4N3AA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (1-26)e10a
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3aA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3aA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3aA03
3TAXA 1P4GA 3BD8A 3TG4A 1NOIA 2UWJG 1WUYA 3ASGA 3Q4AB 2HY7A 3OKPA 5D00A 5TMBA 3T3GA 3CUTA 1Z8DA 4GZ6A 1FTQA 2BGTA 4YVOA 3UYLA 3MRXA 2GW1A 1PN3A 1NA3A 3ZCSA 3QOUA 4REMA 2PL2A 4N3BA 3LPZA 4N3CA 1NA0A 1PSWA 2GPNA 1RZUA 3U3WA 3CUWA 3IAAA 3FWVA 2AV6A 1XNFA 3O3CA 4WNFA 5G04J 2DBAA 5M72A 4HLNA 3IEGA 4BQEA 2XGOA 3Q3IA 1KT1A 2AW3A 4BTAA 4MHSA 1GFZA 4BFCA 4NQ0A 2XA2A 2QRGA 3SF4A 3ZN3A 3SYRA 3MTDA 4H7YA 2PZIA 3KS2A 3ZCPA 5LQDA 3QWPA 3C4VA 4RG6A 3G2JA 3EBPA 4KBQA 1NOJA 4CDRA 1UQUA 2GPAA 3OKCA 2XCIA 5D0QD 1C8KA 1P4HA 4JA9A 4QLBA 3LKUA 3GW4A 2Q6VA 2SKCA 3DDWA 3PE3A 3L7DA 4GA1A 3QKWA 2YJNA 4UQZA 3R9AB 4F3VA 4LDPA 3NC4A 5I45A 4WACA 1WV1A 3AS4A 3TG5A 2PYDA 2GJ4A 3FROA 1O6CA 2ASVA 4N5CA 3N71A 4HOTA 2PRIA 3TOVA 5LCWJ 4HWGA 3VUEA 5FZQA 4CTMA 1E96B 1NLMA 3Q3EA 4I1AA 1NZNA 1QQEA 2AVPA 3ZCQA 3MS7A 3ZCTA 4JL0A 4J8FA 1FU8A 2QLMA 2Y4UA 3EBOA 4EJ2A 2R66A 4F96A 2ACVA 5HI7A 2QLNA 5LCWC 1JIVA 5KJNA 2IEIA 3WAGA 4X7RA 2JLBA 4GZ5A 1JIUA 3JYSA 3RJVA 3ESKA 3ZCVA 4J0UA 3G2NA 3HBMA 3RO2A 2LSUA 1K06A 1C50A 5JTUA 1L7XA 3CK7A 4WHMA 3O48A 5DIZA 1VGVA 2F3PA 2X0DA 3OY2A 3MT7A 4WADA 2FFRA 3CV3A 1HXIA 3E3LA 4RIHA 1E1YA 2XA9A 4I2ZA 5GPBA 1C8LA 4CGWA 2FETA 1FU4A 4NESA 2VSYA 2XCCA 5IKPA 2IUYA 4EKEA 5DLDA 4XIFA 3MA5A 3BD7A 1PNVA 3NP9A 4EQFA 2IYFA 4RELA 3Q47B 4BWRA 3CK9A 4B94A 4GA0A 4HORA 3T3HA 3TSAA 3LY8A 2Q7FA 2UY1B 2ACWA 3VTYA 5CCMA 4UI9C 4GYOA 2BISA 1AHPA 2GPBA 3QWWA 3S7JA 2KCLA 5G05C 2HR2A 3KAEA 5CCLA 2H1FA 3CVQA 1C3JA 4U0ZA 3E4BA 3ZHEA 2FBNA 1JG6A 2IV7A 2BUGA 4I17A 3BEOA 3EDTB 4YI3A 1IIRA 1FC0A 2R4TA 3E3NA 3GPBA 2C9ZA 2LSVA 3L7BA 2R4UA 2ECPA 3AMVA 2SKDA 2MHKA 3ZFWA 3MEKA 1HZ4A 2QN8A 3H4IA 3WC4A 3LCAA 3G2HA 3NPAA 1BX3A 3Q49B 3NCHA 4H7XA 2GEKA 1P29A 2O6LA 1QM5A 4YVQC 1P2DA 3T3DA 2VGYA 1NVKA 2QNBA 2G9VA 2J9QA 4BTBA 2GEJA 2HYZA 1YA0A 3DD1A 4RIEA 3E3OA 2BFWA 3BCSA 3OTIA 1WUTA 4RIIA 4JA7A 4MRAA 1B4DA 4O6FA 4WNGA 1RRVA 4M83A 3OXLA 4AY5A 5ARFA 2ATIA 5KJLA 3L79A 2VCEA 8GPBA 1A17A 1P4JA 4NC9A 1JG7A 1ELWA 1FTYA 2WQHA 2X6QA 3CEHA 1Y8MA 1H5UA 5DBKA 2X6RA 1OUVA 3RHZA 2G9UA 1HLFA 2ZB2A 3MBOA 2ONDA 4BT9A 4UI9K 2C1ZA 4N2SA 4HOQA 4IN3B 5FTPA 4G25A 3VTXA 5HQ8A 1ABBA 2PQNA 3URZA 3AS8A 3MSCA 4RG9A 3DDSA 2QRQA 3CK8A 4U0UA 3DZCA 3GZ2A 1WV0A 4KQMA 1L6IA 1Y6FA 4GPKA 2Y4TA 1GGNA 1ZBPA 2FF4A 3RU0A 1M5RA 3MS4A 4KQ1A 5EKQD 4W6QA 4AMGA 2IEGA 3CUYA 4NEQA 4RIGA 4FKZA 1E4OA 1P2BA 1F6DA 2X0EA 1KLXA 4BQFA 2PRJA 5D0OD 1YA6A 2KC7A 3OT5A 5IKOA 5C1DA 3S28A 2VGXA 9GPBA 4KYOB 5ARGA 1TJCA 3FP3A 1FU7A 3G2KA 4GYWA 4GYYA 5JJTA 3UPVA 3ASFA 4EKYA 4I9CA 2X0FA 4RENA 2QN9A 3BD6A 4NRHB 3QDNA 2PQ6A 5AYWD 4M60A 3D1JA 1HH8A 3NF1A 4CGVA 1GZ5A 3C48A 4MI3A 1IHGA 5JJ7A 4L22A 4RIFA 2BGUA 3ZCUA 4Y6WA 2GM9A 4AY6A 2FEZA 