4MWSA

Crystal structure of human ppca (trigonal crystal form 1)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal protective protein
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwsA00
4UPDA 5ISMA 5LLSA 1XRQA 2GBFA 4DMKA 2J3DA 1QGED 4Y2RA 4UHBA 4OSEA 3HJUA 4N8EA 1VE6A 3CN9A 1NX9A 1ZD3A 1XZCA 1XRRA 2XUKA 1HBJA 4ZV9A 1W4LA 4PV7A 5AKYA 3H2HA 1TK3A 1Y37A 3IUJA 1KEZA 1GPKA 1CQZA 3H18A 3R41A 1XRMA 2ROQA 2QZPA 3AIMA 4C4XA 3I2JA 3FLEA 3FSGD 3PI6A 5AKIA 2I03A 2XUJA 1L7QA 5HQ3B 5HFAA 4GBGA 4UBNA 1PV1A 5AH0A 2C5GA 1XZMA 4JUIA 4KRYA 1K63A 3QH4A 4Q3LA 2XB6A 1ZD2P 1TRHA 5ALSA 2D5LA 4CIAA 4A5SA 4G4JA 2XUHA 3H04A 1CUXA 4Q3OA 5AKHA 2HA2A 1GKKA 3HI4A 2JGLA 3V9AA 4CG3A 2WIJA 5LZ5A 3OURA 4JNCA 3VJKA 2JGFA 1VLQA 1W76A 2VJBA 4QEKA 5K5EA 3DNMA 1MTZA 1N5RA 2QS9A 3RARA 2PM8A 4MQMA 1TCBA 3SK0A 2QMQA 1UK6A 5A2GA 5DJ5A 4CI9A 3ZI7A 3I2KA 3S8YA 2QXTA 1GT6A 2HA5A 4BVKA 3BXPA 3A70A 4C88A 5HK8A 2ZSIA 3IUMA 3VISA 5IVIA 3WWPA 4ZREA 3I2GA 1LPMA 1XQYA 2HADA 1Q83A 1QIJA 2Q0XA 2CMFA 2OGSA 2ACKA 3BDIA 3BDVA 3BWXA 3EIOA 3LIPA 2EDCA 2PUHA 1QO7A 4B80A 2PSJA 4BB0A 2G4LA 2ZJFA 2HU7A 1CUUA 3E3AA 4X91A 3WI7A 4BP8A 3H2IA 3WK9A 4I3FA 2JIDA 2QKYA 3M83A 4Y7DA 1Y7IA 4FBMA 4CCYA 4PSDA 3G0BA 2WQZA 3L1HA 4B9AA 2WHPA 5ALXA 4BE9A 1YB6A 4ARBA 4U2GA 5FV4A 3G8YA 1TCCA 3A2LA 3QMMA 1SCIA 1WM1A 1X2EA 1BEEA 3O0DA 2PVSA 1UKAA 4FNGA 3LP5A 1EB9A 3I28A 2J4CA 3GFFA 1JMYA 3AZQA 4UBKA 1CV2A 2WUGA 5ALGA 2OAGA 3CCBA 3GUUA 5JYCA 2E3JA 2WHRA 5FUMA 4BRSA 3QVMA 1DWQA 2OGTA 3BL8A 3C5WP 1A8SA 4UFOA 1N1MA 2I3ZA 4K6HA 3EQ9A 4W1SA 1CUDA 4U2BA 4PO3X 4Q1VA 2WKWA 4Y2JA 3IIIA 5CH5A 2ORYA 1G5FA 3KXPA 4BCDA 5JAOA 4UHCA 2DHCA 3BIXA 1DX6A 2JGMA 5CT8A 4Q82A 4QDUA 4G4IA 2YYSA 1FJ2A 4FOLA 4Y2PA 1U8EA 1J07A 2XLBA 4OCZA 2BGNA 1G42A 4BCCA 3TEJA 4X92A 4XX1A 2AJLI 1XKTA 3W9BA 4QWMA 1ISPA 5K3AA 1LPOA 2DHEA 1FFCA 3I2HA 1ODCA 2HA0A 5AI0A 1JI3A 1EA5A 3B5EA 5FOQA 1YB7A 1ACJA 3CCCA 1ZGCA 1AMNA 4BP9A 4KAAA 1NU8A 4C6HA 4P08A 1XRNA 5AKKA 5HK9A 5AJHA 1QIMA 1BU8A 1GGVA 1XZIA 5J3JA 4XJVA 2XMDA 1VA4A 5E4YA 2GYWA 3IA2A 2I3DA 3NWOA 1W6RA 4UBIA 3WL8A 3FYTA 2VT7A 5AP9A 4OYYA 3C5VA 1CUAA 1LPBB 1ZJ5A 5JADA 1OILA 1CPYA 4G8CA 1EDBA 4H7EA 5JARA 4K2AA 4BC1A 4IH1A 1SCKA 5DYWA 3EF3A 5T4BA 4BVJA 4B85A 4M0MA 4DNOA 1VA5A 3QPAA 3I6ZA 5I7UA 5AK4A 4BYMA 4A16A 2WFMA 2PU7A 4Y9SA 4QDTA 3WWDA 4G1FA 2QUAA 1Y7HA 4WDQA 3G0IA 5LYYA 4X3CA 2X76A 4DSZA 4OYLA 3H0CA 2XT0A 2JEYA 4AMZA 3PFCA 1UWCA 4BCBA 1R3DA 4QLOA 5JZBA 5HCUA 2WUEA 4GHWA 5CH3A 5AM4A 4HS9A 3SX4A 3KDAA 2XUAA 3HZOA 4KE8A 1XLUA 3ANSA 4Z49A 2UZ0A 5HFNA 5HZGA 1CUWA 1ODSA 1UXOA 4O08A 3QYJA 4DM7A 5A7GA 5DWDA 1H2XA 2CKMA 2GZRA 5ALDA 1CUYA 5I9IA 2C4HA 4HTAA 2RHWA 5DTJA 1R9NA 3G02A 5JD4A 1DWOA 4U2DA 3F67A 2PUJA 2XQIA 1WHSA 1L7AA 5AM2A 1IZ8A 1XLVA 5AI5A 1YS1X 3DYIA 5K3DA 3WKBA 2WTNA 1CR6A 2Z3WA 2EEPA 1AGYA 2B61A 4GDMA 3ZV7A 4GLBA 3STTA 1A88A 1CUGA 3M82A 3I1YA 4J0IA 5JAPA 2ZYIA 3VVLA 4IO0A 5BV7A 1LPSA 2WLSA 4CCYB 2WIDA 4X97A 2OPHA 4LXGA 3KD2A 2PSEA 5AOCA 3NUZA 3G7NA 4BAGA 3W05A 1AURA 4S0XA 1RYYA 2ZYRA 2WILA 5K3CA 1UKCA 4BAUA 2Y1KA 3WZMA 2VJAA 3AUKA 3TRDA 3UMJA 5ALPA 1G66A 1F8UA 4RE6A 1WHTA 4EY8A 1XQWA 3A2NA 4FNMA 4UFNA 4H7IA 1XKLA 1UK9A 4Y2QA 4INZA 3FVTA 1L7RA 3S2ZA 5AHXA 2NW6A 2EDAA 3FVRA 1F0NA 2WFLA 5IVKA 4Y2VA 2XQFA 3A6ZA 1FFAA 1SCQA 1HKHA 1XZBA 2CUTA 4LYDA 1EHYA 5LIPA 4W9RA 4NS4A 3EQ8A 4RNCA 5EIAA 4WCVA 4E11A 4ZXFA 4CG1A 5ALTA 1MJ5A 3D59A 2G5TA 5F4ZA 1E8DA 1B41A 1ZI9A 1VZ3A 1H2YA 2Y6UA 2WHPB 4FLEA 5FP0A 3I2IA 1QIDA 1YASA 3WKDA 3MUOA 5CRIA 3MGAA 4OU5A 3QMWA 2QM0A 3LS2A 3ESBA 4K6KA 2AJ8A 3LIIA 2WSLA 1SFRA 4RPCA 4QZVA 1XZAA 3WA7A 3BE8A 1F0PA 2VAXA 3E1GA 1VXRA 4CFSA 1XZFA 3D2BA 5HF9A 3RK4A 4EHBA 2HU8A 4FTWA 3AIOA 1OXMA 1R9MA 4DTCA 2XE4A 5CT9A 3FLBA 4OPMA 4AX4A 4B84A 1DTEA 2OCIA 5JIBA 1DT3A 1CLEA 4B82A 4AO6A 5JZSA 4ZRDA 3VKFA 3L1JA 4BE4A 5CT4A 2HL6A 1ZOIA 4ITVA 5FRDA 3VDXA 1GQSA 2GZSA 1K8QA 3QM1A 2VJDA 3AZOA 4FWBA 4EBBA 1K5PA 4MYSA 5JAHA 2XMZA 5HQ3A 1ZI6A 4Q34A 5KBYA 4UUQA 2WUDA 4WFKA 4G8DA 1CUHA 1EX9A 3I6YA 2PPLA 2QXUA 5LZ9A 1QTRA 1TCAA 4W1QA 5AOAA 1MN6A 3G9UA 3ZPXA 1YA4A 3IURA 1EXWA 2WIFA 3F96A 3PE6A 5ALEA 2QJWA 3AIKA 1TAHA 4H7JA 2O2GA 5LZ2A 1USWA 4TGLA 2PSHA 5BWCA 5C7YA 2AXEA 4QWWA 5D3ZA 5YASA 2XMQA 3STWA 2Z8XA 1CFJA 5AM1A 1CUSA 1MU0A 2WG0A 3QITA 3RKSA 4LIPD 1UK7A 4H7KA 3OC0A 1P0PA 1LBTA 4FFWA 1UFOA 2CBGA 5E4TA 2ZYHA 4RGYA 1FFDA 2W6CX 4EY4A 2VT6A 4H18A 3STXA 3ILSA 2RI6A 3M81A 1LZKA 5LZ7A 2OAEA 5AI4A 2FJ0A 3WMRA 2OCKA 1U2EA 3PUHA 4ARAA 3RLIA 3E0XA 2YH2A 1XZKA 4X94A 3LCRA 3FYUB 1ETHA 4QE3A 3STYA 4Q3KA 4L3WA 4HXEB 3VJLA 5ALOA 4P92A 1LPPA 4RE5A 1QJ4A 2V96A 4OB7A 2DFPA 4J3JA 3VXKA 2B9VA 5ALIA 4M0FA 5JANA 2G63A 1U4NA 1D07A 1EDDA 3U1TA 4A23A 1UKBA 1W1IA 2V98A 3WKEA 3VJMA 4MYDA 3TGLA 2DR0A 2PU5A 2IIVA 3DYVA 5A6VA 7YASA 3W9UA 5ALHA 5ALLA 1XZLA 1J06A 3CN7A 1A7UA 5DNVA 4WDRA 1VOTA 1ZIXA 3G0GA 1RWQA 4KYVA 4F0JA 4HRXA 3WA6A 3ED1A 5EIHA 1MAHA 2QVBA 3G9XA 5JZ9A 3H1AA 2GBIA 3IDAA 1BRTA 3BF7A 4B7ZA 5I8PA 3D0KA 4ZI5A 2H9YA 3H2JA 5LKAA 5IKXA 3DEAA 3OTQA 4BDTA 5KREA 2JGEA 