZA 4S04A 3LUJA 1U2PA 4TMYA 1A04A 1D4ZA 2PLNA 3QLUA 1A2OA 4RU1A 5DKFA 1KRWA 3N8IA 2IYNA 1YS7A 4RDCA 1BA2A 3KS9A 4IF4A 3JTEA 4RZSA 1M5TA 1E6KA 4Z4FA 4KK4A 1ISRA 2M98A 3SY8A 1FFGA 4MQEA 1I3CA 1JYFA 2WJWA 4IMJB 4F06A 3OQNA 2IKSA 3JPWA 2W42A 2V0NA 1GUBA 4CBVA 4JB2A 2FQYA 2ID7A 3OLZA 3H1EA 4O1HA 2AYZA 3GBVA 3SG0A 3RVOA 1ZH4A 3EQ2A 3OM0A 1ZAYA 5IEBA 8ABPA 2JCGA 3LUFA 2FKAA 3ILYA 4KV7A 4KZKA 3TD9A 2RJNA 3GL9A 2WRZA 2ID9A 5BRAA 2PUEA 1NXVA 1QMPA 3OLYA 4ETMA 1JL3A 3VNBA 2IPAB 2R25B 2E4WA 1TVMA 3FDFA 1EWKA 1KMIY 2FQWA 3MMNA 1Z16A 3CKMA 4ZMSA 1USKA 1QP7A 1C0EA 2QU7A 1JFVA 3EAFA 1T34A 4QYMA 2PUAA 4RXTA 4OLAA 3IP5A 3HV2A 4G0MA 5BRJA 3FMVA 4H3HB 4RK1A 2NT4A 1KGSA 5TPZA 2WMYA 4TLLB 1DP4A 1F51E 1JLKA 2MSLA 3EODA 2GKGA 1U0SY 3K9CA 4MS1B 4RK7A 3GBPA 1DRJA 1DC7A 5CNMA 1Z13A 2PUCA 4MR7B 2QSJA 3T6KA 4YRZA 3NNSA 3EDCA 4B09A 4RKRA 5EWJA 3O1HB 3O74A 5JS1A 4DQDA 1P6UA 4NCAA 3M9WA 4HNRA 5KC8A 1DJMA 3R0JA 1LBIA 3K4HA 4YS6A 3Q7RA 3S99A 3NHZA 4QYWA 4MR9B 4W5NA 2LP4Y 3OLXA 3OMWA 1QP0A 2HQBA 3HSYA 4ZJPA 1QKKA 2PUFA 2FXIA 3P9YA 1U04A 2X7XA 1ZHHA 4WXMA 1PUXA 3LMKA 4RK0A 3DZDA 1ZGGA 1RPJA 2FN8A 1ZGZA 4O5AA 5DLEA 3CFYA 3HEBA 1GCGA 3LUAA 2LUOA 3Q9SA 4KK3A 4Z4EA 1DZ3A 5FBKA 2ZAYA 4Q6WA 4D6YA 1EFAA 4TLMB 4QPJC 5BQ3A 3MA0A 2QVGA 3FFTA 3KSMA 1YK0A 2YHBA 3CG0A 3LOPA 4JB0A 4PICA 1JYEA 4MS1A 5CNJA 4ETNA 3LUKA 3MM4A 2MYUA 3KLNA 1RZRA 3CLKA 2FLWA 4ETIA 1K66A 4L85A 2F8SA 5IBQA 3LUHA 1H9CA 2LBPA 3D8UA 4N47A 2N9UA 3RVLA 2FW0A 1JBEA 4Q6BA 1UDRA 5KQLA 1RZRD 3JY6A 3QEKA 4PYRA 2L2QA 2NZVG 1LJLA 6ABPA 5TE9A 2F8TA 3O75A 3SAJA 4UHJA 3FFXA 3SM9A 4EVRA 5CNIA 2VK2A 1P8AA 4RXUA 4W5RA 3OMXA 1MVOA 2MYNA 3LUDA 3QEMA 4S05A 4L4UA 5IUJC 1D1PA 1NTRA 3BILA 3GRCA 1VKRA 3H5OA 3H5VA 3GA5A 4WWHA 5TPZD 5TQ2A 3HJFA 3E61A 3GWGA 2QR3A 3I09A 2JVKA 4RK4A 4F8JA 2PAFA 2JVJA 4KQCA 4RS3A 3EJWA 4JAVC 1B00A 2CWDA 3N0WA 5C5EA 1BDIA 3QELA 1Y1LA 3H6GA 4EYQA 5KQGA 4WZZA 5T3YA 1MIHA 1NXPA 4MS4B 3CTPA 3JVDA 3QLTA 3HXMA 1JDNA 1XHEA 1DCMA 2A9QA 2MYTA 2KYRA 4FB4A 1E2BA 4YLEA 1FFSA 1DRKA 2HSGA 3O2JA 1ZN2A 3O21A 1IIBA 2E4ZA 1D5WA 4IMIB 3RQIA 3EQZA 4KREA 4YO7A 3I5AA 3QX9A 4MQFA
chains in the Genus database with same CATH superfamily
2H7CA 3IQXA 4YGYA 1NW5A 1GT6A 3PUKA 4AUNA 2XWQA 1YJ8A 3AY7A 3TD2A 4ARZA 1D04A 3PEVA 2JLUA 2OP1A 1YUNA 1NR5A 2Y66A 3KKPA 4R7ZA 3VU9A 3WAJA 1WVMA 4X54A 1FY2A 1OBCA 1Q16A 4OMFG 2QNBA 2PMEA 2EKBA 1M2JA 2HPHA 4Z51A 2B6NA 2X9LA 1RIIA 2IU4A 3GNLA 3JQDA 1BX3A 3KZOA 4KLAA 5TMEA 4AI6A 5TQJA 3GY0A 3QFTA 3UJ8A 1Q7RA 3PXEA 3H99A 3WRYA 1L9XA 2YQZA 4BMCA 3HEAA 1U9IC 4O25A 5KTTA 4P9NA 5FT9A 4JEHA 4KTVE 3T7DA 5B1EA 4MKGA 1J0BA 1XZAA 4AQDA 2ORED 5HQTA 4HMPA 2LKCA 1UZUA 1VMDA 4TZKA 2WW8A 4CR8A 4KIWA 4BGIA 2G9VA 1IM5A 3CM0A 1VZ3A 4Q7MB 6Q21A 2B4QA 3D3NA 5FI3A 1FQWA 3D4IA 4J75A 4KO4S 4PCLA 1CQXA 2G4CA 4TSFD 2IF2A 1M3SA 4PONA 3KJIA 3QSYA 4WZAB 4FLEA 1QNLA 1XZMA 1XPRA 1K8YB 3G8AA 4M1MA 3REQB 2XNSA 1GKUB 1IBRA 2IYUA 2GPJA 1OAOA 3K9NA 4ROSA 5AVJA 3EY9A 3WZ2A 5EZ6B 1ZD4A 3Q0TA 4W9RA 5IUNC 3VAAA 3R3VA 4QU8A 3RUFA 5IVKA 4MJ3A 3BRWD 3CRMA 4UHBA 3BSSA 4YFYA 1S9HA 2F9MA 2HU5A 3SZMA 1R74A 2IOYA 4B4OA 3K0SA 1OTXA 2SKCA 1YJXA 2BH9A 1WR8A 3G8DA 3OUUA 4AMYA 4MRSA 1U9ZA 4V3BA 3K0CC 1I3LA 1X80A 1RWMA 1D2MA 3OECA 1OZHA 1G1AA 3QI2A 2P9JA 2P4SA 3EULA 3IAS1 2JVIA 4HWRA 4TTTS 4ZVUA 3OURA 4OX9B 4KODA 1H2HA 4CKCA 4LWQA 1E1RA 4UE2A 3D8NA 3B1ZA 1MFPA 4DV3B 1J23A 2XGSA 1SC1A 2YHIA 2Y2VA 4I1OA 4WN9B 4M9QA 1J8DA 1LK7A 3RHFA 4M0KA 4DQUA 3U13A 1RDFA 3P9CA 2WTNA 2OZEA 3PSAA 3PQ3A 3NWPA 2CLDX 1W29A 1LJ8A 3B12A 4QGBA 4IDQA 3X44A 3RS4A 5HK9A 2EL9A 2NSHA 5JCXA 1RHQA 4HWSA 3DFKA 4KMSA 1G3IA 1ISJA 1HDCA 1XDGA 4WNIA 3OZVA 1QQ5A 1ZLXA 1WETA 5IXYA 4DYVA 4OMUA 2V5AA 1JLLA 3B1FA 4CNBA 1FDOA 2FSPA 1JPUA 2FZVA 2R11A 1QUEA 3THOA 5A3SA 1V3QE 2BCJQ 4MR9A 2R0QC 1P4GA 1ZVMA 4QGGA 1LVGA 5FPYA 1GZSA 4IUDS 3B78A 4CYMA 4D9IA 4G37A 4QOHA 3I28A 4K2AA 2HNAA 3GZTB 5JCPA 1KEWA 4MIEA 5EN4A 3RBXA 1WUIS 3LFUA 4CW7A 3KEGA 1X9GA 3V4FA 1U28C 3EXFB 1PJ8A 1GAEO 2WDZA 1IHPA 4PLGA 3O3NB 3F3YA 4DFDA 1R8YA 3U3KA 5K8CA 1R0XA 4FILA 1NOKA 1XTIA 2FWAA 3G8YA 3GG9A 3K6JA 2PXAA 3ZGLA 3AV0B 1DKQA 1ZU5A 3WNCA 2AUMA 5FBWB 2ZYAA 1EGMB 4I9HA 3ZU4A 3VI3B 4EUKA 2HIGA 3SC2A 1EWRA 2ZTMA 3FPKA 3IBSA 4REOA 1SQFA 3R5FA 1Q1QA 4RZ2A 4AJLA 4F21A 5B6IA 5ICEA 3BRSA 4PHGA 1K0UA 1Q1ZA 5E4TA 2SCUB 4AKEA 5KDOA 2V6GA 4G0QA 3HACA 2D1TA 1USUA 4ARIA 1KU6A 4CIYA 5HS4A 2QVCA 2V7VA 4YVFA 4EX6A 2O8FA 1L5YA 1ODIA 1OYVA 2I2CA 3JAWB 3ZHRA 3TNFA 1NRWA 2JGLA 4H7IA 2PL5A 1KMHB 1T3HA 2QG4A 3QHQA 4LTMA 1RYHA 3DP7A 2JJ1D 1TCVA 3FAKA 