3NP7A 4AM9A 4PQGA 3Q15A 5BW8C 3VDNB 5G04C 2P6PA 2WPVA 1A8IA 3COPA 4YUAA 3RIBA 2JJMA 2OOEA 5ENZA 3MT8A 2KCVA 2XGMA 1KT0A 5CHEE 4APOA 5TMDA 4J8EA 5TVGA 2XPIA 1QZ2A 3WADA 1PC2A 3RO3A 3CUVA 3K9IA 3PDNA 2QZSA 3S7BA 1XKXA 4G2TA 1IXYA 3MKRA 3WXXA 3UYKA 1WAO1 4MI9A 4X7PA 3CV0A 3VUFA 3CKBA 1JIXA 5HXAA 2F3UA 1GPBA 2P58C 3C4QA 3KD7A 1YGPA 4GCOA 1WW2A 4X6LA 6GPBA 5FJYA 3NB0A 2KCKA 1NZDA 3S0JA 2PQRA 4N39A 4W9RA 2QFCA 3ULQA 4GZ3A 1GPYA 1UQTA 3IA7A 3SYMA 5G05J 1EM6A 4I9EA 3D0RA 2VQ2A 5EX0A 4HOUA 1W3BA 1KTIA 4G24A 4Y6CA 4MHOA 3OKAA 1P5QA 4G1TA 2QRMA 2IW1A 1SXPA 2XEVA 4WNEA 3ZCRA 5BNWA 4U04A 4Z5XA 3MQFA 4U07A 2C1XA 3G2LA 1L5VA 1XC7A 4AIFA 2C0MA 1NOKA 3CVNA 1UZUA 3ZGQA 2G9QA 3BCUA 4X7MA 2AMVA 4N2QA 3OXFA 3S7DA 1JEJA 5JJ6A 3ASDA 2VSNA 5FZRA 3HYMB 3Q5MA 3UUXA 2QN2A 1L5SA 3HBJA 4F9FA 1QKJA 4J8DA 4U0SA 1SXQA 3UQ3A 2VGXB 1FS4A 2QRPA 4GPBA 1XV5A 4YI5A 2F3QA 3S2UA 3T7DA 2R5SA 4XI9A 3QKYA 3RSCA 2V5FA 3U4TA 3OXGA 1ELRA 3S7FA 5DU2A 4EL0A 4GCNA 2YQ8A 3HBNA 4LEUA 1V4VA 4UQYA 3MTAA 4RBNA 2FF5A 2QN1A 4UQXA 3MRVA 3RSZA 1GPAA 2R60A 4FZRA 2VCHA 3BCRA 3CEMA 3MT9A 2YHCA 4LEIA 1AXRA 1LWOA 3T5TA 5JTTA 4KQ2A 4BT8A 2VG8A 2FO7A 3GYZA 3FFLA 3LY9A 2C2LA 1FTWA 3QHPA 1IYGA 5FT9A 1Z62A 3S27A 3T3IA 3T3EA 5DXFA 2HO1A 3ASHA 1NZFA 3D0QA 3ZPJA 4WNDA 2GT1A 3OTGA 1XL1A 2F3SA 3CVLA 3CKCA 2C0LA 2IF4A 2QN3A 2IFUA 1F0KA 4G2VA 4WUYA 1XL0A 3HBFA 1RZVA 3OY7A 5D01A 1Y6GA 4G23A 3RKVA 2AZDA 1LWNA 4YNDA 2WTXA 3LYAA 2OFFA 2C4MA 2QLLA 2L6JA 3S29A 3BEEA 2PYIA 4HOSA 4XI0A 3CUUA 3TGOA 3MV3B 2KS6A 4AN4A 2QRHA 3MV2B 4A1SA 2JZCA 4F97A 2IYAA 4KXKB 1FCHA 4JHRA 2QN7A 4BQIA 1XOIA 3GZ1A 4N9WA 1L5WA 3CEJA 3L7CA 4MI6A 3CX4A 5TMEA 2E2EA 5KJMA 2SKEA 2G9RA 1Z6QA 2NC9A 3LY7A 3GUHA 2R68A 4EL5A 4G26A 2FI7A 3PE4A 3QWVA 5EX3A 3ZHEB 5BT1A 1P2GA 1GG8A 2IV3A 2I6HA 3NAZA 3MS2A 1ZU2A 3CVPA 2XMPA 2XCUA 4MICA 4UI9J 1WW3A 3H4TA 3RT1A 4M7PA 4CTNA 4ABNA 2H1HA 1EXVA 5FZSA 2UY1A 3L01A 4GA2A 2LNIA 5A7DB 3SZ7A 4I2WA 3AS5A 5A6CA 3CEQA 2KATA 1Z6PA 4AMBA 1FA9A 3OTHA 3L7AA 1Y8ZA 1B89A 4N3AA 3G2IA 1L5RA 1L5QA 4ME2A 3BDAA 3MRTA 3Q3HA 7GPBA 2XCBA 2XGSA 3VDMA 4CTOA 1K08A 1J39A 1PYGA 2F9FA 1WM5A 2XA1A 5KJKA 2VYIA 3MTBA
chains in the Genus database with same CATH superfamily
2V54A 1P4GA 3U3JA 4XVUA 4TZTA 3R3WA 2D6FA 3ASGA 1EX7A 4C22A 1OI4A 3GUCA 3H05A 2Y99A 3OFVA 3BTSA 5HOQA 5D5QA 3QMPA 4REOA 2WIGA 1VL0A 2OL4A 4F4FA 3VMFA 1E98A 5JEDA 1UBNA 5FUYA 4CR6A 1PSWA 2D4HA 1H5QA 5J3JA 2MMCA 5EIHA 2J6BA 5IVIA 2P9FA 2P68A 4QX6A 1DJMA 2YOHA 3B3FA 1L3IA 2Y1EA 1DQRA 3QMMA 2JGKA 2X0IA 4WNAA 4ZK2A 4I2NA 2QR3A 4JVOA 1Y7IA 1MX9A 3KR2A 1UBGA 1HX7A 2G76A 1O1TA 1EUCA 1UDCA 4F7AA 4P7FA 4P86A 1X87A 1LPAB 4PLCA 4ZOLF 1MQAA 1A5SB 5HZKA 3NBAA 3I04M 1E64A 2GVZC 1GFZA 3DR3A 4LJ4A 3ELBA 4ZPXA 4P7GA 2P2DA 1S3SA 1UJ6A 4Y2JA 4YP0A 2WD7B 1Y81A 4J6FA 3WAGA 2X2PA 3X1WA 3A0UA 3NBFA 3U9SA 5AM3A 3WLNA 3AHEA 4JX9A 5IN5A 4FQ7A 3D3EA 2RHMA 1FBNA 1G1MA 1IYZA 1JILA 5AKLA 1G291 2OCLA 5EG5A 4ER3A 4QRHA 4OX9Y 