2LIPA 5JD6A 4PSCA 1ZICA 2Z3ZA 3RM3A 4BVLA 1XLWA 3BJRA 3K6KA 3YASA 3C87A 5CH8A 4HVTA 1WB4A 2HA6A 4IH9A 1XZDA 1XFDA 3AZPA 4GWLA 3FWHA 2FX5A 2ZJ7A 4GW3A 1ACLA 3QZUA 1EK1A 2C0QA 3DL4A 3GA7A 4E46A 2RHTA 4X6YA 3WL5A 2ZJ6A 1LPAB 1DU4A 3DOIA 2WIGA 2XMBA 3DQZA 1CUFA 4KAFA 2VA9A 3C8HA 1CUJA 4C87A 3WKCA 1OCEA 2P8SA 4FKBA 1DX4A 4E14A 4FBLA 4G4GA 3O4HA 3B12A 5CBKA 2VTVA 4N5HX 1H22A 2DCMA 4X93A 2VJCA 4UHFA 5SYMA 4J0KA 5ALMA 4B9EA 2QOEA 1DWPA 1THGA 3R3WA 4IQ4A 4MWSA 2GYUA 1GQRA 4J0CA 4DMHA 3DKKA 4JEIA 2GBGA 1N5MA 3IVMA 4WFIA 2IITA 2PKYX 2VSQA 3DS8A 1BROA 5E4JA 4CG2A 3C45A 1QIGA 1A8UA 2Y2VA 2OCLA 1AKNA 3DCNA 2C7BA 4EA6A 5EGNA 3F9CA 3JYHA 4OUKX 1R4ZA 4H7FA 2K2QB 2XLCA 3KOOA 5BOVA 1T4MA 5AI6A 4DNFA 2XUFA 1GZ7A 1PJAA 4H7DA 1Z68A 4I19A 3ANTA 3F8SA 4AZ0A 4K6GA 1QIHA 3PFBA 4UBLA 4AB1A 2HFJA 1JJBA 1VXOA 3HABA 1EB8A 1QIEA 3FNBA 5KWIA 5AK3A 1XZEA 5DTIA 4B0OA 1MAAA 1UK8A 2DQZA 1LLFA 1HL7A 1ODTC 4Y2TA 4IHAA 1YA8A 4P9NA 3WYDA 5C8ZA 2V9ZA 4X95A 4MXDA 3G9ZA 4J7AA 1DQYA 3CXUA 1WPRA 4AN0A 3IB3A 1HLGA 3DDUA 5ALRA 3C8DA 3WIOA 3DD5A 1LNSA 4EY7A 4WJLA 1GPNA 2I78A 3R3YA 1JU4A 1UT6A 1JMKC 2VEOA 4KAJA 4OU4A 3F98A 3O95A 5A71A 5ALUA 5AM5A 5JATA 3IBTA 2PL5A 3HRHA 4U2CA 5AKJA 5HF8A 1QIIA 4MJ3A 3R3ZA 4X6XA 1H2WA 1HDEA 2B4KA 1LPNA 1XZJA 4G5XA 4FMPA 1P0IA 1W75A 2H1IA 2WG2A 5DLPA 4AO7A 4AMYA 4U2FA 4N5IX 1C7JA 1Q0RA 4UHHA 2J3QA 4ETWA 4HAIA 5HF6A 2QR5A 2W22A 4DMFA 1U65A 4J0JA 5EHNA 2FUKA 5T4EA 1O6FA 2OXEA 3WWEA 4XIIA 1W52X 2CJPA 1XRLA 2HU5A 3OM8A 4WY8A 1YCDA 2QUBA 3P2MA 4OB6A 1QONA 1LZLA 3FSGA 4J0HA 4Y2UA 1BS9A 1BEZA 5ALFA 1MX1A 5FXMA 1JU3A 4DNPA 5A62A 3DOHA 5JASA 2BCEA 1RP1A 1AUOA 3I1IA 3GZJA 1E8NA 2XUDA 2JGKA 3GBSA 2O2HA 3STUA 5ALWA 3X3HA 1K6EA 1GXSA 1TKRA 4NVRA 1Q0ZA 2HA3A 4NZZA 2H7YA 3PF8A 3WJ2A 1LGYA 3N0TA 5K3BA 4H7HA 5D6OA 2XMSA 4H0CA 3OG9A 3ESCA 4BTVA 3NGMA 2OGZA 2ZSHA 4QNNA 1YS2X 4KE9A 3HC7A 1BCRA 4W63A 4JYPA 4B6GA 4KEAA 4GEGA 3FCYA 2XUOA 3L1IA 4HRYA 1THTA 2C58A 3ZLVA 5C81A 3ZWQA 1C4XA 5AKZA 2PSDA 1B6GA 5HKBA 4LHEA 3BF8A 3WLAA 2WG1A 4W1PA 4LXHA 3WK6A 3ICVA 3R3VA 4TVKA 5AM0A 4EY6A 5AK5A 4L72A 3H19A 1CUIA 2HHAA 3FOBA 2WJ4A 1MX5A 3ESDA 1WOMA 1JKMA 2ONCA 4XWGA 4PSUA 4DNQA 2XUPA 5AKLA 3UUFA 1F6WA 4ZV7A 1R1DA 1P0QA 1VE7A 4QDXA 1CUVA 5AI8A 2RIPA 5AI9A 3WK5A 3KSRA 5IVHA 3WKAA 3I2FA 2XDWA 3GELA 3OPMA 5CT6A 1IZ7A 1X2BA 1IUOA 2XMGA 4UHDA 3HEAA 1MO2A 2Z8ZA 2XUIA 4AN1A 1I6WA 3B3QA 4X00A 2DQYA 4U2EA 1E3QA 2BJHA 3E4DA 1CQWA 4UBMA 3UUEA 3FBWA 2QRUA 3DLTA 4AO8A 2WM2A 4BZWA 3FYUA 3OOSA 1CUEA 2CZQA 3H2GA 4BTLA 4UFPA 2GYVA 4UBOA 1SC9A 3O9MA 1O6GA 5EI5A 3C6XA 2H7XA 1JJIA 1QO9A 1XZGA 4BC0A 4G9GA 3D5EA 3PDCA 3G0DA 5C8XA 1MPXA 4ZGBA 2Y2UA 5AKEA 3C6BA 3ESAA 5IH7A 1CIJA 2VATA 1XQVA 3MVEA 1QE3A 4KACA 5CMLA 3WK4A 5AIAA 1ZGBA 4C4ZA 2WFLB 2BGRA 3O4IA 4X90A 1ZD4A 3K2IA 1GKLA 5AICA 3F97A 5LZ4A 2Y6VA 2O7VA 4PW0A 1QIFA 4FDMA 2JBWA 1E89A 2HA4A 5EHQA 5CXXA 2AJBA 1FFEA 4W1RA 4B81A 2BUCA 2HFKA 3R3UA 3T4UA 2X5XA 4KRXA 4YK7A 3U0VA 1FSSA 1UOOA 3W06A 2QT9A 2R11A 3HLKA 3D2AA 1XRPA 2RAUA 3D4LA 3AINA 1CUCA 2AJCA 2HRRA 1CEXA 2YASA 1K4YA 4F5ZA 3AFIA 3V1LA 1EI9A 2XUGA 3O4JA 1QFMA 2AJDA 1IMJA 5FPQA 4BRZA 1HPLA 5DYTA 5JD5A 1DT5A 5T4FA 1EDEA 2O7RA 1R88A 4FLFA 1ZD5A 3M3DA 3EQ7A 3QPDA 3V48A 5SYNA 1CRLA 5K3FA 1XROA 3I6MA 4TPKA 4EUSA 1KU0A 2RGUA 1AQLA 1FFBA 3LLCA 3DKRA 4QLAA 1N8SA 2XUQA 4FHZA 4GI1A 5CTAA 1H2ZA 1BE0A 5ALVA 3W2TA 5JAUA 2XQKA 3C6ZA 4G8BA 5FDFA 5AOBA 3DL7A 1CUBA 3C70A 3WK7A 4PF1A 1EK2A 3W04A 2WUFA 4HXGA 5AK6A 3KWJA 2JGIA 3Q8WA 1EH5A 1VZ2A 4KE7A 2B20A 3EBLA 3QPCA 4PQEA 1IVYA 5BWBA 3STVA 2WU3A 3FLAA 3ICWA 2OG1A 5AO9A 5CT5A 3MUNA 3WJ1A 5K3FB 4Y2SA 2HA7A 4AXBA 3QMVA 4C01A 2Z5GA 3R3XA 4J0GA 2QTBA 5FKJA 4KE6A 1YAHA 1ZIYA 3AJAA 4MEAA 1WB5A 2PBLA 5AIBA 2VQ6A 3T52A 3PUIA 1C7IA 1M33A 2WJ6A 4FFVA 2WJ3A 1QIKA 4UHEA 1AX9A 1H23A 3DJYA 4F21A 5HKAA 1J2EA 4L0CA 5AM3A 2V97A 3H1BA 1MT3A 1ZJ4A 1EINA 4HXFB 5ALZA 4YASA 4J0DA 4P93A 1P0MA 4FLMA 2HM7A 1ORVA 2QJRA 4Y2XA 5CURA 3TJMA 3N2ZB 2X8BA 5H3HA 2BKLA 4NMWA 2BFNA 2CEKA 5LP1A 4BZZA 1X70A 3H2KA 2BUAA 2WTMA 1CVLA 3GROA 2GBCA 5KWJA 4BATA 2VF2A 4BBZA 3O9VA 1VKHA 1JFRA 3ZLUA 1Q84A 4H35A 4EZIA 2ECFA 3SC2A 2CB9A 4N8DA 4PNZA 3BIWA 3O4GA 1YR2A 1S8OA 1LBSA 5IVDA 1VJ5A 2RONA 4QDOA 4CIBA 3PICA 4X71A 3C43A 4OD0A 5ALKA 4KJXA 3WL6A 3C6YA 5DNUA 2OLEA 4MQLA 4DLNA 4IH4A 3H17A 4Q05A 1TIBA 4EY5A 4X6UA 1NU6A 2ES4A 2IX9A 4OB8A 4WFJA 3G0CA 1BN6A 4C4YA 1A8QA 4LYEA 2JF0A 4BDSA 4AZ3A 3A2MA 2DSNA 5ALNA 4HZGA 2ZYSA 2OQVA 3VVMA 3D2CA 2HIHA 4H77A 2D0DA 4F60A 4GECA 5ALYA 3WZLA 2WHQA 3D7RA 4E15A 3FYUC 3WWOA 4BAZA 4X85A 2JGJA 4YX9A 1ORWA 1PFQA 3D3NA 1E8MA 2XQJA 3AILA 4K5QA 2VAVA 4DYHA 4XVCA 3IUNA 1UOQA 6YASA 1QFSA 4KR0A 4GXNA 2O2IA 4V2IA 2WU4A 5CW2A 2J4FA 3WQHA 2ACEA 1EVQA 3V1NA 5FPPA 5LZ8A 2FJPA 4MWTA 1HQDA 3KWFA 1ZI8A 1G4HA 3PF9A 3ZLTA 4M0EA 3NOXA 1BN7A 1EVEA 3G9TA 3JWEA 1WCYA 1CUZA 3IULA 4LKOA 4G9EA 4QDZA 3WK8A 4DIUA 2BUBA 4Y2YA 2C0PA 5DYYA 2XI4A 1MX9A 5LKRA 2HRQA 2YXPX 3HSSA 4N8SA 3JW8A 5D3KA 3FCXA 3HACA 5CXUA 2WIKA 2OCGA 5ESRA 2XMRA 1MNAA 5HF5A 3V1KA 5ALQA 3BJMA 1QLWA 1WPXA 4MEBA 3R40A 5JALA 3QBJA 3V1MA 2PSFA 4WY5A 2C5FA 1AZWA 1UOPA 2PX6A 3K9BA 1T2NA 1JT2A 1GPLA 4B83A 3WYNA 5EHZA 4ROTA 4JH0A 2OQIA 1DQZA 2WFZA 2XMCA 2ZVDA 5AKXA 1UZAA 4ZWNA 4J03A 4X7BA 3IUQA 4QA9A 1KU6A 1IUNA 5FLKA 4D9JA 2HDWA 1YAJA 1XZHA 1E5TA 4I4CA 4L9AA 5E2IA 3WWCA 2G5PA 2H7CA 5DNWA 3R0VA 4DGQA 4EB0A 1QZ3A 4DMCA 3HXKA 3WL7A 5D7BA 1XQXA 1YSCA 2DHDA 5A7FA 2JEZA 4UBJA 1JJFA 4LXIA 1DINA 1QTIA 5T4HA 5EHXA 4C89A 1WB6A 4B0PA 4DSAA 2XQGA 4CCWA 4JYMA 5EFZA 5AKGA 1R50A 1MNQA 4YPVA 2BAGA 1E66A 1BCSA 3FAKA 5A7HA 1IUPA 3SWWA 1SOMA 1QOZA 4AQDA 1J1IA 5C8VA 1AC5A 5ALJA 2R8BA 5K3EA 5EIEA 3WIBA 1TQHA 3Q0TA 3HYSA