3D4PA 1MOSA 2PM8A 3MSCA 1G38A 2O3QA 4XARA 1Z3CA 4KYUA 4AT1A 5CXXA 2YZKA 4IXTA 1ZNXA 4D0RA 4ER3A 4TMXA 5L4LA 1L5OA 2HADA 1XA0A 3TZBA 1H1TA 1T0JB 1L5SA 3PEYA 4N0QA 3C6QA 3D2AA 2WD7B 1VKNA 4AU1A 3NGLA 1L3BA 3EVTA 4JVOA 1GZ4A 3HEMA 5DSXA 1CEXA 3AL3A 2QI9F 2CJFA 3LHDA 4URZR 4I4NA 5JWRA 5DYIA 4ALIA 1Y4ZA 3IKMB 5EP3A 4EF4A 5H4GA 5HZHA 1ZI8A 4J6FA 3O4HA 3P9SA 3PR2B 3TUIC 3F6EX 3VMMA 2YWBA 4FCCA 3GH1A 5JNVA 4M6WB 2WG2A 5DHUA 5ADVA 1GGHA 4JP1A 2WSSD 3WQQA 2CNKA 1H8HD 1CQWA 1LSUA 2IW1A 1SKUA 2OLJA 4JC4A 3BSYA 2VUTA 1NIPA 5HFAA 1ADFA 1EDEA 3TAHA 1DQYA 1E79A 2V5UA 2QPAA 2W4IA 3GV0A 4CMBA 1JMKC 4DNXA 1WWKA 2O7SA 2VF7A 1XEFA 4OJTA 4F93B 3L4KA 4LGMA 1QRTA 5INTA 3GJ5A 4LKOA 2E48A 3IP7A 4OGKA 4W1SA 4WNAA 3GYBA 4HAXA 4QNNA 4YJFA 4ZQBA 3V80A 5EJ4A 1RRFA 4BXOB 5DHFA 3VU3A 3PI7A 1M6HA 4XWWA 3LGXA 3RBVA 2QNIA 3R7WA 3SXJA 1J21A 3VJMA 2JIRA 4BATA 2HPVA 2Z4SA 1PFWA 3M1IA 3O5AA 2OM2A 2ZSEA 5CIYA 2H17A 5TLSA 1JAXA 1I5EA 3I6BA 3WHLA 5B36A 4FPXA 2OCIA 4TLAA 3RS3A 2RGXA 1K8XB 1W52X 3R5TA 1Q0TA 3KLBA 5I7OA 2PU7A 2Q07A 1GA1A 2ZDQA 3AEKA 1YZUA 4FKZA 3Q2KA 4G0OA 5JO9A 1WBJB 3K32A 2RHHA 3T5DA 4FNAA 5LMNB 2O3UA 2UU9B 4REMA 4QFCA 1TJ4A 4OFWA 3FMPB 4FE4A 2WTMA 3IDZA 3Q3VA 2GQ0A 1P74A 3NQ41 4COOA 3LIIA 4BECA 2O19A 2D54A 4I4IA 3VHXA 3WWZA 2DLDA 2IPNA 3H7IA 4KLCA 3TRDA 3PHJA 2OV4A 3I01M 4LNHA 4N5MA 2G72A 1EX9A 1N5OX 4YCLA 2C9DA 5EFOA 2NQ8A 1GUYA 3BMCB 5FTWA 3WGNA 3QKUA 3OFSA 3LXMA 4MLZA 4BP1A 3I05A 4INPA 4EG3A 4FOTA 5G40A 3KSAC 1E0DA 2OPBA 4F2HA 1XZBA 3NHKA 4A3SA 1PHPA 4AF7A 2O8FB 3DDHA 4MGHA 5LC1A 2ZETA 4E4RA 4KXYA 4P38A 5JZBA 2YN4A 2XZTA 2J31A 2XOKA 4EH1A 1AQNA 2Q62A 1GR1A 1GPYA 3IT0A 4XR4A 4DDVA 1KDOA 4M0DA 3WGVA 5JAQA 3E22A 4BMOB 1YULA 3DS8A 5UKDA 3WDLA 3BIXA 3SC2B 1N34B 1B1AA 4A27A 3ONVA 1NVVQ 4BCDA 1RQ7A 1W4BA 3DUWA 1ZC3A 1XRPA 3HCEA 2H2WA 3D31A 3JWGA 2I2BA 1FP1D 3QNMA 4M9RA 4R9SA 4NNJA 3MCWA 4LY9A 2PZAA 1V1MA 1BH6A 1L4FA 3IILA 3FCEA 1G7SA 3F7TA 4OHPA 5KTYA 1Q77A 3BORA 2DKNA 5B4VA 3DE2X 1KFCB 1TD9A 1KERA 3Q8XB 1KMCA 4GGOA 4J6EA 4Y9RA 4F8EA 4L9WA 2WLTA 4MVXA 1IN7A 4WN3A 1VJ5A 1G21E 4Q1VA 3FDXA 3OFKA 2WT8A 4WY2A 2HK6A 1QO7A 2O7QA 3L0IB 3BXHA 3G7UA 3DW3X 2CFOA 3GW8A 4AQ7A 2WQ7A 1G8JA 1MRSA 1P9OA 1TVKA 3EZNA 4IHQA 4L0DA 4QEKA 1PR0A 1VMKA 4MRNA 5FA6A 4OLBA 1Z0DA 4MCIA 3RVJA 1IOLA 4FNGA 3AKCA 3CNBA 4B8WA 2C3YA 3OFJA 3P5BA 3CYFA 4WADA 5CMLA 5DNDA 1GPLA 4UTNA 5JAIA 1IUKA 2Q5IA 4TMWA 1LLUA 4E51A 2WG0A 4M9CA 2EKQA 2XRMA 3DVLA 4ENSA 2FFAA 2RG1A 2QROA 4FFRA 4GZ5A 3MRVA 4PFSA 1B0ZA 2WMDA 1YC5A 2QQEA 2HSEA 4FKMA 3G9XA 2OAQ1 1T2EA 3ENWA 3MJHA 3H2ZA 3KVVA 2QZ4A 3R74A 3QLUA 2Q3DA 3EZFA 4KE6A 1U0BB 2W93A 3KL2A 1NI3A 1C41A 1NYQA 1WF6A 2VZ8A 4S1OA 3FYUC 2Z8ZA 3DW1X 3F3SA 4WK2B 1RWWA 4IF4A 3O0DA 3MGGA 1ZH8A 4BQPA 3IP3A 3KZ1E 1UDWA 3OZFA 2CL5A 5K8TA 2GCGA 5JH7B 1NT2A 4QBGB 5A02A 4OOEA 4F8YA 2AEFA 3B85A 3P0EA 1Y7IA 4B7CA 3LXUX 1N9KA 2L0XA 1TTHA 5E2IA 1L4KA 4V02A 4XWTA 1N2CB 1SRQA 2XUQA 3F8WA 4LVUA 5EMLA 4CKEA 4MWBA 3S1SA 3IP8A 4M49A 3A6DA 5HXAA 2X8AA 5T67A 4E08A 5EJ5A 5DW0A 2ZSJA 2ZE6A 2WTAA 2QF7A 3GEBA 3I83A 1E20A 3F47A 2ATIA 3IS3A 3ZWYA 3V4PB 5LYJB 4ZCQA 2W2XA 4MB6A 5BRAA 2PUEA 2CNWA 2P6RA 4EITA 3F96A 4EHAA 3O4VA 4R0VA 2ZRNA 2E4WA 3BWDD 5E6UB 4D7AA 4EZIA 4YRIA 1X7DA 3SHVA 3PPIA 1WEHA 4AMGA 3A36A 4FYPA 5BRJA 1COWD 3U4QA 4HAWA 5F76A 3WV4A 4FWBA 3P19A 3L4BC 4RK1A 1GTRA 1XJQA 1ZS9A 2X0RA 3GK3A 3ENVA 2YRXA 4HYQA 1NW4A 3AK4A 1KYVA 1ICIA 1QLJA 1YIAA 2HRCA 2JFUA 3OT1A 2GFIA 2R2GA 4HNTA 2BHLA 2GKGA 3R7SA 3RJZA 1T4MA 3U3XA 3AYXB 2G1JA 4AY4A 2HMYB 3BULA 2HH9A 1E9FA 1OT5A 3HH8A 4NSNA 4Z6KA 1HG0A 4X85A 1L1EA 2H9AA 2FF5A 4GPEA 4J16A 2E4AA 1VCIA 1FDVA 1XZJA 5JNLA 3VR5H 3GUUA 2NN3C 4IDGA 1P6UA 4PZPA 4AFNA 4NCAA 1SIOA 2YZMA 4UCQA 1R27A 3QKRA 4DR6B 1TOAA 5EYPA 4IDNA 3F78A 2ZAIA 1FP2A 2VPQA 4Q9NA 3THYB 3DQZA 3K4HA 2IQ5A 1CE8B 1Y5MA 4FOPA 4NBSA 4BNIA 3D64A 5FPKA 2Q4EA 5DEOA 1TX4B 1K8RA 2QXUA 2CXUA 4WBNF 2JCBA 1OSNA 2BEUA 3BMCA 3NHPA 2HIMA 4LTDA 4D8WA 2RHOA 1Q57A 1ZM4A 1RHUA 5BVHB 2XITA 3H84A 1N0HA 3LMKA 5DWVA 1XDSA 2H1WA 1FBTA 2Q2OA 2RAPA 4FFMA 5KPJA 1G8SA 4KGXA 3CFYA 4UNSA 2AMVA 1O6BA 2JBHA 3RT1A 2IYWA 1GZHB 4FQ5A 2I67A 1YDWA 3SYNA 3S5UA 2XI4A 3I53A 4TXMA 2FK7A 2XWSA 2FMTA 3M4ZA 1T4BA 5REQA 5B58C 4JB0A 3AVPA 1Z73A 2IDKA 3AUYA 5HMLA 3ZE9A 1BG6A 4PSCA 4QEDA 4RTJA 5F52A 4NU8X 2BR5A 3JX9A 1CUUA 3OQ6A 5M2QA 5AKHA 2ZS7A 5JUWA 4U3JB 3EMKA 4ARVA 1O97C 1ODLA 4OO3A 1F0YA 2FPUA 2XUZA 4ND1A 3ROEA 4P4TA 4HH1A 1IOWA 5C1PA 1U8FO 4ESOA 3W2IA 4GKJB 2IH4A 3QFRA 2COUA 1Q21A 2OFXA 5I9MA 1LJLA 2W37A 3ZGYA 5A5EA 2AB0A 1VJTA 