1HXHA 1OA0A 3VO8A 2PJUA 2RHCA 1OX6A 4MO9A 4KGVA 1C8KA 4BO0A 2D5AA 1JHXA 3T4UA 4J7XA 1P3JA 1P5HA 5U9CA 2X5JO 2QD4A 5JLJA 1NATA 5ABPA 4R0NA 1R6VA 4LJAA 3AW9A 2LCQA 3TO5A 2DK6A 2X3UA 2PLFA 1I4OA 3B1XA 3CPJB 1P5RA 2BF7A 5C37A 4B7ZA 1AG9A 3QPWA 1MC8A 4FDMA 3FRJA 3ZKWB 2GJ4A 1X8LA 1VBMA 2PM6A 1EH5A 1RZRA 2WPNA 1GFWA 2GB4A 3IB6A 1NNUA 4MWTA 4HB2A 3VUEA 5HE9A 1ZK3A 2RH8A 3TIVA 1Q22A 4XIJA 2PSDA 3IAUA 5CH3A 1JAYA 4IUYA 5JD4A 3HI4A 4DCJA 3WMRA 5EJ6A 4B4VA 5E7IA 2PMWB 3FDIA 1QAMA 2PR2A 1ZH0A 1TM7E 4EJ2A 3GT0A 2CHUA 3SZUA 4X6XA 1B26A 2OD7A 3PS6A 2GA9A 1JDSA 1PJ3A 1M76A 3W2TA 1I36A 2PMFA 3EBLA 1XQYA 5CYGA 5HS4A 3U61B 2W6ZA 1XZCA 5FL7D 4BATA 3OZUA 4MVWA 2EP8A 4UXJA 3HG0D 1FVOA 3WR5A 4EGQA 1BDHA 3NIDB 5KWDA 4F4UA 1YOVB 1JHZA 4CNQA 4X90A 1K7XB 3CMMA 3MERA 1GTG1 4RSMA 5CNKA 1H2EA 2IITA 5A9SA 5LU9A 1F7VA 4US1R 1EA7A 1QORA 3G49A 3KQMA 4U7HA 3FTQA 1WY7A 3N6RA 1TC2A 3USZA 5ICGA 3U7QB 1J07A 3VJMA 4DE5A 4G0PA 3A9RA 3KAPA 4FDVA 5ALRA 3S99A 2EQXA 2R8YA 3H4MA 4UAJA 5I7RA 3IKJA 4PYMA 3GFSA 1CDEA 4ZO4A 1SCUA 1J23A 3FOFC 1FYDA 2BJHA 5K2MA 4F4CA 2E89A 3BRWA 4A36A 4G5QA 1E7UA 4UCQA 4MA5A 2AGVA 3K5HA 4G67A 5FPHA 2H8KA 3DW3X 3MX3A 3UIEA 4CGYA 1R6TA 2FY8A 3RHFA 5KSZA 2CJXA 5G3ZA 3D6MA 1YS4A 3NGMA 1AXEA 4P5PA 4WKBA 4UUPA 3THXA 1SBZA 1L8AA 4FXOA 5EERA 4CZ2D 1NW5A 2RONA 1SIWA 3PGVA 4BZQA 1AS2A 1R8XA 3JY6A 4QRDA 3UJHA 5FIOA 3EB9A 2EZ9A 5DN6A 3UMVA 2ACWA 5LP6A 2ZAMA 4XDHA 3AJRA 4UI9C 1RPJA 2V8OA 2W58A 3ZDEA 1SM4A 2KQUA 3WXBA 4DSUA 1K8KG 1M73E 1P7PA 1TUGA 1TT5B 2HJRA 4D8WA 4LE1A 4FHKA 4DNPA 1EESA 2H1FA 3DE2X 4C7KA 4HLLA 2FBNA 5EZSA 3UY4A 1V41E 2X7HA 3WL5A 3SI7A 1F8FA 1HMYA 3C3AA 4YI3A 4D4KA 4EY5A 3EQ9A 3I1IA 5KYNA 1U8ZA 3LNCA 1HTTA 3HJHA 1YRQA 1XIVA 2GKGA 3AX6A 3NV7A 3AIMA 3ABLE 4ZVVA 3V1MA 3ZK8A 4C0LA 2GOYA 3JRXA 3QELB 4PLTA 1SGWA 1ZVKA 3AYXB 1B8PA 4K9KA 4Q9JA 4YN3A 3JR7A 3ZFWA 2BI4A 1PF7E 2KW5A 3F3YA 3D8NA 4LOLA 4Y2UA 4UNPA 4QUBA 3C6ZA 1CTQA 5CW1A 4LFCB 3DJFA 2J9XB 4DDKA 1C2TA 4RS3A 1Z39A 2H8GA 1YDEA 3HB5X 4JKIA 4X61A 5ICSA 4V2UA 1GRNA 1NC3A 4HATA 4MGEA 1E6MA 1M1ZA 4KUEA 5K4HA 4QXPA 1YKGA 1UPAA 2G9VA 2I6XA 4URVR 2PWYA 3QVWA 1BA3A 3EXIA 2DFPA 5CRIA 1H0HA 1XALA 5CECB 1XMXA 1KIFA 1E59A 1PG0A 2A58A 1BI8B 1M34A 1N6PA 1S8AA 4N3GA 4UPDA 1RYZA 3PDHA 1SAYA 4IDNA 4HMPA 1E2EA 2C8VA 2GETA 1O9HA 2VBFA 4KIFA 4QXMA 1RW2A 4UVGA 1Y3IA 1YL5A 2Z6AA 3AOEC 4NMHA 4UBOA 4MIKA 2HUNA 4ZZIA 4HLUA 2EFHB 1JNXX 2GBPA 4RK7A 3WJ7A 1YOBA 4W1SA 1RLJA 4BO9A 3D0OA 5HM6A 2JW5A 2WM3A 1IWOA 1PV2A 4H1HA 4P35A 3NEPX 1XEFA 4Z8YA 2OHOA 2YVQA 2ZRDA 3MAJA 3BK2A 1TM4E 2DR3A 3BDIA 2FEMA 2J85A 3KEOA 1JE1A 1JFFA 1M5TA 2X14A 3D7KA 3EDCA 4LF7B 2WXNA 4KR3A 2O5RA 4M0LA 5HQ8A 5A4KA 1UWKA 2QVYX 2PQNA 4U00A 4ADSG 2BRUA 2YOFA 3FTUA 3UFBA 1RXUA 4Q4AB 3EN0A 1RRFA 2QRQA 2CFSA 2Q9UA 2Y0DA 3DV0B 5DT9A 2HXYA 4BU1A 4NPHA 1PFYA 2ZI7A 1OLSA 4LCTA 1ODIA 5C1IA 3GNSA 2XX3A 1KEVA 2GD1O 3MEQA 2ZU6B 3QF4B 2YYZA 4Y7DA 2F1HA 2X77A 3CH6A 2MSNA 1K0UA 3CZ4A 3DZKA 