chains in the Genus database with same CATH superfamily
4UPDA 5ISMA 1URPA 4TWZA 2H0RA 1R4NB 2PFGA 2UZIR 5LLSA 1XRQA 2ZI3A 3RUFA 4FHEA 1ULTA 4HWTA 4DMKA 4HDKB 1GYQA 1YRWA 2P9GA 2XYRA 4XFJA 2PKQP 4JZYA 3TIFA 3TNYA 1LLUA 1WMEA 4LRTB 3OICA 1QGED 3H6KA 4G5OA 1I3LA 4Y2RA 2JAHA 5IDXA 4N8EA 3IHWA 2QYTA 4OHXA 3BUSA 3EPHA 1U8FO 3W8FA 4Q4JA 4EWLA 1UOEA 3CX4A 3LJKA 5JBIA 1XRRA 2B36A 3U2QA 1JAZA 4J16A 3AEUA 2QSYA 4JVSB 3O94A 5KVAA 2PEYA 1DBQA 5GWXA 2VWPA 5EXDA 2CHVA 4CKBB 4WY2A 5AKYA 2QZZA 1BHJA 2QJFA 4HMPA 5HCIA 1XDGA 1KEZA 4CMBA 1XMJA 1KPHA 5EJ9A 4IIXA 4CDGA 3P2OA 3UOGA 2IEBA 2JI6A 3RC3A 3R7WA 5JXIA 1JQ3A 2WTUA 1RWXA 2C20A 2QQ5A 1XRMA 4KUGA 2AOXA 2YS6A 3QENA 5FNVA 1DIRA 5I4CA 2P6NA 4GYYA 5L95A 4W99A 2V5VA 2OV4A 1R64A 3ERCA 5AKIA 2P2DA 2R6AA 2I03A 1T2EA 5L7TA 2OBBA 2XY4A 4QHTA 1JXQA 1JXAA 2HC9A 4JT9A 5CXSA 1SEVA 4DM3A 1FB5A 2LP4Y 1UINA 3AHJA 3HM2A 2O8BA 3AM4A 4CDMA 3PWTA 3VNUA 4MW1A 4BFCA 1R0XA 3D3QA 2J5XA 3F0TA 4JUIA 3GFSA 4JYBA 1KEEA 2J5BA 4B34A 4NXMB 1DPFA 1RPNA 4KQFA 3URMA 2Z6AA 1ZD2P 4B3GA 3TTWA 4P7FA 4BKPA 3HN2A 4FE7A 1EWKA 3V4PB 1NXXA 4PZYA 2XDQA 1Z13A 2I65A 3CXRA 4KO1S 4AI6A 1QFZA 1AUXA 5L3QA 3FVQA 3WTCA 3EXFB 4C04A 3JVEA 4MDFA 4Q3OA 2IYEA 3CONA 4TTVA 1ZK3A 4JQOA 1NAIA 4G01B 2V4MA 3VPAA 5CEJA 2H51A 1G6OA 1E6UA 1YK0A 2LUOA 2QN9A 3V9AA 3V4RA 1K7XB 2GEVA 4KH0A 3ZDFA 1WZ2A 3AWDA 3EC2A 1E9EA 1ZGJA 3IESA 1WUYA 3K5IA 4DS3A 2IHVA 4ALMA 3C3DA 4BLWA 4BFWA 2ZRPA 3TLYA 2NYUA 1XDUA 1M6NA 5TGZA 3R6LA 3UC5A 2HKIA 4YXWD 4UM8B 1OI4A 3EVBA 3JQQA 1Y42X 4PVCA 5BV0A 2MSKA 5JI3E 4MIOA 3DNMA 2BMJA 2PX4A 4AKSA 1WU7A 1N5RA 2H57A 5BUQA 1Q2XA 4HDMB 1Z56C 4JJEA 5I5EA 1FJHA 2ZWMA 2CJXA 4MQMA 1ADFA 4YO7A 5EN4A 5LJIA 3PQ5A 2JHAA 2SBTA 2R7AA 3UA4A 4PC6A 1PYDA 2P5UA 3QF4B 4YJ2B 2X0IA 1H05A 2YWHA 1HETA 3Q7PA 3ZI4A 9GPBA 2Y05A 3UMRA 3WKBA 4NJEB 2P2CA 4LXYA 4UE2A 1HWYA 1T8TA 1MRNA 3LDHA 1T0HB 4PGGA 2FSVC 2HK8A 4ONEA 3ZI7A 3ZJVA 3MTAA 1JGTA 2YDXA 2BM0A 1ZDMA 3ND6A 3QHPA 4QGHA 3P2JA 4E21A 4GNRA 1GTVA 2VYVA 2FZ4A 4ENTA 3CPHA 2HXSA 3PEUA 2H52A 4BVKA 3A70A 2ZRDA 1YB4A 4XEUA 3SICE 4YNBA 4YFYA 3QX7A 2BI8A 2N1MA 5CFRA 4EPRA 1OI2A 5BQ3A 1S0UA 1KMCA 2V7GA 2C96A 2Q0QA 4TZKA 1OYWA 4ZREA 5IKPA 4CM4A 3AY6A 4RA6A 1UAGA 3TECE 3U4QB 1JFFB 1Q83A 3WMGA 5CDUA 1LJUA 3L02A 3CBQA 4M7WA 1E2FA 4DR6B 4DIMA 5DXFA 4MWGA 1GPYA 1L7DA 2J32A 3NHJA 2CMFA 3REFA 2BDEA 1ADJA 4L4ZA 1VGVA 1FJGB 3BWXA 5E6UA 3HCEA 3WLTA 4L8WB 5M34A 2CJYA 4X3OA 1DZ3A 3PVZA 1QO7A 4P3XA 1SVWA 3S40A 3NAGA 3WXMA 4C3ZA 4RH1A 4TTSA 4WLFA 3T5AA 2BL4A 2WF8A 4RTLA 1SXJD 3TD9A 3HMKA 3UQYS 1O5TA 4MJLA 4RMIA 2FPIA 2D1YA 2J45A 4JYCA 5TV2A 4E13A 3EIEA 1VMDA 4X91A 2GWHA 4R2IA 4XSVA 4JR2A 1DRWA 4AZWA 3B3AA 3AVWA 5FIUA 2O3SA 3L8HA 4WXYB 3WS7A 4MARA 1W2WB 4BP8A 4K9OA 3RV3A 1O7JA 5CEEA 1ORTA 2I33A 3DEIA 1BVYF 2C2GA 4HNUA 3DXXA 3ANYB 4L6AA 1E3IA 2QKYA 2R6JA 2B4YA 1PJZA 3QI7A 3RVPA 1L4UA 2UYOA 3TIIA 1JR3A 4FBMA 4NYIR 3RTGA 3RQIA 1LBQA 3CIFA 2X7XA 3PPVA 1IZYA 3Q8XB 1G8HA 2NSLA 4KO2S 4QX6A 1O94C 5B1HA 5KOYA 1GRNA 2F1IA 3GGJA 3N2LA 3NCHA 4IHQA 1MJGA 4M38A 4MKHA 2CK3D 1T1GA 4R7GA 5I4BA 1LLQA 4BEBA 3HM9A 2C57A 2QEQA 3QIAA 1ZL2A 4EM6A 1EUCB 4M0CA 1N2ZA 3K1TA 2EHJA 3BMOB 1SVMA 1S7GA 3RT1A 2NO7A 4CF3A 5K0SA 4GR9A 3DWGA 3UV6A 4AUMA 2P9ZA 3H0KA 3NYWA 3ASVA 4YRPA 4MVJM 5K3AA 5AD1A 5KDDA 1MIOB 1WNFA 1E2PA 3KEOA 1ZN7A 2PVSA 3R5KA 4FNGA 1U7ZA 3ZWYA 2Z43A 2Q4BA 1EB9A 2R4TA 4JMLA 4B3SB 2IHYA 4Q48A 5TIIA 1HDRA 1PR2A 2XCTB 2HJ9A 4GUDA 4ZC8A 3AZQA 1EFTA 1U4OA 2NXWA 3ZWCA 3ZJUA 4IIHA 1T3SA 1JHQA 1T43A 3A1NA 1K9SA 1FU8A 3BWBA 3OHSX 3P9IA 4D9EA 4DYVA 5J4HA 2IEAA 1UT5A 1NIPA 2JZOA 1PQPA 2QN7A 1D4OA 4EBFA 2VRCA 4G23A 4D3ZA 4ETMA 1M1ZA 4N0MA 1KEKA 3JAKB 4RTOA 4PVDA 2IRWA 3RUAA 1KSGA 3A05A 2VPPA 2HTFA 4LC9A 2QY9A 5H02A 2XTJA 1XP5A 3PIRA 4TMZA 4X7MA 5ENZA 3SQOA 4BRSA 5BXQC 2EP5A 2GFIA 2PUEA 1G3QA 1Z0DA 2C8KA 2PZJA 3MERA 2JA1A 3O0TA 3B82A 4MW0A 1J22A 4JI3B 2RH4A 1RVV1 2A9FA 3ELUA 2IBTA 2JFNA 1A8SA 4UFOA 3GMDA 1EESA 1N1MA 2VJPA 3HWWA 3G8AA 3DBOB 4WZBA 1USKA 4DM4A 2QU7A 1O8BA 2QRQA 1RVDA 3PL1A 5FFNA 3ANNA 2BSXA 4IS2A 4DC9A 4GRDA 2PKXA 4R3NA 2QTHA 5HKLA 3OY2A 4IIDA 4CQLA 3ML1A 3T3IA 2PKWA 2JJ1A 3AR2A 3ZR4B 1G21A 1ZWLA 2ZB7A 1XA3A 4AICA 1F9AA 3MJTA 4GGMX 3CT4A 4LBVA 1MV5A 1N0UA 1E5DA 2WKWA 4IGIA 2R25B 3DOEA 5CH5A 2BBOA 3LYLA 3RROA 3TL3A 3IPCA 1G5FA 4Z53A 1EX7A 1JIKA 1NR1A 1TUGA 2QVXX 3KUXA 4RVDA 4EKYA 2DVMA 5JCPA 2JGMA 1L5MA 1U7XA 1DHTA 