3OU2A 1ZD8A 1S0UA 3LDGA 4R98A 3SAJA 1VB3A 1F6WA 2W22A 1CF2O 2WU3A 4KMMA 4EVRA 4HWOA 3HLYA 4QVGA 3SFVA 1CG6A 5AW8A 2BZ1A 4FGLA 4G4IA 5HCIA 3STTA 1FYXA 3UHOA 1KOFA 4L8LA 5CH3A 3H5VA 2C9BA 1FPMA 4LW8A 4XJSA 2I6XA 3TJMA 3UMSA 2C97A 1NI4A 2AFIE 2JJ8A 2WJPA 3IAHA 4IFBA 4ZOCA 4YWJA 5TX7A 1RC8A 4F4HA 3LPLA 1UFRA 3IVGA 3QNUA 4UAUA 5JASA 4R51A 1WOYA 2BM1A 4GSKA 2C29D 3VU8A 4D8UA 1BDIA 5FOSA 1KQGA 2HLDA 1TQDA 1JIQA 5T3YA 3LCMA 4NE7A 1TPZA 2HW8A 2XDAA 5K3AA 1GKKA 2BVNA 3ESYA 3NR2A 4HQLA 3MN1A 4OBXA 3R7FA 5ICGA 3HXMA 2C5BA 1F6DA 2A9QA 3EAQA 5F23A 3C87A 1FFSA 1WQ1R 3CPEA 3OHSX 3R6TA 4KMOA 1P81A 2NXCA 4RD3A 2IGBA 3O8QB 5L7TA 2BLNA 2IXFA 1E2EA 1ZFNA 3KJGA 4KKXB 1QBGA 4MB0A 1ZA2A 1A7KA 1XLTA 2P7IA 1RFGE 1WSBA 2GZMA 3R0XA 4LI0A 1DL5A 4TVBA 4EFKA 3LZDA 5CLJA 1XZCA 5KTNA 1W4CA 2JFNA 3H05A 4G2NA 2Y6VA 2GEKA 3P9RA 3ZWBA 1E62A 1QHIA 3A0RB 1UFQA 4NBKA 3KIPA 3TXXA 4LMPA 2AXNA 2XODA 4X44A 1U0NA 5ALVA 1H4VB 1Y6JA 4WXEA 5CX1A 3ZY4A 1NAHA 2QJRA 5EP4A 4NBLA 2QX9A 2ZRGA 3LYUA 4G4GA 3VGJA 4AZWA 1SZJG 1JWAB 3N7TA 4RTNA 3R6WA 2PMBA 1X8KA 4GYKA 1RFLA 3AONB 4OBEA 1BU8A 3A8TA 1NUUA 2DHEA 5GQSA 3RLFA 3ROMA 1Z7EA 4YUVA 2RB4A 2KI5A 1QRSA 1Z63A 2JB9A 3OIFA 1DAOA 1TYCA 2O3TA 1TO1E 4KBYA 3VSAA 1GQRA 1EK1A 3DBHA 3L84A 4CM9D 3EXFA 4PZZA 1C0PA 5MF6A 1WTCA 4LISA 5CNKA 4ZGGA 3TUZC 2JFYA 2VYCA 2H07A 3IA2A 3FHJA 3IV7A 2WF9A 3JATA 1I1HA 1GQ2A 2ZBEA 4M1EA 1R8SA 4WQMA 3C4QA 3CEJA 9ATCA 4GP7A 4R2XA 4TX1A 4W7SA 1XEWX 4LFCB 2UYQA 4MRMB 3ESRA 4GSYA 4Y2PA 1PJQA 2YV3A 3FVVA 5CK5A 3TGLA 4GX0A 3RV4A 1PLJA 3ETHA 3UK0A 4GE0A 2PWPA 3M4YA 2I78A 4PYNA 2CXTA 1U7ZA 3K5PA 4AB1A 5DRTA 4E7OA 2DY1A 4GR5A 4QELA 1UF9A 4AKSA 2HMTA 2AD1A 2C0PA 5JQGA 4P3NA 1KEKA 3TOVA 1N6NA 1YKFA 3M5CA 3AI1A 4TRRA 1C30B 4MVJE 2DCUA 3WKAA 1TAUA 5KJCA 1FYWA 1JZQA 4EB6B 4TXHA 4ESEA 4EVSA 1GN9A 3IIIA 4RQUA 2QUJA 1I3MA 3JR3A 2JLWA 3UAGA 1J0CA 1N3LA 3FH0A 1YJQA 4N5DA 5COBA 3OF3A 5L4NA 4LUCA 4FYKA 5ALOA 2HNKA 3TNYA 3K9GA 1AIPA 3PE6A 1CY7A 4JOCA 5ECDA 3PK0A 4GL4A 1QJ4A 3WHPA 4FXPA 3D6UA 3HUFA 3RGWS 4JU8A 4RVNA 2D2EA 1E2GA 1ZM9A 1G291 3WLIA 2VNKA 3C7CB 5EA2A 3OE1A 3PDCA 1HEIA 4TVKA 3B2NA 1KHHA 2AZDA 5BWMA 2YHAA 4B34A 4LXXA 1L7AA 1EVLA 4LQCA 3B5JA 1S01A 1A8UA 2BIFA 2XDQA 1E1NA 2ZP1A 3KOUA 1ZJ6A 1IOZA 3Q9UA 4TXJA 4GVLA 1JZTA 2BEUB 4I66A 5L7YA 3U7JA 1Z5OA 1NLYA 3KKEA 4OXQA 4ZAXA 2VPZA 3DWEX 2PMCA 1X6VA 1GARA 5F64A 5B55A 2Q5EA 5FUBA 2I6GA 3AEUB 2Q3HA 3D81A 3HJBA 5FEUA 1XB2A 5AVRA 4Z8XA 1K6IA 1I5RA 3LC0A 4BC1A 2PZBA 2IUYA 4JGBA 1RAFA 1P33A 2GPTA 2VP2A 3VR3A 4XWOA 4LHYA 4WPGA 3OAAA 1HMYA 3W7AA 3M7IA 4Q48A 1YFJA 1QYWA 4GUDA 2PBZA 3U4CA 1ECPA 2UVPB 1W4AA 2GTPA 1G9SA 3KXDA 3ELYA 3MBKA 3ORHA 4R1NA 2YHSA 3KOWA 2C07A 2QW1A 3M1YA 2OB2A 4GKAA 5EWLB 4CT4B 3LTNC 3PGVA 2X0FA 1LS6A 1VPDA 2O2DA 1I0ZA 1C8BA 1QANA 3SDZA 4NZPA 5LNK1 2YWGA 1KYTA 4KRFA 2BGKA 3ZY5A 3HCPA 3WGGA 5IF3A 3ED1A 3A4LA 5GOTA 5JLJA 3QELB 2PL1A 4FE7A 3FCXA 1S8NA 3DO8A 1YL5A 5ALTA 3CY6A 2X9NA 1YVRA 1NLFA 2PPVA 3TKAA 3TOCA 4UFOA 3RASA 2VLIA 4LK3A 1OXKB 2F62A 1G5TA 4MUKA 4IRUB 4NEQA 5SZIA 2MTBA 1Y7TA 2GPAA 3FE2A 4K6GA 3TE7A 3WIEA 4XE5A 1DC8A 3CZ4A 1SCJA 1W2GA 3G1TA 4UBIA 4A82A 4QDJA 3RREA 4EHFA 3UMYA 1NXXA 2PJUA 1KPGA 3VQTA 2IXAA 4EAAA 1UK9A 4XH9B 2FSUA 3DAPA 4P4LA 1NBHA 3U3DA 3OIGA 3JQPA 4M0EA 1H1LA 3CSDA 2O6HA 3HNOA 3P0RA 4H1WA 1ZITA 1XVLA 3R7LA 3ASYA 3O4JA 3O7MA 3MINB 1JIUA 3QHAA 1YE5A 2Z2JA 2POQX 4EW6A 4QGSA 3PFWO 1M0SA 2G7MC 3EMDA 1V39A 2WAAA 3DE7X 1ECFA 2CMDA 1F3OA 1TC2A 1YZGA 1YAHA 2PS9A 1NXOA 4NZ9A 4XVRA 2RJOA 2P11A 4DA0A 4IDCA 2G6TA 4PR3A 3EPHA 3JTMA 4I8IA 2E85A 3PEFA 3QENA 2Y99A 1RTTA 4ZOQI 1KMQA 5KYTA 2IL1A 1SKQA 3MUOA 4NF2A 5HX7A 3UWDA 4UPEA 2HNBA 2GDZA 1IXSB 2GN0A 3ZKWA 1OREA 3MHTA 3A37A 5E9WA 2CB0A 2WYIA 1MGPA 2V45A 1O03A 3IVRA 4RQTA 4YRQA 3D0RA 4AL4A 4MINA 4LEIA 1NVBA 3M3PA 1P1JA 2QMYA 3P4XA 1A76A 3E6AA 1RXIA 4TLDA 3GX1A 4MUAA 1QOPB 2XLCA 2V3VA 3E18A 3O31A 1S8FA 3PQEA 3UJNA 4KNYA 1USIA 2IYAA 5J59A 3FUWA 4EP1A 2WJ6A 1WB6A 4DCGA 4H1VA 1UBJS 4O2BA 1O94D 4KQ6A 4JVMA 4DA8A 5DRYA 3K92A 4ITUA 1PFYA 4ZCSA 1W85A 1S2NA 2H16A 3WWOA 4N5NA 3OZUA 3WQBA 1IBKB 3CLSD 1G8AA 2BEVB 5ALNA 1AGRA 4OHUA 1P1IA 3D0KA 1GVNB 2XE4A 4H35A 3S2FA 4QXOA 4CHTA 4CLRA 2I55A 3T38A 2J59A 1FXUA 3EHDA 1JHXA 1JA0A 4C0LA 1FQKA 4IXMA 3OOWA 2Y1FA 4S35A 4DLZA 4XSGA 1GNSA 2FOIA 2VHVA 1N75A 2F1JA 4ZYXA 2GXSA 2JIOA 3V1YA 1I1OA 3GP3A 3L77A 3T35A 3WRXC 4JLOA 5BY2A 4V3CA 1SZDA 3UMRA 1ZG3A 3FOFC 1AZLA 3L05A 3PC4A 4MQFB 4I5DA 3P1JA 1WOMA 4PZAA 2NV0A 2Y0PA 5TR9A 1L7RA 3KQHA 1O96B 1RLMA 2J4DA 3LW8A 3OH8A 3U1TA 2B25A 2LPMA 3ABIA 