1F4VA 2HWXA 3T34A 5HKKA 2H1IA 4JLUA 4LHZA 4RQAA 4UM9D 4XASA 1JFRA 1FK8A 4J1NA 1D9ZA 5NLLA 3S5UA 4AYXA 4BQFA 2BFFB 2AFIA 3WLTA 3FH0A 1NN0A 5JZ9A 1NHWA 3MCZA 3WHPA 2PRKA 4NONA 1Z4NA 3ADPA 5IAJA 9GPBA 2R1VA 1PR3A 1QRDA 3SBTB 4PLYA 4YJ3A 3RS7A 1RD4A 3EG9A 3MTIA 2P2ZA 3OETA 4I5GA 4MV4A 3I9KA 2HDWA 1YI0A 1REQB 2D1SA 5AP9A 4UATA 1NULA 3OSZA 4F4IA 2J49A 4BB6A 4CUJA 2IXBA 3AKCA 3CEPB 1DRKA 3ESBA 4OH1A 3HSKA 3NVAA 2BI7A 3NAMA 4QYTA 4YQZA 2NVBA 4HQNA 5AK4A 3RC3A 1AKYA 1PQYA 1YJAA 2XEDA 5BRNA 4EUHA 3G5UA 3P27A 4KFCA 2VKQA 1DO2A 4Q66C 5FO1A 1TYEB 5J58A 1GAWA 1JHRA 4HDSB 3W5DA 2VUIB 3B9RA 4L22A 5C7YA 2ETAA 4ZVLA 2C03A 1AUXA 2H1RA 1KS9A 2PBFA 1QRAA 4ZYLA 3FPCA 3I0NA 4RANA 4BP3A 2BH2A 3K32A 2Q5OA 4QXRA 2DRIA 3E0XA 1ZR4A 1KY5A 4PEVA 1BXZA 4L4SA 3VDNB 5K3FB 3G6WA 4LMAA 4RC9A 1KVQA 1XXHE 2P40A 4W5RA 1YWGO 4YUAA 1U3VA 1ETUA 2PLRA 2R6HA 3JW8A 3BREA 1WZCA 2R05A 4MOWA 3DUFA 2XLBA 4ZT3A 4EZEA 5TRTA 3PLAE 2VDUE 5EMMA 2W90A 4TTRA 1B6TA 3ABQB 4YDYA 4IINA 5REQA 1MX4A 1KERA 4GTSA 1C4WA 1XDWA 2FN9A 3F8WA 3JARA 4MGIR 4C04A 4ETMA 3CUVA 2RBKA 4W5QA 4ESVA 1VIDA 3LV8A 1MIOA 1R6UA 1T0BA 3LRPA 4QVKA 4BNGA 4IXNA 3VV2A 2DFVA 2BLLA 3TCXB 2XMGA 5B4VA 4QHYA 5FBQB 3X1XA 4ANFA 5FLEX 3W77A 5BUZA 1KF0A 4IHQA 4C29A 4EB6A 1TLTA 1Q74A 1L5FA 3U66A 1Z0JA 1MQSA 1V5EA 3VHQA 1SWVA 3DXYA 1U1GA 3CF4A 2N9UA 5ENOD 1JLLB 2CHQA 4HGYA 2CXTA 1KEEA 4IGKA 5IS2A 5LA6B 4EVSA 3S4YA 2GK4A 1NZDA 1VBNA 1V9SA 3IA7A 3HY6A 4R2WA 1PYDA 1PCXA 1LSJA 4MRMB 4OIFA 2QU8A 3KQOA 5DKFA 1I33A 1NONA 4LPSA 3FJ1A 5DHUA 4A6DA 4YECA 2R00C 4ITVA 2CNWA 2CG2A 5EQTA 2NU6B 2VWGA 3OKAA 4NACA 4G1TA 2MINA 2GNOA 4NZOA 2Z2JA 3IV0A 1HZZC 3B5EA 4X94A 2FF7A 2F43B 5CIWA 3V42A 1CLUA 3UZUA 3ZCRA 3M6MD 1DBPA 2MIIA 1DBQA 5ALWA 2UUBB 1OV4A 1WLYA 4LBVA 1OH5A 1JTEA 3EVNA 4K8RB 3K3PA 1XC7A 1INLA 4A2PA 4IWNA 1LK5A 3JWPA 4WY2A 5GJVC 4D25A 3IOEA 1BVRA 3UK2A 3CVNA 3AAAC 2G9QA 2X5TA 4W4TA 4DJJA 4N2QA 4QGAA 3WKAA 5B3AA 4D6PA 4YMHA 3VR5H 4IIVA 3MPOA 5BQPA 1QRUA 1R50A 1NYRA 2I4MA 1C1HA 3T12A 4V0NA 4X85A 3RNLA 5HUQA 1I2AA 1UR5A 1YJBA 2GCOA 3S7ZA 3WL6A 5EA2A 1KEUA 4F6LA 1DZ3A 2XNHA 4OJMX 4UBJA 2BGNA 1UFOA 4KPUB 3RWBA 4CKCB 4I1MA 1FS4A 4FHJA 2IVFA 5JZVA 1NXPA 2GTHA 1CRQA 1KZ6A 2JGIA 4RWZA 1I3CA 2JGNA 4GTVA 2PMBA 3AEKB 3I5AA 2I7DA 3JD4A 3M1YA 1VJ0A 3QKYA 4N47A 3R76A 3ZDXB 4D0GA 1G3MA 1WUIS 1Y89A 5K6RA 3SIWA 3EFOB 3LPCA 2DP4E 3HBNA 2LTAA 2P9TA 4KI0A 2JD1A 3G2MA 1JCQA 4INOA 4FMCF 3IP1A 2W93A 4EG3A 4FZRA 1RP7A 3HVJA 3GGDA 5FLKA 1Q0ZA 3NGLA 2DEUA 3B60A 3DDOA 4ZCMA 2CHFA 1Z07A 3HVEA 3K6SA 4DDUA 1W94A 3G13A 3PZ2A 2XB2A 3H6HA 1U9IA 4E09A 2YJ6A 2EX1A 3IH5A 1KS2A 1T1IA 4AQ7A 3TZKA 1QE0A 2J0QA 2G7ZA 2M2IA 2Q3BA 5CEAA 1UJ5A 1MXFA 1ULTA 2ZRQA 3OJCA 1JAZA 5DM70 4W5NA 2FJAB 1E5LA 1KZ9A 4D9NA 5D66A 1M6VA 1NZFA 3OAWA 2C83A 1G5QA 1N5LA 2DBYA 2Q6IA 2XE7A 4KXXA 5HGJA 5CBKA 1DTSA 1XCBA 4LHXA 3SZ3A 3OEHA 3DE0X 4B8YA 4S04A 1WBDA 1MNAA 3WX0A 1GGEA 4BBZA 4XQCA 1HT0A 2Z09A 3RFCA 4MUFA 4PG5A 4B0OA 4LGVA 