5CT8A 3W7VA 3BQMB 4Q82A 5IT4A 2ADOA 2CFTA 2EQBA 3KOXA 4YRMA 1NI5A 3EC7A 1NP3A 2AOUA 3CEAA 4L27A 4AS1A 4GMXA 3ZZUA 3HADA 3D64A 1T36B 3FKSD 5KYXA 1J07A 1EFHA 2J08A 3GAFA 4ND7A 3V4FA 2ATIA 1CB7A 3GG2A 3T9BA 1C30A 4O4JB 2R1TB 3L82B 5L4NA 1DGQA 3IB6A 3CVJA 4Q4AB 1MW8X 4LZNA 5ITWA 3L0OA 4M8LA 4J4HA 3QA3E 4KHPB 1R10A 2OCXA 4B4WA 3T95A 2AJLI 5C37A 1YKSA 4N01A 4J0EA 4D9MA 3D8UA 3H3FA 1C1XA 3ST7A 5CBPA 1HNZB 3LHFA 1NVTA 2CHQA 2Q2QA 3LLUA 3R9KA 3WYGA 1VDZA 3BMNA 4KWTA 5K9ZA 2PGAA 1CEYA 2FZEA 3FWYA 1XAHA 3RGWS 4F2HA 5AI0A 4BGUA 2R79A 1JI3A 4MLPA 1EA5A 1XJ5A 2PHZA 1LK7A 3B5EA 3JYOA 3TS1A 5FOQA 4HQFA 4KUEA 3CCCA 1KK2A 1GV0A 1WA5A 2FOLA 1NZJA 1Z7WA 3CC8A 4WLEA 2IEDA 4BFTA 5C18A 4DV4B 4TLCA 5K6RA 4KAAA 4MV7A 4WBNB 2P0AA 4P08A 3VGJA 1M7GA 2BI7A 3BWEA 2QM3A 4X1KA 2HGZA 5AKKA 1QIMA 3H1TA 1BU8A 1Z6PA 1A7KA 3AB7A 3QW4B 1IY0A 3RLFA 4Y6QA 1XZIA 3RREA 1H8HA 3DONA 2W6IA 3UEOA 1XMSA 4FS8A 2QRMA 4X61A 1PRYA 4WNAA 3IVAA 1E4YA 1GZ6A 1V0JA 1TYZA 2HNKA 2I3DA 2I2FA 4MI1A 1UPAA 4ER5A 3QPVA 1VPDA 1Y5LA 3C5HA 4IOLA 4DG9A 1RRCA 3E8MA 2IF0A 2B8EA 2C2BA 4NJMA 1DKUA 5AP9A 4B45A 5A2QA 5IVPA 3V00A 4C0HA 3E3MA 4OYYA 3TE6A 3ZWNA 2IHBA 4DWJA 1YZQA 1A8IA 2CBXA 3MWDA 3OWXA 5JADA 3GJZA 2Y27A 4ZYYA 4FFMA 4K05A 1R8YA 3GXBA 3L5OA 2H92A 2PUWA 2QD5A 4H7EA 4PQRA 1U2TA 5JARA 4IH1A 1OFTA 1PFYA 1L1RA 2Y1XA 3VGPA 1O95D 2P0EA 4NY1A 4TLBA 3F6RA 3TQTA 3BRQA 2YIJA 4R0NA 5T4BA 4BVJA 5BPHA 3CLTC 4B85A 5KMGA 2FG5A 1IBKB 4S04A 4DNOA 4E5DA 1VA5A 4B76A 1Q0UA 4IWXA 1MA0A 5EMNA 2WUVA 4ZQEA 3BMOA 4ILEA 4XVRA 4IDAA 5I7UA 5AK4A 1N4DA 1W0KD 5EUCA 2HPZA 3P97A 1U8AA 4REQA 4QDTA 5BR7A 3CF4A 1N0IA 3WWDA 3AKYA 1DKOA 4YAUA 2QUAA 3N5CA 3AEQB 4E51A 1IN4A 4MGIR 3SNHA 4YR9A 4FFSA 5FNZA 5BVGB 4W7IA 1G21E 5ITVA 3U7EB 1Z4PX 2XD9A 3O8LA 5ITZB 3H0CA 2O8BB 2O0HA 3G2LA 4EJFA 2RGAA 5KX5A 4P7JA 4DRZA 4W5OA 2V45A 1Z0KA 3BQNB 2W2OA 3QLVA 4XWOA 5CXQA 3A4LA 4CW7A 1IWPB 2JEYA 4AMZA 3HR8A 4HSEA 3PP8A 1R3DA 4MITA 2VBGA 5IKMA 3CF0A 2PEZA 1OZGA 3DBHB 3KJQA 3UFBA 3G3EA 1TT5A 1XA4A 1DO2A 1BA3A 3PNPA 4GHWA 2AXNA 2VTBA 4DMGA 4YRAA 2ZAMA 4C20A 1UBUS 3FPLA 2R6DA 4HS9A 3SX4A 2HLNA 3W90A 3T7DA 2VYQA 2B2NA 3MS7A 4PRKA 1NN0A 3EIXA 4MQEB 4TV9B 5FD8A 4RTJA 1GUYA 1Y9AA 4RK1A 5IKEA 2QQEA 3ESZA 4E0BA 5E1DA 2AR0A 1UDXA 2ZI9A 3Q3IA 4YH1A 3BD8A 3W1EA 3ZZNA 3O3OB 3VKVA 2O4CA 5HFNA 3KJXA 4O4LF 3NAMA 2BBWA 1AKMA 1KJIA 2V6JA 1T5IA 4RIIA 5AW2A 4GDFA 2Y1OA 3D6FA 1YIDA 1FYVA 1MHPA 1N2JA 4HUJA 5EAIA 1YS7A 4O08A 3PHJA 5CYFA 1BW9B 1J1ZA 2QGNA 2VLBA 3LL7A 3H7AA 1TLLA 2XNDA 5EQDA 1KAEA 1B2LA 2BKXA 3E35A 4PAWA 4PO1A 1JLLA 2EG5A 1X1SA 3P26A 1N25A 1WCIA 2GEBA 5GJCA 3SJAA 1HLPA 1NNUA 1WP4A 4CIYA 4AF7A 1VL8A 2PLFA 3CPEA 3DC7A 3IT0A 2GUGA 2P67A 1KQOA 3QVSA 4QGFA 3DMRA 3ZY5A 4XD2A 4R71A 5BMVA 2RHHA 3SSNA 4QM7A 1A04A 3LQYA 1G8MA 2Y1WA 3VDNB 5ALDA 1CUYA 3SVTA 3NUGA 3MYYA 4I08A 1P1JA 2XZTA 4HTAA 1H0KA 5IZCA 2RHWA 1TKBA 1O5IA 3PC6A 3G02A 4CRWB 5JD4A 1B76A 2YHUA 3HVUA 5LQDA 4U2DA 4MP3A 2AN1A 3AOGA 1ZUNA 3F67A 3LCCA 1R66A 2XQIA 4PYLA 1DELA 4WZZA 3VR6A 1Z8HA 3TAXA 1H1TA 2R62A 4Y1RB 4KI7A 3LT2A 4WH0A 4AP6A 4IQFA 1BA2A 2E1PA 3SOPA 1SUBA 1IZ8A 2GGSA 2JAPA 3GQBA 4I9GA 3A31A 1XVVA 3KR9A 2ZIEA 2IYVA 4RH3A 1Z4KA 4MS1A 1KK3A 4PINA 4QVIA 4JLOA 4KQ9A 1JEQB 2YYZA 2WTNA 3EPPA 3Q88A 2IZ0A 2JH8A 3CO0S 4TM8A 2M6LA 3W2EA 1X8XA 5HGXA 5HZMA 2B61A 3EVCA 3ZV7A 1ZW6A 1NJ6A 3CLRC 3I8SA 4MCIA 1TXGA 2ZIUB 3STTA 1JDZA 2HPVA 5JOQA 3QOXA 5BN3A 3GVPA 4QGSA 5JAPA 4DKJA 3PG5A 2J9RA 2ZYIA 5MGNA 2BH2A 4IO0A 2OFPA 1Y80A 5ADUS 1NF2A 2WAAA 2JIPA 2RDMA 3EWAA 3M8KA 4PYRA 5CB4F 1WLSA 1F8YA 2FGJA 4B75A 4CCYB 3LBYA 1XXHB 4X97A 1MIHA 2PV7A 2VYND 3KD2A 4F56A 3KKOA 1YV9A 4M60A 3A3PA 1L4LA 4JMPA 5JAMA 3AKZA 3NUZA 3ZZMA 1RRVA 4IBOA 1SRRA 4Q6WA 3WRXC 3E1SA 4BNJA 2O8FB 1REQA 5IUKC 3M7IA 3TZCA 4XYMA 3W05A 1D5CA 1NLMA 1X1AA 2VXBA 3X2EA 1Z0SA 1OGYA 3CGGA 2LD4A 2ZYRA 3L4BC 3K20A 1PDVA 3K6RA 1RPZA 5K3CA 1UKCA 3GYGA 3FLMA 4HJXA 2BBSA 1WXDA 1U7DA 2FXIA 2VN8A 3NBMA 3UC9A 4MUKA 2IP4A 1LQTA 4J1SA 1NQOA 5AVXA 1ZM9A 3RS5A 1TMYA 4Z4QA 2ZT6A 5JV5A 3FPGA 4DPLA 1YJQA 3JVDA 3NJRA 3AUKA 3RIXA 4EUNA 3UMJA 2BGMA 4KMSA 1G66A 1R0RE 5ALPA 4JJ7A 2JBAA 1Z2OX 3F9IA 1VJGA 3RG8A 2ZU6A 3K1JA 1U63A 3GBPA 4YACA 3F7NA 1XKLA 2YDYA 1N0VC 1JLRA 1SBNE 1UK9A 2YJ5A 3BXOA 4Y2QA 3VKHA 4B6PA 2Q6IA 4Q4CA 1NQVA 1YO6A 2C99A 1L7RA 3H9GA 3BSSA 4Q4LA 3I12A 5EKSA 5EJEA 2F8TA 1W2HA 2CXXA 1Y5RA 1W93A 3DYBA 5CVVA 5LUBA 3W8DA 4LECA 3B13B 3QF7A 4YBRA 3IL2A 1II8B 1JDNA 4JVNA 1G20A 1FLDA 3PFFA 4Y2VA 1X1CA 4MS3B 1O6ZA 4HXYA 2XQFA 3RIYA 3A6ZA 3LUAA 2PYIA 2P9BA 3HBJA 2UZ3A 4MB2A 4QKQA 5JH7F 3CRNA 3T3MB 1KVUA 3EFEA 5HZHA 3GLHA 3OLWA 1RC0A 4NFHA 3LDGA 2WZQA 3ONWA 3P2KA 1QRRA 2CUTA 4NU8X 1DDGA 2W4QA 2DECA 4OOFA 3EQ8A 3SX0A 4RFSA 2OFOA 1I7LA 5B3LA 5A3VA 4RD6A 2H0AA 1KY2A 3B6MA 5LBIA 4OLBA 3EIFA 4ZXFA 3GR6A 1E7WA 2VOEA 4KIGA 5JQGB 2HJGA 1B8NA 3NTLA 2MSEB 1HA3A 3KZXA 3B78A 1P7ZA 3OO0A 3ZHQA 5TMPA 1ID8A 4YC7A 4B7XA 3PV0A 1E8DA 3A9CA 5F76A 1WSAA 4EVQA 3ZXUB 1GTL1 1FMLA 2PA3A 1GHTA 2WHPB 2Y6UA 3K4QA 1TJYA 3CLUC 3OQPA 3PXUA 1R5BA 4FLEA 