5J2UB 1FMFA 4KXXA 5I7AA 4DUGA 4CKBA 1NURA 3QVGA 4LJSA 1TFRA 5KYYA 3E03A 3NPMA 4LXYA 1ZMOA 2C84A 1XDDA 4G6ZA 2DTDA 2FY8A 2OESA 1SBNE 2BCEA 3QEOA 4NDNE 1GEGA 2INGX 4OGWA 1D0VA 1NBMD 3C45A 4XWAA 3U4AA 2C5FA 2FMFA 1V7PC 4YRTA 1G2QA 5TQ0B 1DOAA 1JNYA 4GMKA 3KV1A 2ZJ4A 3VX4A 1R0YA 3EVZA 5HM6A 2NMVA 2IIQA 4BNWA 1W19A 3KQMA 1OFUA 2HRDA 5KIAA 1E59A 1VE1A 3L9XA 3O4FA 2Z9BA 3CUWA 4R6WA 1TQHA 1KI2A 2V7TA 3WK8A 4UM9B 9MHTA 1UT6A 4RHCA 4ZO9A 3ZU2A 2ARKA 1IZ7A 4HEJA 1JMVA 4OQPA 2I29A 3L18A 1HKHA 2I1QA 3LP5A 3RHSA 4NENA 1VYTA 2VTKA 4UBOA 5ADHA 5J23A 2XYVA 2I6UA 4XEHA 4ARSA 1D1SA 3AC0A 2PXHA 3T3EA 1JLSA 2W48A 1U94A 1D5CA 3JARA 3TZLA 4OHYA 2ZIUB 5F1OA 3CWQA 3NAMA 3V7YA 1U6KA 3CPSA 3LBNA 2G71A 1JJAA 1R0KA 4IIFA 3EH2A 3ZDDA 1HYHA 5EESA 3EXG1 4QO7A 1YZQA 1CETA 4CF4A 2XB2A 1NXTA 3I9MA 4KG7A 4PNEA 1MORA 4B5LA 1G3UA 2C9ZA 3U60B 1WEKA 1Q0SA 2CJYA 3C7KA 1DIRA 4DEXA 1GKLA 1O9HA 1RW4A 1U0GA 2C5HA 4M3NA 3AVTA 2JIQA 3Q4GA 2BYTA 2Y1XA 4AVYA 3SVTA 4UTZA 2YN2A 4XYMA 2AI2A 1JBKA 1W44A 3SSNA 1M7BA 4M99A 4ZT3A 1C81A 1J22A 2G4VA 3MS4A 4ETWA 2BGUA 5J5CA 1CSEE 3U26A 4ENVA 3DFMA 5ALQA 1B0PA 5CT5A 5F5LA 2H48A 2BKXA 2BMWA 3KXKA 4BYMA 4D9NA 2H63A 1T2VA 2EFCB 3CONA 1QG0A 4MV9A 1TQ6A 2GO7A 4JYPA 4TM7A 4D92A 2EVWX 1OTHA 2XF8A 1BX1A 1SO8A 2R751 3OQNA 2AFVA 2IKSA 3JPWA 3JQAD 4M9UA 1KH2A 5THKA 4RORA 5IXSA 4JLSA 2C4UA 2XD9A 4K88A 4FZVA 2I7CA 2QLMA 5T4EA 2WFLA 4ZODA 1P0QA 1JHDA 1SU6A 1JAHA 4KWTA 3BMNA 2PD6A 3GDGA 4LVCA 1POXA 4GR4A 3TD9A 3TXAA 5BSHA 4NAHA 4Q24A 4KPFC 4QZVA 2DUMA 4P2GA 1J2YA 3SJ7A 3AR9A 2XCRB 4E5SA 2ZUBA 4X93A 5F77A 3P9PA 2IZ0A 2IPAB 3O4IA 4ZDJA 1IN4A 1AGYA 1IUNA 1NKVA 2YXPX 4RHEA 3V4OA 1B6TA 4PGAA 2QM0A 2QU7A 1RQRA 1RLJA 1NP6A 2VWQA 3DV0A 4DLBA 4BWYA 1KC3A 2ZYSA 2BBWA 2ZIVB 4QWMA 1A5TA 1YU9A 2GVZC 3AXTA 3H18A 5FLYA 4FMDF 2I3ZA 4LYYA 2RIPA 3AETB 3QH4A 4B74A 1SBCA 2AD5A 4ASUD 2JFOA 1OFGA 1AKNA 1BN6A 2GRJA 2PRIA 4JJIA 1RM4A 1Y6FA 1CUBA 4I1PA 2PXCA 3TRHA 3L4JA 1COWA 3C24A 3EDCA 1ZK1A 2A14A 4A0QA 2W0MA 4URWR 3A26A 2ZYHA 3LA6A 5TXGA 5K99A 2ZU6A 1YZYA 5K3FB 3C3YA 2JGDB 3OBIA 5HILA 3QVUA 3KT0A 1KYXA 3LP6A 4CLRB 1JRLA 2DPYA 3MTQA 4FEAA 2R7LA 3WA6A 1CTQA 2QL9A 1GZVA 3I6MA 3GI1A 3IXMA 5HJEA 4JGIA 2GAIA 3VTKA 5I51A 3WK5A 1S9DA 4N8EA 1LFDB 1JHYA 1T2NA 3OIYA 1GPAA 3UGTA 4UUOA 2HMWA 3F7OA 3WNZA 2HFKA 2PZ8A 1J5XA 1M75A 3FUTA 1PQWA 1A5SB 2ZVJA 3HRIA 4PTYA 5K8JB 3KUUA 2QL5A 2HMVA 3HBAA 3KZKA 4QPZA 1R8QA 1U04A 2A59A 3LQKA 4GI2A 4HBGA 2NM0A 2VNIA 3LLMA 2J6CA 3FHOA 4I19A 2NX2A 4GYYA 4QSMA 3JD0A 1TJNA 1GCIA 1JECA 4EKIA 2YXEA 2X19A 4CR7A 4E14A 5DXAA 4PINA 2I7DA 4E07A 4KO2S 2DKOA 1C1DB 4M54A 4O4IA 2QTZA 3N8HA 3DLTA 1K0FA 3KSMA 3NP9A 2REXB 5DN9A 5ALPA 5ARDA 3GQVA 3RT9A 3U40A 5JRZA 3LUKA 3MM4A 4CDGA 4D4HA 5IRCD 3V8BA 1L1RA 3B9PA 5EGNA 2H7YA 2CLHB 4ICIA 2E1PA 3L1JA 2PY6A 2ZSUA 5IBQA 5LJLA 1M8GA 2QTBA 1WP4A 4PC2A 1FDTA 1PL0A 1QX3A 1YT5A 2LBPA 1MQ8B 3QPAA 4B6QA 3BE4A 1IY0A 1KAMA 2CK3D 1EVKA 1Q44A 1IHDA 2P9BA 4U2BA 5E6RA 4F38A 1GZUA 4IVRA 3LUBA 3GD7A 4ZDKA 3TQIA 1HDRA 5AVQA 2QTVA 2RH9B 3P2KA 1QTRA 4YRCA 2P8SA 3MJCA 5IDVA 4BJHB 2AFHA 1HE4A 3IQDB 1SN7A 3MCVA 1P5ZB 1Z0JA 2YWHA 1Z9BA 1SXJC 5DI3A 4G56A 3W9BA 2FH5B 5AOVA 1JEYA 1TZCA 4OI2A 1K75A 2OC4A 5C1IA 4UHJA 4B6OA 1UBTS 1A7UA 4URUR 2PRJA 1O08A 2ODAA 2ZS9A 1O4WA 4KDFA 1AC5A 1ZCAA 5K8UA 3AKZA 1TM5E 1MX9A 4X6LA 1C0LA 5GJVC 2AE1A 5LP6B 4S05A 3ZWWA 2OCGA 5BOSB 3GRCA 3H3JA 2W7TA 4TTQA 5DOVA 5FFNA 5BW4A 3EZGA 2WSIA 1KKLA 2WM2A 4NONA 3OMLA 4QPNA 4RGBA 4Y2GA 3RSGA 5EMKA 5KEIA 1JEEA 3H3FA 4M98A 4IKEA 4QA9A 4K7JA 1PR2A 4R1MA 3ZQJA 2CWDA 3D7KA 3STVA 3WBFA 5AP9A 5JMPA 2FE1A 3E27A 3UIEA 5IZCA 3QBDA 1E5DA 2FSGA 2ZT5A 4EW1A 4X3OA 4HS9A 4HPWA 2VATA 1IZ8A 4MS4B 1WUHS 2AOWA 3AZOA 4Q3BA 1MZVA 3AUFA 4YK7A 3ONWA 1T5IA 1KJQA 2PYDA 3CUVA 4WCDA 2F3RA 3M6IA 1GYPA 1DRKA 1DTWA 2CXRA 2OD2A 3R3WA 4QBKA 4BLQA 3QMMA 4EWLA 1JDBB 2VIIA 3M8KA 2QRKA 4DCMA 4X41A 3P5SA 1L4YA 3PZBA 4JA2A 4AULA 1AHIA 3PDJA 2RK4A 2WIFA 1I7LA 3H4VA 3IJEB 3ZHVA 5H7XA 1CQIA 1F8FA 5FTJA 3UFXB 1YACA 3KAKA 4CQLB 1C7EA 1LQ2A 4P36A 3K9FC 2H9YA 4BHTA 2QN3A 5L3ZA 2IXGA 4NYMQ 4R9VA 1XAJA 5T7BA 1HTTA 2ZJ7A 4RUKA 3U0BA 4AWXA 4WKNA 3EMBA 4QICA 2A92A 4B3DA 2ZRFA 3NOXA 2YWRA 4ZYWA 1I32A 2Q27A 3N8GA 5GGXA 1I01A 1NN5A 1UK6A 4UM9D 1GAWA 3TMYA 2W9XA 3H86A 5EKTA 2MSDB 3FM9A 2IYPA 2XTJA 1M6WA 4WLFA 1DVRA 5I7EA 3P32A 1GFIA 4EUEA 4YCSA 2A0WA 3V7UA 4HQ0A 4KUGA 1B6SA 3JWJA 3H9EO 1IWBB 4OA5A 4C05A 4MDFA 2AKYA 3E8XA 4L28A 3AWDA 5BNFA 2XEXA 2DRIA 2WM8A 3K30A 3ROKA 3LUPA 3BBLA 1ZGJA 4E5PA 5J4KA 2DTEA 1SA0A 4ISCA 4U7DA 3DEZA 4ILEA 