3CKCA 2IY8A 5U4XA 4GZCA 2MSLA 3BFPA 3T7IA 3IPYA 4JQOA 1CUEA 1IEQA 2OM2A 3NOXA 3TD9A 1QYIA 1Z34A 2FLKA 4O3FA 2WV9A 2Y05A 1RZVA 5ITZF 3DYBA 1ACLA 3A3YA 1ZI8A 3OIUA 1GAJA 2AZDA 3DKPA 3TMAA 1J00A 3M5PA 4RF5A 5FR1A 1VKNA 1G6HA 1N6NA 4KGZA 3EUEA 2C4MA 2IZZA 3PBKA 1SR8A 3UKUG 1CZRA 4H3HB 4PO9A 3SHVA 2ACEA 2PYIA 2J8ZA 4XI0A 3W5AA 2DZDA 4B82A 4XPIB 3JZMA 2WFLA 4BEPA 3IYLW 1NF2A 1TRHA 1ND6A 3LIIA 2Z57A 4XWAA 3V2XA 4CM1A 1MB9A 1ZX1A 2YC2C 2IU3A 3OHPA 4XD7A 4KR6A 1SIUA 2Q4BA 4RH3A 3H87A 5C2YA 1Q12A 3G8CA 2ECFA 3PNVA 1DXYA 1KI7A 2QSUA 3GAZA 1II9A 2E2EA 4IW3B 5TT0A 3T1QA 4C4SA 1IHUA 1MQ9A 3GU3A 2DUWA 3G0HA 5H7XA 5H80A 5FQNA 3SXUA 4II3A 1Z6QA 4ZEMA 3OICA 4FONA 3O8RA 1X2BA 3FU0A 3C6KA 5B1SA 3OOEA 4LRSB 3TDKA 4TYYA 2WILA 2OV4A 4ALJA 4OUDA 5K99A 3IUSA 1R0ZA 1YR1A 3QY9A 3BB3A 5LSAA 5B2FA 1VDZA 3ZHEB 3K9HA 5KTOA 2N75A 1E7QA 5BSVA 2Q41A 4ETIA 1NV9A 4TXQA 1BW9B 1KKLA 1X1AA 5IJWA 4DUZB 1GUDA 3U0VA 3G9XA 1QPGA 1DUSA 3QVKA 3UV3A 3BB4A 3OPVA 3UK1A 2PXHA 3ZHZA 1IMJA 3ELDA 4P33A 2YY6A 3JD0A 2KJZA 4FGUA 4PYLA 4F84A 5EDSA 3D9KA 4H15A 2PD4A 3DCJA 3R0VA 1YASA 3HY3A 5KEIA 2Y1FA 4TLDA 5M04A 4LRTB 2ZXWE 1RI2A 4OKIA 4JI5B 3KZOA 3R7WA 4C6TB 2GM3A 5D1HA 5LXTA 2H4FA 2ZJ4A 3C5HA 4XGRA 5IARA 4D9GA 1JBKA 4BN5A 3ZE6A 4Z53A 3BDAA 2QZJA 4D92A 3SFXA 2X58A 1Z2OX 2DIWA 4LZJA 2P9KG 1WJGA 4JC0A 1JEQA 4CTOA 1GYRA 1B0ZA 1A9OA 1JLMA 4JXZA 2D5CA 2OO5C 4JT4A 4TMFA 4ACKA 2PPVA 4NEHB 2DM6A 3VPSA 1ODCA 1GYQA 1VHWA 3KYDB 3WGTA 3L17A 3FWNA 3G1UA 4KV9A 4DV3B 1N9KA 3B8HA 4IFBA 4K26A 5JXHA 2ZBDA 3E9YA 3D9OA 3MWDB 5JY1A 1E2UA 4UU0A 1PN3A 1LF0A 1X1SA 2AA3A 2P9ZA 5FPKA 1E5TA 5BRAA 3THYA 1QF9A 4O4HB 4AULA 1G6OA 4EA7A 1XZMA 3WP0A 3D4NA 3PCTA 4JU9A 1DX9A 8LDHA 2IYPA 2AV6A 2DQKA 4CCWA 2UVQA 5M72A 1UIRA 2XPYA 5KINB 4GGOA 1A7KA 5K0LA 1CWUA 1X86B 2IYXA 2BE7A 3PD0A 3RG8A 2OHIA 2RFMA 3NTOA 3VPXA 1OI2A 1SKBA 3PNKA 4BLSA 1JR6A 4BFCA 1OX4B 2F1IA 2JHPA 3DOEA 4NJMA 4BLQA 3SR4A 2E4AA 3AXSA 2R8XA 1NLZA 2BM1A 1ZOLA 1Q7RA 1BVUA 5F35A 2VIIA 4CFZA 2XTJA 5FLYA 5JYEA 2VWQA 2QLBA 2PQ2A 3N07A 3JAWA 4ZYWA 4G5HA 3FLMA 1XCGB 5F5XA 3T5BA 4RLFA 5LKAA 5DM2A 1ZJWA 1HNNA 1IBCA 3C1OA 4XWGA 1UKCA 5SV2A 2OK7A 2QMOA 5KNLA 3GW4A 4G36A 3DDWA 3PHGA 1OAAA 1PZFA 1U65A 5KKCA 1FT2A 4YCCA 3TJMA 2BEWA 1FDIA 2I2CA 5F9HA 4M55A 3VHXB 4FFLA 4N7MA 4LNGA 1Y1PA 2YIVX 5HK8A 3GRFA 3GNLA 4XKCA 2P2LA 1T15A 2W8BB 3OJFA 4WACA 2VN8A 1V95A 3G0GA 3MOGA 3QMVA 4KTTE 1U99A 3KX2A 1QAQA 2O8DB 4N5CA 3N71A 3AFGA 4HOTA 2BF4A 2YMPA 3JSAA 4KQCA 1JDZA 4U7GA 4CUKA 2PQ0A 4KPYA 5F9MA 4G1MB 3TECE 1NLMA 3O9VA 3S1SA 3K9WA 2WYIA 1JH8A 4C5AA 4DPMA 5C1PA 3BWBA 1M5UA 1LQTA 2ZVPX 3EEIA 3EGXB 1IHBA 3Q9UC 2B0OE 3NO4A 1REQA 3IA2A 3RAEC 1ZC3A 1SHLA 1O97C 2Y4UA 4N6NA 5CMWA 3SOPA 4DCCA 4HB4A 4C43A 1VSUA 2CEAA 2ODAA 4YRGA 2FW0A 4L2YA 1TF7A 2ZVDA 3AK4A 4EYKA 4Y2XA 1S3FA 3G8YA 5I8WA 2FOLA 3VNSA 3F71A 3WNBA 1N7GA 4LF6B 1NMXA 4L7TA 1XTJA 3SS7X 3ZXXA 1OGIA 4PGFA 4DMHA 2Z2YA 4J0UA 1UBTS 1C81A 3EMVA 1ECJA 4PC2A 