4N0EA 4RHUA 2V3VA 3OKAA 1NY6A 1IE3A 1SQ6A 5FP0A 4A1OA 3NHPA 4QYXA 4F84A 3GVCA 3RK1A 4EDFA 5JUWA 3MUOA 1O6BA 3EGVA 1XJ0A 2H1FA 4DBLE 1JA9A 2PMCA 2AFHE 2NX2A 4YIKA 5BNWA 5EQFA 3MGAA 4OU5A 2R96A 2ZSKA 5GQSA 2Q3BA 4D8XA 4FB5A 4S24A 4EA8A 1XCLA 2CJWA 2GHRA 3VR6H 1UBHS 1L8LA 2ZSDA 4FFBB 4HWRA 1CDOA 1E3WB 4UNQA 1SFRA 1NHWA 2AQKA 2E7ZA 3VYSB 4QZVA 1QQ6A 5KI6A 1FQWA 2FPMA 2IPMA 2G6TA 3DW3X 3BE8A 5HCNA 3TQOA 1VXRA 5FBZA 5BQXA 1TK9A 3DWIA 3RSHA 1E5XA 2FPOA 2JGRA 4EKIA 1QF7A 3WJAA 1ZSNA 4WUVA 5DCUA 2QUZA 2P1RA 1R9MA 2MCFA 2A4MA 4DTCA 1NN3A 4A9AA 2MOKA 5A3QA 3FM9A 4OPMA 4AX4A 4EB6B 1SB8A 4QUBA 1W5EA 2AHRA 2QV7A 3DVQX 4M83A 5K01A 2Z30A 5EINA 1GY8A 4G5YA 4R40A 2XYQA 2I2CA 4H17A 3U4GA 2Q2NA 4URWR 3RRMA 2V9PA 3HCAA 4HYTA 5DMHA 1NXVA 4PG7A 3GA0A 5J4LA 2CD9A 1VSBA 5H68A 1SXJE 5FTMA 2QN3A 1V7CA 3LBHA 5CAEB 1ZOIA 3HQ4O 2PS1A 2JLQA 5IAOA 4FQ8A 3VDXA 1GQSA 3K0SA 5E4FA 5TSDA 5DHRA 1K8QA 4MUBA 1E1QD 1KY3A 1E62A 1XEFA 1KZYC 1PD0A 1UP6A 2P9TA 3FTQA 3I4FA 3M3PA 4BQSA 4WN9B 1QP0A 2D6FA 1YRLA 5AT1A 3M4XA 1YRQA 1N5OX 3FYSA 1I7SB 2NT4A 4KK3A 4WJKB 4X1KB 5ELLA 4HZUB 4C43A 3OQVA 5TQ0A 3GXOA 5TF4A 5HQ3A 2VQFB 4Q34A 2QTWB 4RS4A 4XJXA 1NDHA 4TQGA 3TLGA 1C8BA 2JLAA 2ZJ2A 4KOAA 1RZ3A 2JJ2A 2NACA 2YMLA 1I1QB 3Q1LA 4FXPA 4WFKA 2O2XA 4H6XA 4D0NA 4UM9D 4L02A 1XTPA 4FEGA 4K46A 5CNMA 3H5IA 3T3NA 1RJDA 1IY8A 3BKXA 3W7BA 1U9JA 3AFOA 4NJMB 4WI1A 1K6XA 4QBKA 4RVSA 1W73A 1A4XA 3EDOA 1A9ZA 5E1MA 4GOXA 3E8SA 3WDLA 5LSAA 4RTKA 2BTEA 4Z7OB 3U7RA 2GNPA 1E1CA 1GZSA 2ZUFA 1KMQA 2AFIB 3C0KA 1G8SA 3LRTA 2F3RA 3ZJ5A 4IUDS 4C7VA 2V0NA 1DAPA 4ANFA 1TVMA 4UQPA 2X77A 4NXNB 2MYUA 4ENSA 3AF1A 4OSPA 3PNQA 2GRAA 3MW8A 1A5TA 3E7DA 1F2VA 4LNUB 5G0WA 4D5EA 5HKKA 3ZPXA 2PH7A 1SQGA 2P6MA 2ZIAA 3AFMA 3DFFA 4DW8A 5AVVA 4NJEA 3CNOA 2QLJA 5BSEA 4C7JA 1WUTA 1EXWA 2WIFA 1YNOA 1QMPA 1QQTA 5ALEA 3BCRA 1EFVB 4WVLA 2EW8A 3AIKA 4WZ6A 1XTRA 2PRKA 2OD9A 3AUFA 1JG7A 4KR7A 3DBHA 5ESDA 1K98A 2WYHA 1K86A 4IW3B 4R1MA 4WOPA 4OX9B 3M6UA 2PO7A 1HMYA 4OGGA 5AUQA 3T9EA 1T0BA 1CC1S 5HMLA 2QM7A 3QU5A 3RK0A 4TS9A 2XTMA 4ZEWA 4K9DA 4EATA 1H3FA 1RXUA 2PFKA 3HSYA 5KYUB 2PSHA 2ZBVA 4URFA 1PCXA 4EMSA 3WMEA 1KGSA 5C7YA 3P94A 5KX5B 2VHVA 1PJRA 2PLWA 1A8HA 2NG1A 3V97A 5EXPA 3UG7A 3FMPB 1UPUA 3OMWA 5D3ZA 2ODPA 3HBLA 4RGVA 3E3OA 3N58A 1GFWA 3F1LA 4K9QA 5D1NA 3CVVA 3HB9A 1YQQA 5ER9A 1VIYA 2LNDA 1I1NA 1W48A 5HRCA 1DADA 4W5TA 2BJVA 4HLUC 2WG0A 1XO1A 1WZUA 1P4SA 4XFKA 5B30A 3T5MA 1X39A 2B5WA 1UK7A 1JBKA 4H7KA 5IMBA 3ZX5A 1ODLA 4S3MA 3OC0A 3QY9A 1LBTA 2VDWA 1JDSA 3RIEA 4DLXA 4EHNA 4JI6B 1JEYB 3GRFA 4ZO7A 1I2MA 1NFRA 1TJNA 1ZH6A 3E7WA 3EY9A 3U7QB 4ZKEA 3WQRA 1UFOA 2CBGA 4AROA 1EDZA 5KNBD 1O3YA 4LJ5A 4BNZA 1E3WA 1I8TA 1R8XA 3KTAB 3NKLA 4RGYA 1RCUA 5FUXA 3S28A 3VSEA 1FFDA 4DREA 2W6CX 4XR9A 3BE5A 4ZXPA 6GPBA 2OZPA 2Q4RA 4UTXA 3ILSA 2DKNA 1PV2A 4XWTA 4L5IA 4MA0A 2DY1A 1ZMXA 2AC2A 1RLIA 3FPBA 4YP0A 5DK6A 2W2MA 4QREA 4C0BA 1XOIA 2X8WA 3P9XA 2BEJA 2ZWPA 1HM5A 2H3EA 1P2SA 2MMGA 3NVAA 1CRQA 1YZFA 4JFAA 2OYRA 3WB2A 4CXMA 1Y1PA 3DMTA 3L7JA 3N86A 4KO4S 3NR2A 3Q0EA 5LQSA 4AG3A 4L5BA 4ZT7A 1D6NA 1DEAA 2Z9CA 1N6OA 4GBED 3TFQA 1UCFA 4AWXA 4DG5A 1L7OA 1XZKA 4LGCA 4X94A 1ZD1A 3T7CA 1PK9A 4CT4B 3GT7A 5FUQA 3F90A 2CVZA 3G13A 3VSBA 5HR5A 3U4DA 3RV4A 1FXWF 1V7QA 3EHDA 1E0JA 2WC1A 4IILA 4L3WA 1XMXA 1KC1A 1Y7PA 2IQ5A 3O3NB 2IFTA 2WWIA 3QG5A 1KBZA 1HE2A 2RARA 4JUDX 2JFGA 2FSFA 5CUQA 4CE6A 4EJSC 1JKXA 1W6UA 2B7BA 3LLVA 4RE5A 4OB7A 5ECWA 1VG8A 4JP3A 2DFPA 3KTFA 4PGFA 3SQLA 3PJEA 4F8EA 2UYCA 1WRBA 2BGJA 2RJNA 3GN1A 1Z0UA 4HGQA 4J3JA 4QRDA 2GETA 3EIWA 4I2NA 5HA5A 2I2WA 2P7HA 4OUDB 2C4VA 5CA1F 3SE7A 2ZIVB 1EJ0A 3L93A 4M0FA 3SMVA 4ZOCA 3DOUA 5AUOB 2MDTA 1M2VA 3K0CC 3ZCXA 5K45A 3WBFA 1U4NA 3HP7A 4NG4A 2REXB 2WWWA 1XHFA 2GD1O 4NWIA 4OBWA 4HB0A 3ZLBA 1UKBA 4D0SA 3TUJC 4Z1MD 1E6KA 2J3MA 2X9GA 2Z2KA 3MAGA 5FPTA 1T6BY 4OJKA 3IEPA 4RIHA 3KTOA 3GFGA 5D00A 5E3IA 5EKUA 5B1SA 5I7HA 4PTYA 4DCSA 4K88A 3U3XA 2XKJE 4R1TA 2NUAB 2HNBA 3DPIA 1XTZA 2QI9F 3EZNA 4AUEA 1J06A 2HDOA 4R83A 3TLCA 4A6PA 3L0IB 1AOXA 5CLIA 1Z2NX 2HJVA 1JILA 1Z9BA 3KV3O 3CN7A 3I4CA 4PAMA 1GTZA 2D59A 3A37A 4MUXA 1ZIXA 1NYLA 1L1FA 3B9BA 4L1KA 1GSOA 4L8YA 4V0LA 2BF7A 3VO1A 2CNOA 4DOMA 4FYIA 4RFLA 1NJ1A 2GILA 5ARCA 3WA6A 3EG5A 2J7PD 2EKDA 5ILGA 4IDCA 1QMGA 3DFMA 1APBA 3OHPA 1OLOA 3FJYA 2DUUA 4PO8A 2FKAA 4J6FA 1UMBB 3NZEA 5CDFA 3GGSA 3LX5A 3RVQA 3WNZA 4LRSB 5KVVA 2NPFA 1KORA 4LPSA 4GQIA 3G9XA 5JZ9A 2QTCA 2VNIA 1T4CB 1BRTA 4QFMA 4KNWA 2YQZA 2YOHA 4PYKA 4C08A 4G89A 4KLZA 4D9GA 2AX4A 2XH8A 4JN6B 3ODGA 4Q9LA 4KMRA 2C8LA 4N3GA 5H5JA 1OH8A 1Q95A 2H9YA 3H2JA 1WQ1R 4RBNA 1S3FA 4IKPA 3L0YA 2ICAA 2V7PA 5ERXA 4ND4A 5KPDA 1CZUA 4DXDA 1ZICA 2ZI4A 4LZAA 1C4KA 4UVGA 1XLWA 3A1DA 1LI4A 1RSZA 3ZWAA 2Z9BA 3Q2KA 2IE8A 1XWWA 4R8KA 5AJTA 3R7DA 1FLNA 3AJ9A 3C87A 4LCEA 1AQ6A 2VP5A 3VNRA 4HVTA 4KR2A 1WZCA 5UKDA 2PJDA 1YQEA 5FUWA 5A0VA 5L51A 2QZ4A 2NNLD 4IH9A 5DHQA 5BWNA 1GCGA 4DDHA 2FX5A 2HV8A 3Q3EA 1EE1A 9LDTA 4WGFA 3HDQA 4LJ7A 3OOJA 4FDAA 3RU7A 3A32A 1G1MA 4GW3A 1NJ5A 3ITNA 2F1HA 2O8CB 3O03A 2Q49A 3RAFC 