5B37A 3VDRA 3WOVA 4WKCA 1UODA 3C3PA 4C5CA 3E82A 2XCQA 2QPOA 2V6MA 3JALB 2Q9AA 1OI7A 3T1QA 4NXMB 221PA 1UKEA 1N6IA 2ASEA 4XJTA 1VKHA 1ONOA 5ICMA 1D2EA 2DHRA 4R81A 1F20A 4PIMA 4WFKA 4Q3EA 3HU1A 4KXWA 3WDMA 4WLUA 1ZXLA 1Q83A 3S28A 3TLYA 3DE0X 2KLHA 1T9CA 1MEEA 1TM4E 2X9GA 3AUAA 3GRZA 4NS4A 1AA6A 5A4IS 1LBSA 3LF2A 4QLAA 4BX8A 2FA9A 2XNCA 1RYBA 3RVDA 3ZDFA 2CJWB 4U2KA 5D5QA 3AVOA 4NFHA 4WEOA 5CDFA 4D82A 4D9MA 4EJ6A 3FPAA 3DJYA 4QBTA 2OMKA 5HNKA 5ICSA 4FNMA 1E5VA 3OLVA 4JXJA 1T9AA 1XNGA 1PJCA 2ZYIA 4OXXA 4KEAA 4MUGA 5DLPA 5G3YA 2NXJA 3U44A 4WK6A 3QXGA 1SQGA 4WERA 4G8CA 2WD9A 3RC8A 3LDUA 1RAIA 4GO1A 2BZ0A 4GZ3A 2JS7A 2B69A 2PO5A 1QYXA 1V0JA 1JKFA 1KORA 2QUIA 2XSZD 2ZBUA 3EVBA 3FW1A 5SZHB 3UGKA 3E3OA 3SQDA 3GO4A 4BAZA 4H1TA 4W9MC 3QUAA 3RYCA 1JFSA 2ZRCA 3K35A 3PQ6A 5G41A 2YQ5A 1SZCA 3ND8A 4AO7A 3GJ4A 1EZ4A 1ZD1A 3HKBB 4Q34A 4U7TB 3SZRA 4A6XA 3C3CA 1OGJA 2W2OA 3ZVKA 1Y7PA 2PFSA 1K86A 3JQ9C 4IGIA 1V5FA 4YXWA 3URMA 4NICA 2HU8A 2VPPA 2C4TA 4M7OA 3WGTA 1L7QA 1OGYA 1ZP6A 4CTNA 1KSGA 2FP3A 1HXHA 4M1TA 3JQAA 1L5ZA 2DBYA 4DJDC 1PAUA 2CFTA 3GH3A 1WXWA 3K5IA 4DL9A 3U56A 1VRVA 4LZLA 3EZ2A 3QYAA 4BEWA 3K71B 2GJSA 3KPJA 3KB6A 4P86A 1Z68A 3PJDA 4LHZA 2AKAB 4D80A 1OBVA 1KQPA 2ZRHA 3D6FA 4BWGA 4C7OA 2PNFA 3VR2A 1R0LA 3DZBA 3T7TA 1UJ4A 3ZDQA 1V5GA 4NR0A 4I4LA 4LG1A 3W5CA 3R9XB 1N5KA 3ORFA 3G49A 2OYSA 3RYHB 1ZJWA 1IJKA 1MZPA 3ANNA 3JQAB 3WNBA 3ZWOA 1EXDA 4Z1MD 4A10A 4U7GA 4P3OA 5IWCA 1CYEA 1P60A 2VHQA 3V9PA 3EQ7A 3L7CA 2RGEA 4JWTA 1Z47A 1I7PA 2HWKA 5KNCD 4BZWA 3FB4A 3TCXB 3IPRA 3MG9A 3WLNA 1C3EA 3P7MA 1EP1B 5BNZA 1B0UA 2VQDA 3V48A 1M1UA 3ASVA 5HKOA 4PLVA 1WB9A 1CJTC 4MI9A 1DJNA 4LX8A 3NHSA 4FHFA 5GAJA 2X42A 2IYEA 1O97D 1Z6TA 4RIGA 1X7WB 1NSYA 3LO8A 1PG5A 2OQIA 1KSHA 2VJNA 3RAEC 4CCSA 2CMGA 3GLHB 3KYCB 1TEXA 4XVQA 1E2NA 1GSOA 3R3HA 2GZSA 4NG5A 3W2GA 2YYSA 3IUJA 1PVDA 3FA2A 1X1RA 4TTSA 4ZV4A 4M8NE 1RMQA 3R7NA 2DE0X 2I4RA 4C0SA 5CX4A 5EEHA 2IXTA 3CVOA 3ZE1B 1VLMA 2FX2A 5D1NA 4IL5A 3U09A 4Z4GA 2COKA 3BJRA 1IJEA 2VCYA 5GONA 1YV9A 1J07A 4YJ3A 4P5PA 1UZLA 2J3MA 4KLRA 5FNVA 2F3TA 5JVDF 3N0XA 1YCFA 1GOTA 1RWXA 1Z6PA 2EV9A 2R4TA 1YB1A 3O95A 1XXHB 1ZXXA 1H69A 1QPBA 3OHPA 3IKLA 1QKIA 4O4JA 4C7MA 4K3VA 5L4SA 2CHQA 5G0SA 1FIUA 1E4VA 3IAFA 2ZWPA 5C8XA 1LDGA 4D9BA 3S8YA 2ANBA 1AS2A 4ZAYA 3TQFA 4LTNA 4MWTA 2FDRA 1TZBA 3SYKA 3TSOA 3SICE 4UE6A 3B60A 4G5SA 1ZD9A 5FL3A 1ZIPA 3CVYA 2WE8A 1MB0A 4A6PA 5F9MA 1XD2B 1ISGA 3RCBA 3E7FA 3B13B 3RW9A 2AMLA 2IOFK 3GFPA 3WL6A 2A0KA 5IN4A 1V9LA 3KPUA 1AUVA 3NRJA 4FLFA 4CIDA 3FI9A 2CNBA 3E15A 2AL7A 3EBLA 2OGZA 2XQJA 3BGOS 3DMGA 4IDAA 4NEHB 521PA 3D6TB 2KW5A 5J2TF 1QZUA 2AR0A 2BONA 1I14A 5CT9A 1KGDA 3OP1A 4OG2A 4XIIA 4N01A 5FQOA 2D0DA 1YZVA 4B35A 4B46A 2B30A 1EK0A 2AOUA 4LDRA 4A1OA 4F71A 4ZQGA 2VAWA 1H2ZA 3DC7A 2AN5A 2VSFA 3KQWA 3R4CA 4B71A 4ENUA 5FBVB 1CZNA 5JH7F 2GFQA 4PNHA 4WNYA 2NO0A 2YHIB 4RSHA 3U6KA 1ML4A 3LYHA 5JZVA 2WICA 4G0NA 4IOKA 4DV6B 3G5TA 3A3OA 3JVEA 4E32A 4GKKB 1FFXB 3IUYA 4ZMBA 2P9YA 3F5FA 4JZKA 4L16A 2NU9B 3V7NA 1CXZA 1TU3A 3ZHSA 5JISA 1JAIA 3FVRA 2O8EB 1PEDA 3ADBA 1RI5A 2VDMB 3ZJUA 3U3ZA 4KWEA 3SZGA 1ORIA 5CAEB 4HVCA 2NUPA 3V1NA 3QHPA 2O5CA 1B73A 3ISTA 3KJFA 3L43A 4OSPA 4PX2A 1UFOA 5E9QA 3RRXA 3V2GA 3V2UA 1Z07A 2QMHA 4ACBA 1O6GA 3VR6D 5DWDA 1GPWB 1OZGA 4F3YA 1M9NA 2XX3A 3A6JA 3T9AA 4ZZ3A 1L8AA 4J2TA 1ZGCA 1PZFA 5CJJA 4MMZB 3ZGXA 3EVDA 2UXDB 3BB4A 3PU6A 1GG5A 3NNNA 4HG2A 1PX2A 3OQIA 4JDPA 4D9EA 3QE2A 3AHJA 4YV1A 2XNDD 5L9AA 1AK1A 2PE5A 4IILA 5LYJA 4ZK2A 1VQ1A 2WNIA 5ECYA 3W5AA 4ZHSA 4CLOA 5KSZA 2OR3A 4JD5A 1Y3DE 3ZDEA 5D3MA 4PBSA 4YUZA 2FPKA 1DT3A 2BUBA 1O3YA 1VYVA 1P9LA 5I9NA 1DBPA 2HDWA 4M88A 2H4WA 2D3WA 2OQRA 3UG6A 1P1RA 5I4BA 2F67A 1IQPA 1WV1A 3U4QB 3RNLA 3U19A 4C7KA 1HEYA 2GZAA 2C42A 4JX9A 3TIGA 3WJ7A 2OHJA 2R79A 3AETA 3H2IA 5LP1A 4J4HA 4OB6A 2Y1KA 5KJEA 1NQXA 5C32A 4KVZA 3O03A 2NAFA 4DLLA 2GK7A 4NYIQ 5KVSA 1PWZA 1OX5A 5AWFC 2H9IA 4C0AC 4NV0A 3T61A 5K6TA 5KYUB 2DHCA 2F9LA 3ZCXA 4CF6A 3TG8A 1XXLA 3F73A 1LJUA 3UKJA 1OB2A 3K0AA 2OO3A 3RJ9A 3A4YA 2W98A 3FKQA 4JQOA 4X1IB 5K3OA 5E7MA 2AX4A 2BFDB 1J70A 1MJGM 2VJCA 3BREA 3SC6A 4NV1A 1O6CA 3ZWCA 1LRKA 2EZ8A 4O02B 4P84A 1OILA 4L8YA 4MQ6A 1EM8B 4IV8A 4RPCA 4X7PA 3ZU3A 4P92A 1ZUIA 3K96A 1ESNA 4CI0B 4BNHA 1NM5C 2YIDA 4CEJB 3TR0A 4GM4A 3OZGA 3FNRA 2X4IA 4Z4FA 1BE1A 3PRYA 3DFUA 4A5SA 5B6JA 4N9QA 4UVEA 3KUKA 3Q3IA 4MGKR 2HA3A 2G36A 1FFGA 1GGMA 1I3CA 1MVLA 1TK3A 2GRUA 4W8OA 2FZLA 1FTNA 1VI2A 3FVWA 3TD6A 4U1RA 4FFDA 3D4OA 4XRRA 3WXBA 4Y9UA 1V95A 4DLTA 2D0IA 1E32A 3FVTA 3PKIA 1EXVA 3NMUF 1JDVA 