4GTTA 1EE2A 3H1EA 4W6ZA 4EUEA 4PN3A 4YMVA 3AG3E 1BGVA 1DEKA 4IDDA 1VJ5A 3MZ0A 5A3JA 2VJ8A 3O03A 1BQ4A 4CZ2A 3DCYA 2F3PA 4NATA 2Z8XA 1K3UB 4LJ9A 4UNNA 5A2GA 1T4MA 3CV3A 5EGSA 5A2QA 3WIVA 4JL6A 3TTTA 4YT8A 1UWLA 3BGOS 2QX4A 4HRMB 1WXXA 2F2TA 4I5FA 4J91A 3D9JA 3RRJA 5JZMA 3HXQA 1OH7A 4L95C 4D45A 1MD9A 3ZIMA 2AQKA 1KR2A 1VGRA 2ZS8A 1P31A 5JSKA 4KMMA 1FU4A 4V0ME 3V9PA 1LGYA 4DC1A 5G3YA 4PC7A 1J2UA 1PP4A 3M4JA 1ATZA 3AC0A 4HDRA 4LI3X 3V80A 1JR3E 3I6YA 3EVZA 4DV4B 3M6VA 2OT3B 3KAKA 3M34A 3RROA 4NBNA 3F3KA 2ZRMA 1G63A 4MBGA 1ZNQO 3NHFA 4H7DA 5C51B 1V11A 1Z0DA 2QR5A 2XZTA 3A6FA 3RH0A 1JWFA 1F4PA 1T9CA 4GOXA 4JLOA 4ZVPA 2Q7FA 3KXDA 2BFCA 3AP1A 5E7MA 3R0ZA 3E9ZA 1KRWA 4CPDA 1I51A 3N0TA 5P8WA 4KITB 4BAZA 2KCLA 4C48B 4GNRA 1AK2A 2WF7A 3GA5A 5EHIA 3CUSA 1V4BA 1NE7A 3JASA 1H6AA 4AY4A 4EW3A 1Z26A 4F3CA 1Q0LA 4DLRA 1JQ5A 2YHUA 3BEOA 3PP8A 4C0AC 4FFPA 4LVUA 4AI6A 2ZT6A 4CDMA 4GEGA 5DHQA 4LJ8A 3IR6A 3ROQA 1QIGA 4L02A 1GPNA 1QGUB 3WGYA 2OK8A 4RA9B 1WS6A 4R6XA 4QOFA 1PK8A 4C89A 5JAZA 3H4IA 1GU7A 4FCWA 3T7EA 2QV0A 2RGUA 3WC4A 4L15A 4BL5A 5I01A 2WXKA 4X00A 4MUJA 1BX3A 1USWA 3K1AB 5G1PA 3UMCA 4KG7A 5JZOA 5F77A 4QATA 2GEKA 3PJEA 3TQOA 4AJ1A 2PS1A 3OURA 3E58A 3KZ1E 3K9QO 2A35A 4OMDA 4Q6WA 4R2LA 5A6VA 1GL9B 3QBTA 1V8ZA 2CJPA 3P9RA 3OUTA 4ZOLA 1AMOA 2VT3A 1DKMA 5D6NA 1G5RA 1PT5A 2Y1OA 5A23A 1GU0A 3FUVA 4LCBA 4Y6QA 1S0UA 1PFKA 5DNEA 4J6EA 4X1IA 4KZ0A 1PG5A 1G4HA 1H0AA 1ICEA 3MKQB 1JSLA 2E48A 2OHXA 1I6WA 2QRVA 3FPKA 3LGXA 3QEMA 3L7YA 4M83A 1CUWA 2P9UG 1HH4A 1NM5C 3LECA 4GX1A 4MCHA 3TNDA 2BCGY 4XQEA 1N36B 1PS8A 2D1FA 3SC6A 2HF8A 3PHJA 1O8CA 4GRIA 1BU8A 4JR1A 4PNHA 7ABPA 3EEOA 2VAVA 4Q4JB 5AW3A 2I99A 3LS2A 1OZ0A 1VLHA 4UOZA 4GI3A 3H2SA 1JG7A 3IEXA 5DZSA 3HBAA 3X43A 4DXHA 2VTDA 2F8TA 1J8VA 2B4TO 1WMFA 2X7XA 3ZNNA 2Q49A 3QSYA 3O75A 1H2YA 1R9MA 3EEYA 2ZSIA 5EUBA 1H93A 4JLPA 5IM5A 1L1FA 1JLHA 4G5RA 3TLXA 3AL2A 1RWWA 1JNRB 1C9JA 3ASYA 4KVFA 4ZI5A 1RI5A 2ZFUA 3E37A 2V5AA 4NBKA 1ATIA 1SA0A 3CLRD 5A6SB 1VPVA 3LUAA 3CBGA 3PQ3A 1XZDA 1SBQA 1WB6A 1M0TA 1VJCA 4IIDA 4PAGA 4BEVA 3FHJA 3WTBA 2AOWA 2WMNA 1VB5A 1N2GA 3Q8KA 1WXEA 3CRRA 2Y1XA 3P9NA 2J7KA 3S8YA 1T91A 1R4MB 4HEQA 1R4AA 4DEYA 2XQFA 1XWWA 3SJAA 1Y48E 3IT0A 5K03A 3DV2A 5B37A 3PPIA 3CSTA 3OE4A 4MYRA 1TYDE 2WPDD 2X9NA 3PZ4A 2JH3A 3FETA 2RGRA 3EXHC 5ENSD 4IDCA 4XB1A 1NVVQ 4DV0B 3ZGLA 4MGZR 2LD4A 1WDWB 4HWRA 1DKNA 1ADFA 2JZNA 3U4IA 3G9QA 4DBZA 4GMKA 1MGOA 2YYSA 5L45A 3BXOA 4AECA 5DSTA 4HUTA 3U1BA 1DAOA 2FUKA 3OE5A 4RENA 1I6LA 3DT8A 2P1DA 5AVRA 5LMCA 2YW2A 3U4QB 4NRHB 2YIDA 1TYQG 4HB3A 1BKYA 1NRIA 2LCIA 1UBKS 1QTIA 2PZBA 2NTVA 4UUQA 3U4AA 1NQXA 1RU3A 1N9AA 3C5WP 1XPRA 3RG2A 3QX3A 2OG2A 4PX9A 1UC8A 3FUKA 3TL3A 3Q15C 421PA 3IEPA 5JJ7A 1RLIA 4JSYA 1BSVA 2FUG6 5ESRA 1XMPA 2VHQA 3GRVA 1OJLA 3HEAA 2NZUG 1XZEA 3PNLB 2MYNA 3L0YA 3FDZB 3ZQJA 1VIVA 2JEYA 1YHYA 4PFQA 4I1PA 2XW6A 4U0KA 3DBOB 4YROA 3B7SA 2ZIUB 4QVGA 5ENQD 3R6LA 4C6SA 2I2AA 4BEBA 2AX4A 3COPA 