2F90A 3U61B 3E22A 4LRXA 2OBYA 2CXOA 1GYRA 3F7MA 3OHMA 4II2A 1NONA 1EJBA 2NIPA 3C6QA 4IJ5A 5FB3A 4ZVPA 3W5HA 3WLOA 1YF3A 1LDNA 1JB9A 3HR4A 3UXMA 4QUIA 3DL4A 2V7VA 1A8PA 1BJTA 2ATVA 2Q5OA 4EG6A 4ESHA 5AHWA 4ERNA 4BMNA 2RE8A 3OP4A 2N46A 5AHOA 4Y6RA 1V3QE 3GA5A 3WLQA 2DUMA 1IC6A 4AZSA 4TQUS 2M9MA 3OEEA 4PANA 1RXVA 3MJRA 3RIMA 4DA6A 3R0JA 2ANBA 2OFWA 3VYUB 1TYCA 2E6KA 2XMBA 4GZ6A 2NUTA 3V3TA 5TPWA 1CUFA 1DBIA 4S05A 3VPSA 4FVTA 4R69A 2ZIXA 5IAJA 4LYYA 1N2CE 3SZRA 3UV3A 4DSNA 1G64A 4G0XA 4XLLA 3R7AA 4CM9D 4S1NA 4ALNA 2O23A 5TJHA 1KDZA 4A8HA 3NWJA 2FMKA 4IZIA 1M34B 5KCMA 1QPZA 2GO7A 2Q5FA 4B46A 3OZDA 4PQYA 4Z9FA 3LHSA 1FDRA 2WF5A 3QNMA 3A4MA 1XNHA 3I9V6 5K0NA 3SHOA 4YMUA 4Q21A 1I3OA 4G1MB 4FBLA 4PZLA 1KDOA 1T9GS 3GDHA 4FHDA 3HCFA 1LSUA 3OZVA 1CS4C 2A9JA 4JAVC 4P36A 4PQGA 3W5VA 8LDHA 3IBYA 1XALA 1GAQA 4X93A 4OL0A 1QTQA 1I13A 2JHCA 2WLTA 4UHFA 1ZKDA 1WVGA 3T1NA 4W8OA 3RGGA 2KW5A 4E6PA 4UMEA 4J0KA 1E4VA 2JVJA 3I30X 3L77A 3R3WA 4ZYUA 1NN1A 4IQ4A 4MWSA 2GYUA 4NNOA 4AK9A 1TZBA 1U9ZA 2BMVA 3M6MD 1YU6A 1WBBA 4X8HA 3HSKA 3OFSA 4J0CA 4II3A 4RZSA 3DKKA 2ZB8A 3L92A 1I10A 1UXHA 3N6VA 5LQRA 3CVXA 5LDGA 5CB8A 2IZ7A 2VSQA 2PKYX 1LK5A 3DS8A 4RJKA 1N7JA 1BROA 1OVGA 5E4JA 4CG2A 4V1CB 5FQOA 1E9BA 3AV0B 3HR7A 3RSOA 5F5LA 2FN8A 1QIGA 4KQ1A 4AD8A 4PYNA 1A9PA 3IP8A 8ABPA 2HCTA 2I3AA 3E84A 4FCWA 1Z6TA 1C4WA 3DCNA 4IWNA 4Q7EA 4OBEA 1NP6A 2WU1A 1A82A 3TVDA 1RBQA 2Q9BA 2DUNA 2W70A 3EA0A 4WK6A 3HXOA 1J20A 1HLFA 3NTRA 1JEEA 2DFDA 4ZYTA 1YTLA 3F9CA 3ROFA 3FNGA 3OQOA 1FLAA 1JW9B 2CMDA 2CNWA 1Z4MA 1RBYA 3C85A 3M9LA 2YNMC 5JSZA 4PR3A 1PNRA 4BUCA 3KOOA 1UPBA 1OE0A 4DNFA 4NCBA 1ZBQA 4EA7A 3O8CA 4MLCA 2RJ3A 2GRJA 4U8GA 2IWHA 2XV1A 4WLOA 3QOWA 1DAFA 2XCUA 4I19A 3ANTA 2AQ8A 1PG0A 4D79A 1ZCAA 2QW1A 3SKXA 4EL0A 3A9UA 4CT0A 1A2QA 4XTRA 3DE2X 1AQUA 1YRHA 3WLJA 3ICCA 2FPWA 7AT1A 4UBLA 1M1UA 2PO5A 1U1EA 4LE0A 2D5AA 2H65A 2FN3A 2WF7A 2W0MA 4FOSA 2CUKA 4N18A 4QYIB 3TVYA 4A2WA 2XDAA 3DXFA 3FH0A 3GRRA 3QOYA 1WQ4A 3KVNA 1FQOA 3MXTA 4HDSB 3TMAA 3TRKA 3UK0A 3TSYA 2ZQYA 1GU1A 4DY4A 3UAWA 5IBRA 3SF0A 1GVNB 2VCHA 5ARDA 2KSQA 3R0ZA 4CFZA 2R7LA 4YGYA 3SEFA 5HYVA 1U0EA 2RH5A 1JQDA 1KC3A 2V8OA 3CF2A 2YWFA 3NQ41 4CKZA 3TLZA 2N3ZA 4QGGA 2WWVD 3G1UA 5FOUA 3ZWPA 1XZEA 4RNDB 1EVZA 4KIUA 3ID6C 2F1RA 3SZGA 1NRWA 3GFOA 3HJTA 1NMQA 1QG2A 3N2IA 2HF9A 4KQEA 4EJ6A 2GH1A 1MQAA 1WXWA 4IJWA 4ND6A 1CE8B 4QU8A 1YBFA 1GTSA 3R0XA 4NCKA 1FRNA 5LBTA 1ODTC 3HJHA 5D1HA 3WLNA 2CCJA 3IP7A 2YHIB 4D6XA 4K7JA 4EB6A 4IDOA 3GRZA 4ZAWA 5KU1A 2QL6A 3DB1A 5C8ZA 1D7AA 1EUYA 1VE9A 5I7AA 2W42A 1WMDA 3EODA 3LY8A 4KQKA 1V3UA 4H15A 1YDHA 1W5BA 3NV9A 3D0QA 4MXDA 5KOJB 1MGOA 1X14A 2CNBA 2Q4DA 4G4SO 4J7AA 4MR9A 1HDOA 1KF0A 5DTMA 1PIWA 3CXUA 3CT6A 1SKMA 2HXYA 3HGTA 4AZVA 1XNQB 2RGXA 2WVJA 4TKVB 3V7NA 4BO3A 3FWKA 2PX2A 5SZJA 1K08A 1S8NA 2CD7A 1WW2A 2CLEB 5D3MA 4ASUD 5ALRA 1PJSA 3C8DA 1QHFA 3NS7A 4JLNA 1JWBB 3CFYA 3DD5A 4BN4A 2H5LA 4D98A 2SNIE 1GPNA 4FGUA 2I78A 3R3YA 4FXOA 3AB8A 3RYCA 3KLNA 4U7WA 1U6JA 4ITUA 1Z4OA 2I4LA 4KAJA 1GR1A 1WNTA 2AV6A 1KRWA 2O2DA 4OQXA 4Z99A 4LZPA 3O95A 2GZ1A 4O2AF 1EIZA 2ZOSA 1SG6A 4JQSA 4K87A 4LXXA 5A71A 1PJQA 2VDJA 4EJSA 4N65A 1GQQA 3BK2A 2VHXA 1BCSB 4KR6A 2Q45A 3DZKA 1M5UA 2PL5A 4R2KA 3VOTA 4YCNA 3NU1A 2BWJA 3RU3A 2BBTA 5FI1B 4XQ0A 3IUEA 1J8YF 1NOJA 1PZGA 3FTCA 4OQQA 3GN2A 5L6MB 4P7GA 4C0JA 4C07A 1H2WA 4OQZA 2B4KA 3EC1A 3ZQ4A 3JQAD 1LPNA 4JI5B 4B6RA 5H3CA 1DLIA 2PZFA 1E3MA 2HQ1A 4G5XA 4F71A 2BCJQ 3ZDRA 3ILYA 1HE1C 1P0IA 2H1IA 3FA2A 5DLPA 4N3CA 1TYAE 4KYTA 2WSBA 5BYJA 3RVLA 5DI3A 5F2KA 5BY2A 5G3YA 1Q0RA 3ZWMA 4UHHA 3EXHA 1IDOA 1U94A 4OUDA 2Z3VA 3VC2A 3VO2A 1G20B 2DWCA 3TQSA 4C0KA 4WINA 4F5EA 1IN7A 4HDOB 3ZGYA 4DRXB 1RZUA 1LQ2A 4TLLB 1YR8A 4JI1B 2DWQA 2WJGA 2B6HA 4XGKA 2AMJA 3T7EA 1U5BA 4XUDA 3TI9A 1E3SA 2E37A 2FPKA 3TBFA 3IP5A 4WASA 1U65A 3A58B 5DTQA 3R5TA 3GDWA 2GCIA 4GOJA 3A6EA 1P3Y1 2EJTA 3RHZA 821PA 4RELA 3OIFA 3UKOA 1X92A 2BW0A 4RVGA 3DQPA 1Z2CA 5A03A 4B8WA 4RADA 4DSUA 1C7QA 2EQAA 4H3HB 1QFYA 1T9GR 1VSQA 2PT7A 3A6DA 3M1YA 2Z83A 5BSGA 1XRLA 3SU8A 1XAJA 4QXMA 3QK7A 3MXOA 1EEXB 4CQNA 4LJRA 2VQDA 3P2MA 5KS2A 1E2NA 4IXTA 1YQUA 3GJ6A 4XQ9A 1Y33E 4OB6A 4G8JA 3U4HA 2A94A 2DZDA 4GXRA 2GSWA 3L0DA 1PJBA 4G2TA 4AYXA 1II8A 3O26A 3PC3A 4K9NA 1ESDA 5K4HA 5CCEA 5FADA 1WY7A 2D0IA 2XYHA 4XB2A 3QGMA 2YWEA 5ALFA 1K06A 1JU3A 3JQAA 5K3OA 5A62A 1QS0A 5FA8A 4QODA 2VDWB 4C6RA 3GHHA 1QDEA 3CRVA 4QBIA 5JZOA 1C41A 5AVQA 1D09A 3FFXA 1B42A 1Z5ZA 4EHIA 2J5KA 2YZNA 3DOCA 4MAMA 3TI7A 1P61B 2R00C 3GZJA 2V5UA 5IDQA 1GAEO 4AYTA 2XUDA 5C1OA 1W8DA 2YRXA 3STUA 1HORA 4EG1A 5ALWA 5KTSA 4WRRA 3X3HA 1B26A 3DSRA 1DOHA 1O9GA 1UJNA 1L5OA 3FSJX 3JD2A 2FE1A 3RS9A 1J21A 1F2UB 3B1XA 3TSWA 3UZUA 4CT5A 1FYWA 3H5WA 5HPYB 1CE8A 3N8GA 4TXMA 4NZZA 1WF3A 1ZCFA 1SUWA 1RYBA 3GJ7A 4EPTA 3DM5A 5CA0B 1QKIA 1RU3A 2NZYA 4H7HA 3R9WA 2PQ6A 5D6OA 3Q7IA 1AMOA 5DRYA 2O9JA 3DEKA 4H0CA 4JWTA 3OG9A 4NI5A 3BH6A 4LA4A 3AC0A 1GGMA 4E3WA 16PKA 2IUTA 4JX8A 3OQJA 5TQJA 3W78A 3L4KA 1M5TA 3PX7A 3UJBA 3HDGA 2CCKA 4J75A 1NRXA 2XJ9A 3HCBA 