1XZGA 4CKEB 2IYYA 2YJTD 1XAHA 3OG9A 5B3AA 1XKXA 1T8UA 1ZCZA 3DMFA 3VTAA 3TB4A 2WPDD 4Q4CA 5CDFE 3W5UA 2F6RA 3B9BA 1YDGA 4PC6A 4HY3A 2GBLA 5AVKA 4JSYA 4B3SB 3RAPR 1NMYA 1T35A 2HTEA 3AFGA 4K9PA 4ZA2A 4OLAA 5J43A 5FOXA 3RS8A 5SYNA 1DDGA 1FLDA 4NP6A 4OYHA 1UMCA 2XLBA 4BDTA 1KQNA 2D1SA 2UKDA 3QMWA 1X38A 4W8HA 4QNMA 4RZIA 4KXNA 3ZPXA 4BNZA 2VT6A 2EG9A 4H0NA 4PYQA 4RBNA 4DDKA 2WWFA 2IS1A 1GQSA 1CVRA 2NO4A 1QRDA 2VDWA 3MEQA 2R6FA 4GI7A 5IYZB 2NU8A 1DC7A 3IESA 4MUBA 1PTJC 1Z13A 2OCDA 4YJGB 4IDDA 1SAYA 1RE1A 1XUOA 3K4PA 4DSOA 4ZTUB 2WUFA 3RS9A 2E0IA 1GAXA 4MARA 2VNHA 2IP4A 2A33A 3DE3X 1QZ3A 3A7EA 4HNRA 1DJMA 1Z7YA 4NK5A 5AKEA 5DPMA 5E7IA 4UBJA 2EKLA 3VVBA 1JU9A 1EJ0A 1J2TA 1FNCA 1MB4A 1CR6A 1WL8A 1VLQA 1OTYA 4CCAA 2Q7XA 1RWKA 2CHGA 2Q3BA 1E2MA 1U0TA 3G6WA 4YLGA 4DR2B 5CFRA 4XM1A 3L6EA 3OLXA 4BVKA 3T7IA 4OHOA 3RABA 1VXRA 1E2KA 3BICA 3ZXXA 1OWMA 4WXMA 3GT4A 3AP3A 3VOSA 1KF0A 1RM0A 3DZDA 3MMZA 2ADOA 3KEOA 1OQAA 1GNVA 1Z38A 3GZNB 3LUAA 2HXYA 1YRWA 3ZIAA 1KFKB 2HRBA 4LDPA 1T6XA 3H0KA 4P0TA 1UC5B 3G2QA 3AXSA 4HB3A 1T1EA 5BQ3A 4CMHA 5TVKA 4DGSA 2OCKA 1NC1A 2QN2A 4IJUA 4RA9B 3UMCA 3INTA 2C3UA 1GLNA 4EFDA 4IH4A 3KQTA 2I3GA 3GEIA 2QD4A 3ZIUA 3WRYC 3BXFA 4HDRB 3OLQA 3RFVA 3CA8A 4D0LB 3JRWA 3G2PA 1QM5A 1JFLA 4KQEA 3WJAA 2J0VA 1MC1A 1JBEA 4LRSB 2BFEA 2MINB 3BDVA 4N3GA 2ZIEA 1JIJA 5LBIA 3HLKA 1FMTA 3CZ9A 3BB1A 3MTEA 3JY6A 4KH0A 3PXDA 3I5XA 1GRQA 4FR0A 2NV2B 4WD3A 1IVSA 2Q4RA 1N2IA 4CV0A 5LXTA 5E4FA 1E3TA 2Z58A 4U9HS 2PJDA 1XVTA 2DWPA 3AVXA 4EJSA 1FQOA 4Z3OA 4C0BA 5EZYB 1HBJA 1NKSA 1N0WA 1NRJB 2FPPB 2IELA 1J2UA 2MYNA 4GE3A 3WNVA 3MK31 2AI3A 2B2CA 5DSZA 3CPHA 1FU4A 5LDDC 2WJHA 1EFHA 4P3PA 3GWGA 1U8XX 1S2DA 3FG9A 3I09A 4Z8YA 5EMJA 1U0FA 2JA2A 4HD8A 4KN8A 3ZKWB 2J5QA 5AW9A 2Z3WA 1U7PA 2W2PA 1JTFA 3L1IA 4QUIA 2ROQA 3ANTA 4PS0A 2HZ7A 5ALEA 5BUQA 1Y1LA 3IODA 1WLSA 3HR8A 5JBNA 5LIRA 4MVJG 5B4TA 1RLOA 1KI9A 2AQKA 1KL7A 2PWZA 2YBEA 4TKLA 5CD9A 2QLTA 4DMGA 4MDYA 1UXKA 2A1UA 5KTMA 4V0SA 5KNLA 5FA5A 2YIMA 1B8VA 3AZPA 4BP3A 1I9GA 3PUIA 1EP2B 4JLPA 4E30A 2EYUA 3G88A 3N5CA 4I9NA 3OTWA 4U63A 1EHIA 2DUJA 1PS9A 1LC3A 2HL6A 2XGJA 3GJSA 5I48A 5DCLA 4ZVKA 5ALHA 5I7SA 2X2OA 2XCTB 1HSOA 3M83A 5KYUA 2IS2A 5DNAA 1DRUA 2QK4A 1V71A 2Z3ZA 3OJXA 2W00A 1VJ0A 2GNPA 3PXGA 3QEAZ 1HZZC 1IH8A 3VPCA 2WJ3A 3PYLA 4BRSA 1A9XA 4PG7A 3H11A 4DDTA 4OQQA 1EXMA 1T9GS 3H42B 4KN6A 2N42A 2ZQYA 4FE3A 2QM7A 2XYHA 4ZVPA 4YRDA 3T12A 1MMFB 3VZBA 1QFJA 2ZJFA 3SCZA 3DTNA 3H1FA 4CT5A 4QHTA 3GCZA 2PWAA 4NZYA 3RKSA 2PJRA 3PPVA 3ICOA 2B92A 3VUEA 1U4OA 4H18A 1ADJA 4GIBA 1ODSA 2QQGA 3SNKA 1Y34E 3AI2A 4C7JA 1CP2A 2BH2A 1AF7A 3BRCA 4YV2A 3IIMA 2RI6A 2A9PA 4M83A 3IUQA 2XT0A 3MGBA 4PGHA 4BL5A 4Q18A 5EAIA 4MR8B 4ND7A 2FWPA 3LPAA 4H59A 4A2QA 3QEMB 3CZPA 3I64A 4KQ2A 4MVJH 5KTKA 3LKVA 2CUZA 4GBED 5K6RA 2IYVA 3EEBA 3EIUA 5KYNA 1YDEA 2C2KA 3FOWA 1FSPA 1W59A 2MSEB 4IV5A 2WZCA 3HRHA 1LNSA 2AN1A 3OFVA 3N2GB 1JLLB 2CVPA 2M32A 1SG6A 1CNFA 2NO7A 2Q6TA 5DGCA 1T6BY 3HUUA 1AZTA 3X1JA 3N6RA 2FW6A 2VF2A 4PWZA 2R1VB 4GD3Q 1XF9A 2TSYB 3AM4A 3PYMA 4MIYA 4MVJP 1DWPA 2IHZA 4Q5IA 2R6DA 2BPOA 2HRRA 5GONF 1XE3A 2DFKB 3SS8A 3QX3A 1CR2A 2IY7A 4JNCA 4I4TB 3GLQA 4ECEA 3KBBA 4LWZA 1O58A 4ITRC 3ZHOA 4G1EB 1EK5A 1F2VA 3LUGA 4OXNA 1CEYA 2XB6A 2HEGA 5BR8B 1ID8A 1A69A 3RVQA 3VPDA 1F4VA 4DM4A 1UJ5A 3A0UA 4QDOA 1A3CA 4HS4A 4CL8A 2PSSA 4BIMA 1CJSA 4L9RA 1TM2A 4IIYA 2AIRA 2ZCUA 4BUCA 4IFEA 1KJJA 1OVMA 3KPVA 1BD3A 1DBWA 1X80B 1N1GA 5C80A 3IXQA 4J0GA 4N5IX 2VUUA 1JKXA 2OBMA 1W0KD 3BWEA 1JIKA 2HA0A 4MS3A 1ZOPA 2IEBA 3JYHA 4C4RA 4E3ZA 2GJKA 1YVUA 3EEOA 2DR2A 5F1PA 3OWHA 1IXZA 1K4MA 4XPIB 2BEWA 1XD2A 1Z37A 3RK1A 2XYGA 1TCAA 3RLIA 1GLVA 2QL7A 1W0JA 2DUUA 2X0IA 1FTSA 3PKJA 5AK6A 5AKYA 3U4GA 5AI4A 5ALRA 2XB9A 2G40A 5AIBA 5BWCA 3SJZA 1HDEA 4N03A 5IEJA 1WLYA 4PO8A 2OBXA 3QWFA 4RH0A 3IIEA 4X0EA 1UWLA 4YAWA 2VHCA 4L5YA 1PYGA 3HFRA 3W4KA 1QIIA 4TYNA 4O3FA 4IQGA 4Y9SA 4B6RA 4M1SA 4YJ2A 4TL8A 1KZYC 2X5KO 2AOUB 4CLHA 1QFZA 2C1EA 5CA0B 2WKPA 3GEGA 1CUFA 4QM7A 5F2NA 1QMGA 1ZAKA 1T0UA 2F1RA 4C4AA 2IJGX 3THWA 2VP4A 4A0SA 3M89A 4F6RB 4J9UE 4F97A 4YQYA 1NYTA 2PT7A 3TPCA 1N2OA 3V97A 2N75A 3H87A 1U0HC 3HS3A 1GV1A 5DBHX 2BAGA 5B1DA 1MC8A 3CT4A 3UGQA 5F7OA 5ES4B 1BC5A 1KAHA 1FNSA 3COVA 1Q1GA 3DBRA 4B2LA 4GPD1 5KNCH 1MOPA 4FYIA 2I8LA 2Y05A 1I6MA 1VJDA 3BKWA 1Y4AE 2HPZA 4MYTA 4PLHA 4Q02A 3GARA 5K0LA 4MSUA 1Q95A 4R8MA 5C51B 2YY7A 3LPMA 2QN1A 3ZXUB 3NTLA 4G84A 3L04A 5J5AA 1PJ3A 1SURA 1MRZA 3V1TC 2BKEA 1W0JD 1TGYA 1A82A 1KE1A 2XMQA 4XLLA 5AXDA 1ZIYA 2JIZD 3MTIA 1TT5A 3N2KB 4YI3A 1AS0A 3GDWA 