2I7CA 4MTCA 1TM5E 4MPTA 1U6KA 1BWSA 1EVKA 3OAAA 1SY7A 4R8KA 4YK7A 5AJXA 3SFTA 5AM2A 2EJWA 2HQ1A 4UVEA 3VR4H 2D74A 3AKDA 3KT8A 5TLSA 1W5EA 4QTXA 2ZG6A 1XCOA 3MWJA 4U7DA 2VZ8A 1V1RB 3HY4A 4TSRA 5AHOA 1DVRA 1TADA 1Y3HA 4MKHA 2A3RA 1DCFA 3ITWA 3JTEA 1RQGA 5HA5A 3SHTA 1H2WA 5BOVA 1H6DA 4PM4A 2DLDA 3BH7A 4IVNA 3QBEA 1NBWB 2AT1A 5T41A 4QBKA 2XMCA 4J0QA 5COBA 4G0QA 2HRZA 2CVHA 2WUDA 3DOUA 1GVNB 4MQBA 5ALSA 3CKBA 3VUFA 4ME6A 3CE9A 2OHGA 2X76A 3DYIA 1JIXA 1J9GA 3PU6A 4M9XA 4XYBA 3RTDA 4CU2A 5JCXA 2Z2XA 3CNHA 5EJ8A 1WW2A 2NTYC 2V0CA 2ZTLA 4RPKA 4B79A 2IUFA 1RMQA 4QJ5A 3HCNA 3K6KA 4DDWA 3AG1E 2GJSA 1R4NA 3PNYA 1XRPA 4XD2A 4OQ4A 3QKSA 1JEDA 2ZKLA 4C0MA 1MTZA 1UQTA 1OZGA 1KO1A 3NX4A 2OSBA 3T7SA 3LQ1A 2JLZA 3LF2A 1XVIA 5F1PA 4E5UA 1XSEA 1N2SA 3BGIA 2BTQB 2ZGDA 1K86A 2LUOA 2ZJBA 3IMEA 3TLMA 2P9SG 1PYOA 3LX4A 5CVCA 1Z3YA 1Z5GA 2W6CX 1F5SA 2BFAA 3CU5A 3PNPA 1AQJA 2FMTA 5CVVA 2MWMA 3L8EA 5KNDH 2R44A 4K86A 3KWJA 5ALPA 2EERA 4U7PB 2WJGA 1E2IA 4DLAA 2WKRA 3CNQS 3DBLA 4AIFA 1SUFA 2WJ3A 2WJHA 2ZBRA 3AIOA 3O4RA 3TMYA 4JI8B 3L1KA 2JNWA 1NOKA 2B0CA 2QVCA 3LFUA 2R7MA 3GC6A 4MV9A 3BHNA 4ZMSA 1N92A 3H5AA 1KIMA 4OQPA 1YB4A 4WN3A 3ASDA 1LBHA 1OAOC 3O6VA 1INZA 1XAIA 2F1KA 2LR0A 2RHBA 4HFNA 2NQ8A 3IXMA 4KBGA 4NSNA 2HSJA 5ALKA 4ZIRB 1DPFA 4D3SA 3RTAA 2C5HA 2HLDD 3QPUA 4YJ3F 3D1VA 1YJCA 2YJ5A 3HJGA 3OBIA 4GQAA 3ZU7B 4GM1A 3FUIA 1U3CA 5AM0A 3E7FA 3SY8A 4EHBA 5CEJA 3QVLA 3MJCA 4MEAA 4RJIA 2ZBUA 3WWYA 4IJUA 2BLNA 3A58B 3PC8A 1GGMA 3DUWA 1NDUA 2VDQB 2WG2A 3QVUA 4MR7B 3OD1A 2ET6A 4Y9TA 2WF5A 1CUYA 2LXNA 1PR5A 4IV8A 4CQNA 4EZKA 4TL8A 1D4AA 4OI2A 4MKTA 3Q88A 3HYTA 3FYSA 3SD7A 2QA5A 2GEFA 5ERGB 1X1EA 1S96A 1MAUA 1IEWA 3ISJA 1MB3A 2JAPA 3QVVA 2HSZA 1ICIA 1UAGA 2R60A 4PYNA 2C61A 2ZJ5A 4ZOBA 2H4HA 1OX4A 1P7CA 2NZYA 1VPDA 2YV3A 3FI0A 1OH6A 1KE2A 1AXRA 1KU0A 1Y82A 2A0XA 5K20A 5F1OA 3T3OA 1PTJA 2E4YA 3QNUA 1I2ZA 2VG8A 3W5CA 4KFSA 4O2LA 5GP1A 3GK3A 4ZALA 1YB1A 1VIYA 2XUPA 4TLBA 3RYFB 1RM3A 3VBEA 1BAPA 4HLCA 2VTEA 1IQPA 3DE5X 3TQIA 2ZYUX 3K1TA 3EIQC 2X23A 4JP8A 1NXSA 4R9SA 1Z7EA 2GEVA 2Q2NA 3QKUA 2AK3A 3DLHA 1HZJA 2EJCA 1QGAA 1X7DA 3R0XA 3DRAA 2RKWA 1XZPA 2ZYRA 3AV0B 2G08A 2PYZA 1N2HA 3KKOA 3D02A 2CJYA 4B8WA 2IFUA 3O4ZA 1SU6A 1W49A 2R11A 3F49S 3MYVA 4MWBA 3OO0A 1U2SA 4MUIA 3LKBA 2HT6A 2IQIA 1Z4PX 2CLEB 1T8SA 1Y6GA 3D1LA 3WYDA 4I5EA 5L3SA 3EEQA 1M1XB 4AYWA 3OZ7A 2OP0A 1IBSA 2HEGA 2HHAA 4D98A 5TSDA 3OFND 3Q8LA 3I4GA 3MD9A 1QOQB 3O4HA 3B3AA 3OEYA 4N4AA 1JMKC 1XVLA 4U95D 3HFJA 3OE1A 4MIOA 5KVAA 3DVRX 3U60B 4C5BA 2V9CA 4HT3B 2W70A 2FSPA 3E4DA 1TK2A 1YA8A 5BYJA 3ADOA 3RYHB 2RHLA 3WGGA 4JQZA 1N5MA 5KTYA 3R7NA 2QN7A 2R6R1 3DM9B 4KO2S 4E14A 3RS8A 3U3MA 5IANA 3WMXA 1T34A 4CG1A 4YGYA 2H4YA 3LW7A 5IH3A 4TWZA 3ZKJA 2FX3A 3DBVO 1IHOA 1RMTA 3ZWXA 3EVBA 3WGIA 4G0MA 5EPOA 3HXFA 2WMDA 1NDQA 1SCIA 1ID8A 4TYQA 4PUCA 2IONA 3IBEA 1JAHA 2I4NA 1EM8B 2YOGA 4R9NA 1CVIA 1CZUA 1QMGA 3WJ2A 5M7EA 3TJPA 2PV0A 4TUYA 1QHNA 2PUAA 3QI7A 