3NBFA 3BD7A 4L75A 5E3JA 4B44A 4CQMA 2H1OA 3FKSA 2XCIA 2O1WA 2Q9CA 4YBZA 1DJOA 2GEJA 2QRHA 1VG1A 1SIUA 2Y68A 1DJLA 1HTBA 3P9YA 4FK8A 4RPKA 1NBAA 4M6WB 4TKUA 1BCRA 3S2GA 4W63A 4JYPA 4B6GA 4DFDA 2FF5A 4QXRA 2JFXA 2AI1A 1N2SA 2BI4A 4TLMB 1X7XB 3U48A 4GEGA 1TM3E 2JRCA 4IYJA 4MQ4A 1V6SA 1VHJA 4ZYWA 1THTA 5AW3A 2E18A 1S5PA 5EP1A 4EYSA 3AERA 2X0KA 1C4XA 4KODA 2PSDA 3R5HA 4HLNA 4ZO9A 5AKZA 3USES 3L06A 4Q9DA 1K8ZB 3VUEA 4YJHB 4LHEA 1RKVA 1UP7A 4DLVA 3WYAA 4ZANA 3W3AD 5ETJA 1EVYA 2EF0A 5CG1A 2OO7A 2P2GA 1E9RA 3WAJA 2BN4A 1ZJZA 1MENA 1OV6A 1TQDA 2G70A 2J3JA 4N1AA 2CXUA 4QELA 4ETNA 1NM5C 1X7YB 4LXHA 5K0JA 4URXR 4QUDA 4DLAA 5ITZA 3K0FA 3AF3A 4X1IA 3WSVA 2O2YA 2HYIC 4K26A 1G6KA 5L8VA 3U3ZA 3NAQA 3GJ0A 4H31A 3U19A 3M4JA 1KDTA 4UU0A 4EW6A 2PD4A 4P98A 5HIKA 1JV2B 2XIQA 3Q85A 1CUIA 2B92A 2HHAA 3JQRA 4Q03A 1YE5A 2WJ4A 3NXKA 1LF5A 3ZV4A 1SU8A 1WZEA 4B3TB 3G89A 3S2UA 3R76A 1ZM2A 2JAOA 4OK5A 1LBEA 3UT5B 3TMYA 1B3RA 1ATZA 3K0KA 4LHYA 1PBNA 1FP1D 5MN4A 1AGXA 3ITDA 5JE8A 3JAKA 2W6PA 4DNQA 2QMYA 3FUWA 3IT1A 3QWFA 1FNBA 4ZYXA 3EQ2A 4GT1A 3LI2A 3R8CA 1ST2A 5JXJA 1MF7A 1MJFA 4EMUA 4AM8A 4ZALA 4LYFA 3IDOA 4GLJA 3U7GA 1F6WA 2O0LA 3TNJA 3U7FB 1R1DA 3IQIX 2CB0A 4TZTA 3FETA 3E9CA 4E7PA 2CXHA 3QKWA 4N5MA 4QDXA 1CUVA 3EEOA 3PYMA 3COWA 3HB0A 3GUHA 4GL4A 2RIPA 4MIEA 2AVNA 2WB4A 4AY2A 4YJ3F 5AI9A 3N0VA 3AQ4A 4YWJA 3SQNA 4G85A 1WTAA 1G5HA 1U99A 4M37A 3BILA 4M53A 4RZXA 4OKNA 3A1TA 3M5CA 4HO1X 4EO9A 1TL7C 2VTDA 1ZQ1A 3LYUA 2KI5A 4HNSA 1K9VF 2JLZA 5CT6A 1Z73A 4PHHA 2Q5IA 2QIOA 3I0NA 4QTZA 4OREX 1BEUB 1X2BA 4C05A 2XMGA 3KVRA 4UHDA 5J47A 4MVXA 1RBZA 3HEAA 2B8TA 1DFGA 1QP7A 2I7TA 2B5OA 5ADHA 3HU1A 3WMWA 4FOTA 5BSWA 1Q44A 2A9PA 1AD2A 3WGIA 3QVOA 3NHWA 2C5EA 1VMAA 1XEWY 4X00A 2DQYA 1JQLB 1AF7A 5E7JA 5K1ZA 1X42A 1X74A 3G85A 4QVKA 3KL2A 5EJ7A 2ECQA 3E4DA 4FD2A 3F3KA 1KKMA 5BP7A 4OLJA 3HNRA 2WM2A 4FW9A 3ZHXA 1J56A 1ZGHA 2QPTA 3L8YA 1ZCJA 2C84A 5FH9A 2C92A 2NYAA 4TQ9A 1BDJA 1CKEA 1MLDA 4MRVA 1CUEA 5LLDA 2CZQA 4MRRA 3VNVA 1B16A 9MHTA 1LK0A 4FOOA 3NRCA 1T4GA 1XE3A 1SVNA 2G0AA 4I50B 3C2QA 2HLPA 4JB3A 3WSWA 3QY0A 2GYVA 3AVUA 5IDWA 2C3OA 4Z6KA 3SYRA 3LX6A 4JKYA 2ADFA 4P1ZA 2G88A 4B4VA 2DPLA 4TRRA 2HYDA 4XVHA 2H7XA 5EI5A 4YMLA 1JBQA 1M1YE 3EEFA 1M2OA 2ZSUA 4HAXA 3LC0A 1N8TA 4BVAA 4QYTA 3DBLB 1JI0A 1FW8A 5C8XA 4HNGA 2I80A 1YDFA 1C1XB 1GZ4A 4BKQA 2BEWA 1FJXA 3FI0A 4JX9A 2JFBA 3QPUA 2IHZA 1HUQA 4ND3A 5SYAA 3M6LA 2OV6A 1I3KA 4NBRA 4WNAB 3T7KA 2OK8A 3LT1A 4EI7A 5FOWA 2YYAA 4WOBA 1QHXA 3DHVA 2JAWA 1KSFX 3DZCA 2VYFA 3L0BA 4MS4A 4D45A 2BKVA 2BTOA 2R5NA 1VGQA 3ADPA 3KB6A 4NV3A 4R9VA 4RACA 5DI9A 2B1IA 3WK4A 4YCLA 1ZGBA 4C4ZA 2FUEA 1Q1GA 4NE7A 4PX2A 4BEJA 4IG4A 2CWDA 2WFLB 3H11B 4M46A 3R75A 2IYPA 2R7MA 3WMXA 5IZ4A 1VSTA 4FYMA 4E2WA 5J2UA 2HBYA 3O4IA 1K7YA 4TXHA 2DYKA 3VR4H 5CBPB 1SY7A 3LFUA 2Z04A 2EOAA 4R6WA 3P9SA 3KYCB 5A3RA 3KRTA 3R5FA 2NQ2C 1MCZA 5ADVA 3T12A 1CR1A 1DG1G 1FDOA 3R0IA 5G4KB 1CHDA 1W29A 3F73A 3K1YA 3HYLA 4DCGA 3VA7A 3ZGNA 4RDCA 2X40A 2O8FA 4YDSA 5A3SA 1QIFA 3N07A 1NUTA 4UREA 1Z28A 5CXXA 2AJBA 1I51A 4NFLA 5HIJA 1CY4A 4PNEA 4FX2A 2XVXA 1KZ9A 1R12A 1P39A 2PGXA 5BN5B 1QO0D 4B81A 5BSHA 1U7OA 1DKLA 1ORRA 2PDAA 3T4UA 1NL3A 2TMDA 4KRXA 5JSHA 4N40A 1UOOA 1P2GA 3KOMA 3NUQA 1UC8A 1Y8QB 3GNQA 3OJWA 2QT9A 2R11A 3HJGA 4X84A 1N4AA 2FP4A 4B4KA 4KCGA 4I14A 3BDAA 5JHGB 2ZB3A 4WK4B 5KHOC 2B7LA 4HNQA 3VKUA 1LDYA 4QOGA 2XXAA 4CTNA 5BOSA 3I8OA 1L5RA 2WYOA 1P6QA 3GWGA 3M2TA 1FUEA 3IAM6 1X7GA 2PWBA 4LI0A 1Y6RA 5FOVA 4ENWA 4ZZIA 3NWPA 3IXQA 3O4JA 2NVWA 3ZDCA 3P2IA 4HWGA 4IJQA 3TTUA 1JR4A 5AWFC 1E9SA 4INAA 3IEXA 2I4IA 3SHFA 2FU5C 1M8FA 2BT4A 4I4LA 1GU7A 1Q22A 1VL6A 2JBHA 4M87A 3PC7A 3FPSA 1JTEA 2A5FA 2HRCA 3B60A 3BA1A 2QRPA 1HGXA 2DCUA 4EHFA 5ICFA 3QFRA 5EZQA 4JDUA 5IDVA 5LMUB 1T2CA 3T3EA 3SFZA 2H0QA 2YN0A 1YMQA 3L7KA 3OKCA 1CRLA 3CYFA 4ZHQB 4I9UA 1JIUA 1Y4UA 4AMUA 4CF6A 2R3SA 4QPJC 3CW9A 3WWYA 3I6MA 4TPKA 2AUTA 4MDEA 3T1YB 4BKUA 1UEIA 2Y3IA 2D13A 2ZPTX 1ZMBA 2WVAA 3QU7A 2FWAA 4LYAA 1MO6A 3IC5A 1G8YA 4JJFA 1RAAA 4EX6A 1TX4B 5L3RA 1FDWA 1XR3A 4F3TA 3IP1A 1CYDA 3E5MA 3HNPA 5GZ3A 2JIRA 1MVNA 1Z07A 3IMEA 4YQFA 1S1MA 1TU0A 3IFSA 5E6SB 1RLOA 3P5SA 3LRPA 4Z4GA 4S1WA 1U3UA 5EJAA 3R3SA 3W2TA 3MB8A 2I0FA 1F2UA 3C6ZA 4IDFA 4Q18A 4OLFA 3UGQA 1UBCA 2VO1A 2YXBA 2RB5A 4TTTS 3W4IA 5JNRA 2YV5A 1P9LA 4YRJA 3UGJA 3TMKA 4X7PA 4YVFA 4NCAA 4DTIA 2B2CA 3B53X 2JFFA 2PUCA 3VHLB 2CHFA 3DV0B 1TCUA 5L7WA 4UASA 1AHIA 2D4HA 5BYBA 1GTG1 1W1UA 1G8FA 2AHOA 4LXTA 5HVNA 4D44A 4EYKA 5ICCA 4TV8B 5C5EA 2WUFA 1N7GA 1T5SA 1CY7A 3E7FA 4HXGA 3SS9X 5C35A 4PO9A 4L28A 2OILA 1VSVA 4EHDA 4PGAA 4JT8A 2JGIA 1QVRA 4CTOA 2VQ3A 3INGA 4HAYA 1JP7A 1KDPA 5A0FA 3BXZA 2GYYA 1KQGA 4TRMA 1A96A 4DV0B 4LSWA 3EBLA 3FWNA 3QPCA 3ZHBA 1J2JA 3IBGA 3UJ7A 2R00A 1NX6A 2BFEB 1CU1A 3BHIA 3ZDQA 4BFZA 8ADHA 1AQJA 5CIQA 4B5KA 5BWBA 4ER6A 1SVIA 4HFRA 5BOSB 1RKQA 1H2BA 2ZWVA 2AN5A 4ZJZA 3LTEA 3AG6A 2OG1A 4E1AA 2Q1WA 1XL1A 2NU6A 3TLMA 3V7WA 2KQUA 4YJFA 5CT5A 4BVFA 2FW0A 4V0KA 5K3FB 4GPEA 2V6FA 4ZIRA 1JLMA 1NVGA 2KHZA 3IILA 3GLFB 5LBUA 2XGSA 