3WBJA 2HA5A 5BOSA 4QM6A 2X8BA 2ATXA 4LGYA 2DVMA 2BFNA 1PT7A 5HK8A 5D3QA 3UANA 4BMDA 1DKOA 1GGNA 2HV8A 2Z6UA 1VECA 4WL0A 3WFIA 3O9ZA 3CXUA 3D3WA 1VPVA 3CRZA 5EE3A 3ZLUA 5CB8A 2CJXA 4XIGS 1QX4A 5LB2A 1BMQA 2BFCA 3LBHA 1MF7A 3RI3A 4CTMA 1OF1A 3B1WA 3OU6A 4KDRA 2J7KA 3R9XA 1BA3A 3PPXA 4BX2A 1WCXA 4PQEA 1AQ6A 2C9MA 2ZANA 4HSGA 4WFQA 5HFJA 5TT0A 5A04A 3DP9A 2I8AA 4DR5B 1CVIA 5FR2A 2ZB3A 5KCMA 2JFGA 2ODEA 1HI9A 1RNLA 3CF2A 2FR8C 2PGAA 3L2OB 4G0XA 3FLBA 2XT9A 4AMVA 5IC4A 3C1AA 4ZVTA 3UJDA 1PF7E 3QPBA 4Q9DA 4QQFA 2IHVA 1NDQA 3HSSA 3IJ5A 3IT3A 3P2YA 2Z1DA 3EQ6A 1YVDA 1XRLA 5FULA 1ZD5A 3HP7A 4J0KA 1L7OA 3GFRA 2Q0XA 4MA4A 5ENVA 1HNZB 1YA8A 4DTIA 1R6BX 2PNJA 1LA2A 5LLSA 3KU4A 4L9AA 3OC6A 1T15A 4HLQB 4L0MA 5PNTA 4AN1A 3HNPA 3SHOA 1XP8A 1FEZA 5CHYA 3ZDXB 2QRNA 3HB0A 3H9CA 1WHTA 4J1SA 1WQ3A 4JJ8A 3ZV3A 5JSUA 3KJXA 4O2AA 4NE2A 1ORRA 5A9SB 2PK3A 2L69A 1W5AA 3KYCA 3NC0C 1JJ7A 4NNOA 2A5LA 2ZRLA 1MVNA 4UVHA 5CEFA 4AKIA 1VBNA 5BURA 2ZYTX 1W4ZA 2P2GA 2H8GA 3I4FA 3PKZA 1PYDA 2NQ2C 4PANA 1GU1A 2E21A 3CRNA 1EGVB 4BO3A 4DDUA 1MJGA 3BYZA 3DLPX 3TKYA 3MIIA 2GFHA 4W1PA 1OH8A 1CEQA 3AM5A 4FNOA 4R8LA 5C4IA 4DMFA 3TZ6A 3I61A 3DZFA 4FGUA 1VIYA 1KVSA 3FD8A 2BKLA 1JHPA 2NNWB 2VQ3A 3L0OA 4TT8A 4XLTA 1N1MA 3AESA 2XRFA 4WLEA 3AR3A 4UDYX 5IDYA 4YDSA 4RD6A 2MMGA 1YQ9A 4H7EA 3K09C 1PRYA 1OYWA 2P9CA 3Q87B 1W8IA 2XUFA 3GRRA 1W88A 4HNSA 4NDAA 3W7BA 1B3BA 1JQKA 3DAFA 4YAJA 5E8JA 3UOWA 2IEDA 1I13A 5H16A 1QYIA 2WI8A 2NU6B 3GZJA 3LDHA 3VAYA 5KYXB 1V43A 2YOFA 5KVAA 1UQTA 3QIVA 4KQ1A 2C4VA 4UHCA 2PDAA 4WE3A 2MSWA 4C6HA 2GK6A 2GHIA 4P33A 1O77A 3PVCA 1AGXA 1IL0A 2PWYA 4E5KA 2P2LA 1WB5A 3KOXA 3QLVA 4NJEA 1DGQA 2VNSA 4D74A 3UK6A 1MO2A 3VHQA 3KJQA 4ND4A 4EA8A 2VBIA 5EZYF 2Q5OA 3ADKA 4FHCA 5EZSA 4D44A 2WUGA 3DLBA 2IZ5A 3CXRA 3W2TA 2QAIA 5G0WA 2VTEA 3UK7A 4RLHA 1W5SA 1FJ2A 2HSZA 4B0PA 3WK9A 1M83A 3MHPA 4RA6A 4WY5A 1EJBA 1V3TA 1GPJA 1SY7A 3RUHA 1X15A 4A26A 4DPKA 1X3LA 3R0IA 2ZCVA 3U7QB 1DFIA 1TYBE 1YF3A 2PL3A 3IAEA 1J56A 1T8SA 2DPGA 2LW7A 4TL6A 4ZI5A 3VJLA 3AEZA 4KIGA 1ATIA 3CLUC 1GGKA 1R2QA 4DGQA 4K9RA 3ELWA 5DFAA 5J40A 1OLOA 2ET6A 3EDRA 1SCBA 2GYUA 1R0ZA 1CUSA 3E3MA 3FZYA 3EPKA 5FQNA 4EECA 2MCFA 2WT4A 4QUHA 2QTNA 4P6VF 4ZHQB 5IFKA 3E7PA 3PWSA 2C4WA 4PIVA 1RRVA 4XYLA 1OI3A 3ZCTA 3BCSA 5DCUA 2MSNA 1EWYA 2VPTA 4F4UA 5JI3E 2AEEA 2NU7B 1DWQA 5FI5A 4S24A 1Z74A 1SHUX 2M9MA 3DFIA 2W6ZA 5CM8B 3HYCA 1SD5A 2GBCA 1WXQA 1N8SA 1WMAA 2SICE 3LCRA 3OTGA 2X0EA 4D9KA 3ZGZA 4MW0A 1VE9A 3RC7A 4E5DA 3BRWA 3E53A 3WLFA 1QF6A 2O8BB 1KYIA 2AW5A 3FYUB 5I7UA 2CVOA 3AT1A 5DSTA 1SU8A 1U6IA 1PSDA 1QDUA 1Z7GA 4DSUA 4D8VA 4KXQA 5B53A 2IYRA 2ZULA 5EUQB 1U81A 2XMDA 3LBFA 4FS3A 3TCKA 3I32A 1DKPA 2DHQA 2HDNB 4PHTA 3GPBA 4RYLA 1AKRA 1EEXB 4W82A 2YWEA 2M6SA 1A96A 3FETA 3LYLA 3DCIA 5C34B 4K1LA 1KO1A 1EJ2A 3VPBA 1V26A 2EZ4A 4BE4A 3LOUA 5FTLA 2V0NA 1IPFA 1CD5A 1R64A 5ENDA 1E1DA 2OZLB 5T4FA 5DNYB 4M36A 2FPIA 2RCYA 3COJA 4K8OA 3U9LA 3C48A 3S1LA 1Z4MA 5DASA 4Y1FA 4C22A 2F48A 2YZGA 4QECA 3QVVA 3RNOA 4A0GA 5JFTA 5LKRA 3KZCA 5IDXA 3WGUA 2FQWA 3V8RA 3V4ZA 3OBBA 1QP7A 2HCTA 1T26A 4C0KA 3AL0C 1RHJA 1MO4A 1DRVA 3IP5A 3L0ZA 4H08A 3LBYA 4G0MA 5E0KB 1IMOA 1US8A 2QGZA 1FMJA 4H7HA 1OFUX 2ZIZA 3INNA 1TUBB 2IYLD 1DBRA 4CM9A 3BK2A 1E2UA 3HWWA 3SIPA 1GPMA 2X41A 4GOXA 1AX9A 1RP1A 1ODTC 3RTBA 5KZMB 1F1JA 1XK6A 3A1DA 3ZE7A 1K4KA 2QM8A 1QHGA 4URXR 5K0TA 3K0AB 3W8EA 1CZKA 1IN1A 4YRZA 2YJ5A 4PPNA 5EJFA 2AJ8A 3A9WA 4X6XA 1NOIA 4OI4A 4AN4A 3KWMA 3ZZ1A 3ZWPA 4YV0A 2HWWA 5LQCA 1YB2A 1C1XB 3BJIC 3MMPA 4XQ0A 3ZK8A 4DR1B 3W3AD 1ZM2A 3IHKA 1UMBA 3A58B 4B2IA 4D3DA 2JDIA 4D4MA 1AN9A 1MB9A 4M0UA 2YJ6A 4RCZA 1NMSA 3NTRA 3SFTA 4DZZA 4G1MB 1ADGA 1LK5A 3LDFA 3V8QA 3FTNA 3T99A 3N1UA 3HHEA 1XGKA 3A1SA 1PGNA 3RIMA 3SOPA 4Q7LA 3B6EA 2CNNA 3HSYA 3E22B 4ZJPA 4E46A 2FXIA 2ZI7A 3KNZA 4K9OA 4NCKA 3ZHBA 4QGFA 3GEEA 1G66A 1NUAA 4M7PA 2AK3A 4EYSA 4GRDA 3OWXA 2X7JA 3CEPB 5CVDA 2JLQA 5ALXA 4KQGA 1X3SA 2MT9A 4E5VA 2ZDGA 3GLSA 3ZNPA 4JSTA 1HYEA 4LPKA 1NNEA 1VYUA 3GF4A 2ZBDA 1W5FA 4FZJA 3UEOA 5LZ9A 6ABPA 1BVHA 1XQ6A 1AZSC 1T6YA 1JS1X 3UT5A 3F6BX 1TB4A 4MIOA 3STHA 2B8JA 2X4DA 2H2DA 2YMMA 4EENA 2VYND 1YCHA 4DR3B 3O8BA 4D5GA 1HLDA 1PZNA 2ENUA 5K0CA 4WECA 2HA7A 5FLKA 4QQKA 3EC1A 2BI4A 1BU5A 4CKYA 5CAEA 2C7VA 2UZ1A 1NFQA 1QIFA 1RQPA 2L2QA 2EZ9A 2FQQA 4BY9E 3SOZA 3GRUA 4NBUA 1R5BA 3ITEA 3TAXA 1PCXA 1CRZA 2LVBA 1N5MA 2EARA 3ZDYB 1Z6GA 3ZNOA 3RGGA 4Y7DA 4HWPA 4JLWA 1ZSNA 5HP4A 3NU1A 1TMKA 3DTVD 1XMQB 1MC4A 3LUDA 2HXGA 1BGXT 3M2PA 3TI7A 5LYJF 3VU9B 3IVCA 4L4UA 5U1PA 5HRUA 4OHZA 1F5NA 4HLUA 2ORVA 4XTCS 2ZB4A 3GA5A 2C7PA 5EEGA 1R5NA 3SHFA 3UUWA 2P2CA 1LPPA 2C9OA 1DG1G 1KDRA 3FGNA 3N0VA 4N9WA 2VJPA 4Q3DA 1DE0A 5GY7A 1VP9A 4AROA 1LKZA 1Y33E 2VDNB 5FHQA 1Y1QA 4YHHB 1BSVA 1U2ZA 4G5QA 3D7LA 4KQWA 4KR0A 4NMLA 3ODPA 4F04A 8OHMA 3FDIA 3UAZA 4EVIA 3FUUA 3MCAA 1A5BB 4BC0A 1LPSA 2AUTA 3ZHQA 1D2GA 2WMNB 1OXSC 4JS0A 4F4JA 2Y1LA 3CTPA 4K6MA 2BFMA 3ESDA 4QODA 2QLNA 3NGXA 1I2AA 3HYLA 5JDCA 2E4ZA 5JDIC 4ERXA 4KREA 1FU7A 4NCXA 4HSEA 4CLOB 3BHIA 3FTPA 3RUAA 1UXOA 3AHCA 3O1JC 1M2HA 2P3LA 2X9VA 1EG7A 2JIBA 4XPZA 3G1WA 4Q3KA 1IEXA 2VUHB 3KDAA 1GL9B 5LB4A 1OFIA 2Y8EA 5LMCA 5HQ3A 1DG9A 1EESA 1WA5A 2ZRIA 1ZZEA 4HQFA 1E5LA 5LQUA 1S2GA 2QPLA 3IEPA 3NASA 1J9ZA 4FEGA 4RK6A 3WWDA 1YUMA 3T15A 2OLEA 5F3WB 2M1ZA 1NDUA 2I76A 5JRDS 2XRZA 1Y9EA 2Q4OA 8LDHA 2D5BA 4U3JA 5FUXA 4Y6GB 4LF7B 3EA4A 1C7IA 3ZHZA 1IHYA 4G67A 3WLTA 4C4ZA 3U6BA 3B20A 1UPCA 2O2GA 1CWUA 5J4VA 2F9FA 2J45A 1GUZA 3CZ5A 5D00A 4G85A 4QX6A 2WWRA 2YDYA 3D9QX 4X5OA 3FGOA 4LDAA 3WGZA 1D7OA 2FFJA 3IUBA 4FYMA 1DS6A 4INJA 4J0DA 3PX7A 2HMUA 5H80A 3T5MA 5FWXB 2ZUUA 5TQ0A 1OYOA 4S1PA 3I9FA 3T9CA 1ZJJA 2G77B 2EF1A 1SVSA 4MAMA 4N5LA 4TV8B 1C7FA 5JYBA 1VJGA 2Y76A 3SLGA 1GGJA 4EELA 5LFAA 5TQ2B 3I1IA 1Z26A 3Q2IA 1GM5A 4X24A 2I7VA 4EHNA 2C4HA 1V6SA 2I2WA 2JGEA 3FIUA 4ZO7A 1A1SA 3M1AA 4RHYA 1VLHA 4XGIA 1G60A 2IH2A 4Y1RA 1KDVA 2YCLA 2IOQA 2GWHA 4II7A 3G02A 1LI4A 1WMFA 4U9UA 4EKNB 4DT1A 1N32B 1MR3F 3TIFA 5JYDA 3NCTA 3B8EA 3JZMA 1E7MA 4B3HA 3DDWA 3FSJX 1GDDA 4PSVA 1DC5A 1T5DX 3CUYA 3L0CA 5KVCA 2AI1A 4FOOA 4MQBA 1JG1A 1PW7A 4BE9A 4RD4A 1MB3A 1ZR2A 1ES9A 3P20A 5K8LA 1EK2A 2I2AA 3PHCA 4C30A 3HB7A 1X1AA 3TMAA 2C57A 4OMDA 3UCXA 4KCGA 4WA8A 1XTRA 3I2YX 2CLMB 3OO0A 3OY7A 3PDUA 3QBJA 4MEJA 4AX8A 2XT6A 4LZZA 3WB2A 1CY1A 1OA1A 2X3UA 2YUIA 4LZPA 4YRRA 1KBZA 3DVAB 1XQ1A 4BFVA 1JWLA 2YRFA 2H1OA 4HZUA 1Y63A 1UM9A 4IJKA 1THGA 3ZDBA 5AVWA 2OENG 1SXGA 4Q4HB 3D5QA 4DE5A 1W76A 1H2EA 4I50F 5LD2C 4C0HA 4NZOA 5IF9A 5ICFA 2CXQA 2PGLA 4B4KA 3BF8A 1VIDA 1RXEA 1UANA 1N2HA 4FFSA 4Q01A 3RUIA 2I1VB 4CM4B 2H2AA 3L0PA 1Y9AA 3CLTC 5HZKA 5JAPA 4XSHA 3OQ1A 2OZVA 3LS2A 4G0VA 3ADOA 1Y8RB 2E4UA 2HZBA 3G2JA 5B1SA 3W04A 2EJWA 4DRZA 2YWJA 5F9HA 4W4TA 4BKQA 2QN6A 4N0DA 1QFMA 3ZN2A 1C14A 3H5LA 1QQBA 5JD4A 4RDHA 1EIWA 4RTRA 3OSZA 1E0SA 3NM6B 5A3QA 1RSZA 3C4JA 4FGJA 1KZ4A 1BCSB 4LRUA 4F7WA 5CPBA 4J49A 1KRXA 1PEYA 2ASVA 1QK5A 3C1OA 2OA0A 4BU1A 1ATZA 4C3UA 5JJ5A 3KTAA 2VL7A 1EFLA 4LOIA 2IXDA 4D1YA 4BZPA 1G2PA 1NVXQ 1WSDA 4IDOA 4LQLA 5GADl 4DCJA 1YS9A 1JFFB 2OHOA 1GWNA 1Z5GA 3D7SA 3GLUA 3I45A 3JD2A 3FZQA 3LT0A 4LOLA 5A6SB 1EFDN 1TEVA 1W8DA 4IIDA 1ST3A 4Q1DA 1XTUA 4KGDA 1P45A 3DKVA 4MPTA 5CDYA 2FPRA 1JG6A 4GNRA 2O8VA 1JPVA 4L8VA 4Q16A 5FBLB 2XMSA 4TSRA 3HP4A 2VR1A 1I4EB 1KY4A 1PTJA 4LYDA 4RQBA 5IZ4A 5D6OA 3OOEA 4K87A 1JSXA 2ON6A 3H5WA 2NYUA 3NUQA 4NARA 1Z2DA 1T4GA 3TW0A 2D7JA 5J4HA 3RKUA 3QF4A 1BQ3A 4FFBB 2C98A 2NWQA 3AOGA 3IAUA 1Z4QA 2FPMA 2WIBA 2B4AA 2AC7A 4J1TC 2EX4A 4O2BB 4Z9BA 3SS7X 4L74A 3VZDA 4BNTA 2CD7A 4BX9A 1GFZA 4A36A 3Q0IA 4FD2A 4CUKA 2QP9X 3M0EA 4W5OA 4OHBA 1F8XA 1CCWA 4RV9A 4JQYA 4EW2A 1BYIA 1QIHA 4YP1A 3T7EA 4ANFA 1HY3A 2Y0EA 4G5OA 4ZI2A 1R0BA 3EGDB 4MKHA 2VRCD 1FRZA 3D3WB 1B42A 2I9KA 1ZU4A 3TO5A 2RGDA 4MVJM 5JLAA 4F6RA 1X9HA 1ZIDA 3VSCA 2FX3A 2H0QA 4DW8A 4NS1A 1W93A 3TSAA 4I3FA 2K4MA 3DL2A 2XTZA 4FQ7A 3QPWA 4AJEA 1PFKA 4BVHA 4CQMD 1A88A 5EWJB 2IIBA 2VJDA 1U80A 5T8KA 5KX5F 2Z43A 4KPEC 3G5AA 2IHUA 5KYWA 1FFWA 1Z83A 1RYZA 3AY6A 3ZCSA 3H0CA 1XK7A 4DBLE 3LLCA 2BFPA 2QENA 1NG9A 3CX3A 2FCRA 3F2IA 3IBTA 1M34E 3QE4A 3TJRA 4LJ7A 3EUAA 5ALJA 1AO3A 3SKVA 4M8KA 4RAQA 1XT6A 5DWQA 4EQ6B 5AJVB 4BGVA 4Q3OA 2A5FA 4JK3A 1OT3A 3QJ5A 4QDZA 4BO5A 3AQ4A 5B12A 1KYZA 1K68A 4B45A 2PSFA 3N07A 4V0MA 3JQEA 3FF4A 4LKRA 4LYGA 1ABFA 2FI1A 3T3MB 1PR9A 3IELA 3KG2A 2J6BA 3HP1A 4RELA 1TQ2A 1V16A 4TKUB 4G0PA 3KLPX 4UBMA 5AXCA 4BB9A 2F17A 3OHMA 4LGVA 4ESHA 4G2TA 3PXXA 2V4UA 2OO7A 1WXIA 4NOLA 2Q21A 3TQQA 4YYEA 2WOOA 2ALJA 4TKVB 5BN1A 3S27A 3A25A 2Q0HA 2VP0A 3BGDA 2PGXA 2CE7A 4JBXA 4YGXB 5C8YA 2IXBA 3QG1A 3SYLA 1JILA 3L7LA 3USES 2AOTB 3DDUA 4V1CA 4X8HA 4Z9AA 2FUG6 4FLMA 1R8JA 3NHRA 1YR3A 1DTSA 1Z2PX 2Q46A 2X23A 4PHFA 3VO1A 3GFOA 3HXTA 5G53C 1NE7A 4DJ5X 2R48A 2WNSA 4RKWA 2O06A 2V9CA 4P82A 1QF9A 4JI7B 2WV7A 2Q4BA 3F90A 5AQ1A 3BEDA 4OJKA 4B48A 3GCXA 3U48A 5DM4A 2AG0A 5J4LA 4ZZ2A 4ZFNA 3C8ZA 4V2UA 3RFUA 2C77A 2FUNB 5H70A 2ACKA 4HXEB 5HIJA 5ALLA 3J7AC 5EZQA 2G5CA 4ON9A 3NZEA 2CYAA 4XJVA 3AY3A 3QKSA 1E3DA 4PZEA 3AF0A 4KR9A 3O3MB 4RY2A 3MWGA 1KQ3A 3RFTA 4R2WA 3FOZA 3OCYA 1V48A 4DNFA 3IURA