2FSVA 1MEJA 3K0FB 2V74B 3KEMA 4X1IB 3VC1A 1EMDA 2WYUA 1EHCA 2WMDA 3HKCB 4GM1A 4YDHB 2H85A 2HJRA 1PK7A 2C4KA 2DHRA 3DZBA 4R2HA 1Z6ZA 4G0WA 3WJ7A 3R7LA 4RJJA 3K9WA 2JDID 4J0GA 4YMHA 1MQSA 4RHCA 2UUAB 5FKJA 4CGZA 1KJZA 1R16A 2YR0A 2QLFA 3E7XA 3H9CA 3LF1A 1YAHA 2YVAA 2A9VA 1ZIYA 2ODEA 4Y2HA 3ZJTA 3ADCA 3OUTA 2MINB 1CDZA 3L7NA 4MEAA 1R4MB 3BB3A 4EPXA 1O54A 4CFYA 4HB4A 4HL6A 4JL5A 4GICA 5AIBA 2VPTA 1SR8A 1Y3IA 2RKWA 1C7IA 1NPDA 1M33A 2VDQB 4IV0A 3RNOA 2WJ6A 3RU2A 1FFHA 3FYDA 2QTGA 4PC7A 4C0WA 2R87A 3ZS9A 4EKDA 3A9RA 4DR5B 1QIKA 3MINA 1CF9A 4CM6A 3JZFA 4C7BA 2DTDA 2H17A 5MGBA 2QW0X 3AEKA 5LQCA 5DP1A 4B2IA 1I4EB 3GRVA 5DXAA 2QHXA 1N9GA 1QH8B 3B20A 1M83A 3WLLA 4E7OA 3RRJA 4Q9JA 3ETEA 3Q3HA 2X1HA 1I2CA 3WNCA 4BX2A 5KCZA 4J76A 3T9AA 4I1VA 3UUGA 4A5OA 1PF7E 1PS0A 4RQUA 5EWJB 4UAUA 3RS4A 5IASA 5DX0A 2YVLA 4FB4A 3GEPA 1LJLA 3U3RA 4BMDA 3ZU6A 4BUZA 1E0SA 1IHUA 4GF5A 4CMIB 4P93A 2H48A 3FNHA 4H59A 4DMRA 5K0CA 5JPIA 1T1JA 1GL3A 4CLRA 3C5CA 2Z1DA 3SXUB 3QXXA 3N2ZB 2VAMA 1TF2A 5DT2A 1RFLA 3ZY6A 3RI3A 4ARSA 2BGTA 2P40A 3HXQA 3MJDA 4YREA 1ZITA 5C52B 3FTEA 1FEZA 2R65A 2R6CA 1JB1A 5AK0A 5HP4A 3W8RA 2CEKA 4ZT4A 2F17A 1EVLA 1UBGA 3G2OA 3TW6A 3UMMA 1EFRA 3UKJA 4OHUA 3AESB 3NVKI 3WIUA 3ICEA 2XNHA 1R0BA 1ITZA 1CVLA 2GBCA 3E05A 3Q3GE 2VF2A 4MGKR 3K6JA 3N3BC 4BATA 4ZCRA 5BQPA 3NYIA 2I2DA 3O9VA 4RLSA 1H9CA 1Z0AA 4ZPXA 2MSNA 2H2DA 3QVXA 2ZZNA 3PUYA 4TQAA 3S5JA 3FIUA 5AVOA 4WJZA 1AS3A 4LGMA 4X1YB 3GFTA 4ZDKA 4IIJF 4ID9A 5LMCA 2JJQA 1N7HA 2PUVA 4PRYA 1GVHA 1FCJA 1KJJA 1B14A 2NOAA 4HG2A 2ZSEA 2ZR0A 1CY6A 1G2IA 1RPTA 4PNZA 2IEGA 1Y6GA 4AWAA 3X1KA 2WINI 4KFSA 4BGEA 2NSDA 4ERXA 4AF6A 5BNIA 3CHYA 4D43A 3FOZA 4J0QA 2FEMA 3KVYA 2ZUUA 2NP6A 2W2LA 4ZA2A 1VECA 3PIIA 1DWUA 4M1QA 2VHYA 1ID1A 5H7XA 2FP3A 2RGCA 5HRAA 2C94A 1TDJA 3C3XA 1NMYA 3EUFA 3ZH2A 5KJFA 2FHSA 2INGX 5BORA 3PICA 1GP2A 1SELA 3P4YA 1XKXA 3PXBA 2IPXA 5J2TF 5I3ZA 1ZM7A 2I7DA 4BXOA 1UDWA 1ZRMA 4K9KA 3CCFA 5DNUA 3OEHA 4RY9A 1U0TA 2IT1A 4J2TA 1W4BA 3GMTA 2VF4X 4DLNA 1DAGA 4UAJA 4TROA 1ML3A 3Q15C 1RYDA 4BWVA 2AZ4A 2XA1A 4MQUA 3LV8A 4Q05A 3E48A 3RADC 4EY5A 2ZAOA 4X6UA 1NU6A 2I2XB 1QU2A 2ES4A 2IX9A 4NZYA 4G0PA 2XNJA 1SBZA 1Y6QA 2D8MA 3NHLA 4MR9B 3KFXA 4WFJA 3SIRA 1BN6A 4E32A 1WG8A 3T9CA 1MABB 2X0JA 3D8TA 1NUAA 1TYBE 3QWBA 3AM3A 4NECA 3ROZA 2EARA 2A3RA 4BV8A 2V7XA 4YJKA 2ZYVX 1RRFA 1Y8AA 5DK4A 5LR6A 2QAJA 3Q2OA 1F9EA 2YHBA 2YQ4A 1NUPA 4YCSA 2L19A 4MRSA 5AHKA 1DUVG 1JJ7A 1J49A 1M0WA 3LFTA 4I5EA 1FTSA 3TCNA 2DSNA 3E18A 4C78A 1F6DA 2ZYSA 1R0SA 1U0FA 2HLHA 4OLHA 3A6LA 1WSWA 4LWZA 4MS3A 3OCJA 2Y4NA 3E9RA 3ANXA 3CMCO 3X2SA 2O57A 2VJLA 4MUAA 2A9OA 2XAUA 4DV2B 3QEMB 1C0IA 3OQBA 1YCFA 5ESXA 1RI1A 4BGDA 5BVGA 1S02A 2D0DA 4W6ZA 1GGNA 3OE4A 3PGKA 4QQRA 4S1VA 1X94A 4AAYA 1ADYA 3BE4A 3WZLA 5JROA 1L4FA 1B0AA 2O8DB 3EG9A 621PA 4BO5A 3PFGA 4OI0A 3D7RA 1YR1A 2I6UA 5KIAA 1SBCA 1P4HA 1UP4A 4UNPA 3FAZA 3M6IA 3N2YA 4GMGA 4JVOA 1E32A 1XZNA 2J9FA 4MZXA 4BAZA 5AW9A 1A9RA 1Z5NA 2DF8A 4X85A 5KPJA 2VDRB 3MINB 1C3OB 4H3KB 2DPXA 1HG1A 3KPJA 4M3NA 2PE5A 3AILA 1DCTA 5LOVA 2D5BA 4IMRA 2QM8A 3L05A 4K5QA 4CMIA 4RVOA 3QKSB 1PBTA 3PX2A 2OECA 5EY5B 4A03A 4DYHA 2A59A 4JKIA 4XVCA 2CDRA 4D46A 3FCOA 2QL9A 1YFLA 2CXPA 5EEGA 1WXIA 2MSLA 4F06A 4LOJA 1UOQA 2VRNA 1KOJA 4MUYA 3W5AA 1IWBB 1F2TB 4GXNA 2LDXA 3OPYI 2VJNA 2ZSJA 2O2IA 1SHTX 3DZIA 3EA4A 4V2IA 1T5BA 5B3JC 4P5DA 2PH5A 1YBHA 4R2LA 1KKLA 1M72A 1V43A 4ND8B 1NXWA 4MUIA 2CXSA 1DTWB 3F71A 3JZDA 3WQHA 3LZ6A 4E70A 1JRLA 2PT6A 2CHUA 4UKDA 3V1NA 5GGYA 2PIAA 1BFDA 1AV7A 5LZ8A 1QX4A 3GGDA 4H27A 2H8KA 1H6BA 2JLCA 1KP3A 2FJPA 3OWHA 5K4GA 3QQ5A 3FPJA 1LQUA 3QEKA 3RSLA 4Z4HA 2QX6A 4UUOA 2ONJA 1Y4AE 3PF9A 4P3PA 1Y3HA 2H2FA 3UKDA 3RSZA 3SC4A 3HFGA 4LGVA 2JCVA 4M0EA 1PP4A 2FUCA 1KI1A 3HB7A 2VUUA 4KJZA 3RT9A 1D1SA 3JWEA 2X58A 4ZT5A 4XWWA 4OGFA 1DB3A 2CL6X 1S6YA 4PR0A 3KOWA 1DKMA 5H59A 4CLOA 4DIUA 5DSZA 1I94B 3DXYA 4F7WA 4U4AA 2EV9A 4I1YA 3I9JA 2C3UA 3ZIUA 3LPLA 1EZZA 1UJ5A 1YOVA 3TZKA 3QE4A 4IEFB 4ALIA 4J4BA 4C0AC 1FS5A 3CF6R 2C31A 2CMHA 2RGEA 2OA0A 3N6RA 4CBVA 5JEEA 5LKRA 2OHGA 1PFGA 4CKEA 4PBRA 4XB1A 3PD1A 4X7RA 2Q1UA 3HSSA 4TN1A 1KZ6A 2NO4A 4P38A 5AW6A 4N8SA 4A6EA 2FW1A 4F1JA 3SIXA 5D3KA 2I71A 3OPNA 4KRFA 4L4RA 4P22A 3HACA 5EWLB 2W6JD 3T0IA 3ZJYA 2WIKA 1EGQA 1V7ZA 3HS3A 4D8YA 1NULA 2A88A 1JYSA 2EFJA 3VHRA 1ARZA 1MNAA 1ZINA 5HOEA 3KFVA 4OV6B 4C30A 2Z9DA 2FNAA 1FP2A 5EIBC 3AQIA 5JCJA 3T4XA 3V1KA 4WXHA 1ZOSA 2AC7A 3L9WA 4UTNA 4FQ5A 1YHYA 1V8OA 4F4HA 5ALQA 2JH9A 1MQ8B 1WPXA 5IH3A 4ARIA 5K2MA 2CVFA 4QG3A 3GLIA 5BV1A 2PSFA 4U8HA 1B8UA 4U3JA 2JJYA 2HJHA 1I7DA 2CGEA 4P7KA 1HYGA 2R6FA 3QX8A 2UUOA 5K0GA 1YJAA 3O8OB 2PX6A 3WV4A 2QX8A 4DIFA 2B99A 4Q5IA 2HHHB 1GPLA 1AA9A 3RSGA 5AVTA 5JLJA 4KG7A 1E4OA 3DOJA 4OQMA 2XW6A 4V0ME 4RTPA 3MHPA 3QWAA 2V6MA 5IJXA 3IP3A 1KJQA 3JQGB 1FUIA 1M1XB 3P45A 1NUHA 1P4GA 3UMFA 4EO7A 3AJRA 4NH0A 5LQNA 3AU9A 1RWVA 1SG9A 5CX4A 1MT0A 1D8TA 1EE9A 1V48A 5KSPA 3U31A 4CKCB 4UEOA 1LKZA 2IDKA 3BHJA 3UN1A 1QE5A 1FQKA 4FDUA 4ZWNA 4X7BA 4RGQA 4F4CA 3ZNQA 4CEIA 1KU6A 2E5FA 1