1JU3A 1Y3AA 3SYKA 8AT1A 2P65A 1GSIA 1MF7A 1T2FA 4OKSA 4BVLA 4MLDA 4O63O 4Q19A 2QX7A 3PQ5A 3TL5A 2HRCA 1EXVA 4QBTA 2FRDC 3AZPA 3MTJA 2PE5A 3TLBA 3HZRA 2NVUA 1MJHA 1WCWA 3AS5A 5A6CA 3TLAA 3RRFA 3NHPA 3KHSA 2F9MA 13PKA 1AE1A 1KZGB 1PHRA 2PS3A 3KKLA 3H9EO 4HAIA 3E9DA 4EGCB 5JNRA 3N2IA 1BWRA 3QYFA 1HT3A 2ICAA 4JJ7A 3FR7A 4BKQA 2GPTA 4UM5A 1T1EA 4Y2GA 1RVV1 3ZU4A 1EHCA 1GN8A 2X2FA 4C4PA 5H70A 7GPBA 2OAP1 3LS8A 1EHIA 4Q7KA 3LK6A 5C7OO 5AXCA 1CUFA 3HNPA 1GDHA 5GZ1A 3ITNA 1YZQA 2C7VA 5LQCA 4PLHA 3SX0A 5I7FA 5KUTA 3VR0A 1Z0UA 2ZPAA 3RAFC 3BZWA 5K9ZA 3HVKA 1UP7A 4NDZA 5TMBA 1ZONA 2ZKIA 5ALDA 4JR2A 5JSFA 3LMKA 3QM1A 4B3GA 3C6YA 4D6XA 1MO4A 1FP6A 2JCXA 2PGLA 3C8MA 5C52B 2AMFA 1XF9A 2H52A 5ER6A 4CCAA 3LVQE 4CCYB 5BN4B 1L8OA 2PU7A 1G8YA 2VHXA 5AW1A 3G2PA 4OHZA 1PDOA 1NA0A 4P3NA 1BE1A 1X7XA 4EF6A 5KYXA 1IOZA 2ZPUA 5L53A 4DPRA 1AGXA 5JVDA 3OUZA 4KZPA 4C30A 3TVTA 4L9SA 3C16C 2JJ2A 1D0SA 2WA1A 4DR5B 1FRQA 5J2UF 2BHLA 2ORIA 3AM4A 2CDRA 3CB4A 2YHBA 4DCNA 3EOZA 3IEGA 3L9XA 2ZWMA 2VRWA 5JCJA 2FJ0A 3NCTA 2OBFA 1R0WA 3AEUB 2RCYA 4AF8A 3UM3A 5DDIP 1V8FA 1YZHA 3SAJA 1ZGCA 4LYEA 5IXSA 1O89A 5C35A 1Z8FA 1HGXA 5AW4A 2AC7A 1RKVA 3NOVA 1TZ2A 4G5GA 4M76B 5FEUA 3G59A 4D97A 1VPLA 2XNJA 1FVFA 2GRRB 3HXCA 2ERCA 2Y0EA 3C43A 5KQPA 3RSFA 4RH0A 5F23A 3J5QB 1V9LA 1ZXBA 2OG1A 2GPAA 3R7DA 2XCIA 4UQPA 4E2XA 4HAZA 1G8JA 1P9LA 1QR6A 3ZDAA 1NAIA 2IWRA 5MFZA 1WF6A 3L0DA 5K0NA 1QSGA 3W6PA 721PA 4GOLD 2B92A 3AR9A 2EKZA 3KOXA 1NJFA 5DX8A 4ZQFA 1RBMA 1CRWG 2JIPA 3FAZA 4YRLA 2IQ5A 5G2OA 2GJKA 2QBYA 3WGZA 5JU6A 3FY4A 3RE1A 2F8SA 4EO7A 4L3VA 1IKND 1B43A 5F21A 2PIDA 1E99A 1FFEA 3F67A 3NHSA 2J07A 4QBIA 4CL3A 3HDYA 1TEZA 5K3DA 4WY8A 3KUKA 3Q3EA 3UGQA 4JCCA 2IY7A 5FNVB 4AJHA 2OEVA 2R6DA 2FW9A 3DDHA 4P4GA 3L5KA 1Y5RA 2VHYA 3R09A 3OKFA 4NJEA 3U64A 2QV7A 1U31A 1D1TA 3KOWA 5KSWB 2JFFA 2R66A 3J7AC 3GPLA 5CURA 1NX6A 3T1OA 3FKJA 3PGLA 3TCKA 1E4YA 2R8ZA 2OFXA 1TQ2A 1CS0B 3F5DA 2WYWA 1QYRA 2JLBA 2J9YB 1ONPA 1Q50A 2AN4A 1N3IA 5AUQA 5ELLA 1DKOA 1O4VA 4DJ5X 5H9WA 1YD7A 2HMYB 1I2BA 1GA1A 2X6KA 3RO2A 3D59A 5A1JA 2BCJQ 1JSCA 4CMJA 3GJ5A 3KZXA 3OZCA 4IIYA 4WHMA 1E4EA 1U7ZA 2V65A 2F6RA 3B53X 4IJQA 1WTAA 2WLSA 4QJIA 1QRRA 1SOMA 3JVEA 2XF2A 5LP6C 2I4LA 3IP3A 2FPSA 3VH4A 5K3SA 2JLAA 2HK9A 2M1XA 4JYBA 4GSYA 4WFIA 2W2OA 4LOJA 5HX7A 3IXQA 1R37A 3Q12A 4HBZA 3TVDA 2WUWE 3WB1A 4AO6A 3HK2A 5GPBA 3RSSA 3DF9A 2FETA 3AUTA 3JQ1A 2H4ZA 3OD5A 4I14A 2W2PA 4GTRA 1C7EA 1UKBA 4N7BA 2OO5A 4GKAA 4IDPA 1G3IA 1TA4A 4I9GA 4NE7A 5T4EA 2Q3LA 3FM9A 4ZYXA 3E84A 3DLBA 1Y37A 1X1RA 2A7QA 2R7LA 4CQLB 4EHLA 4EYOA 4ZMRA 6ABPA 1ZA1A 3QX8A 1KJZA 3WL3A 1T2AA 3KOMA 1I2MA 4GA0A 1F8YA 1LSOA 1M2OB 2HHLA 4OBWA 3GW8A 4UU8A 2HU8A 1J42A 3CNLA 4GMXA 1D2AA 2ZETA 3KNZA 4BX8A 1KC1A 4O4LB 4NECA 1RXVA 1DADA 2O0HA 2IH5A 4FB4A 2TRSB 4JB2A 1E8NA 4NV0A 1EVEA 2PJZA 2YWGA 3RU9A 2C84A 1XZFA 4NJOA 5K0GA 3DP7A 4YA6A 2AK2A 2A9FA 2C4HA 3MM4A 5AICA 1N9GA 4FMPA 1OXSC 2XPCA 2X19A 4LHVA 4I17A 4M21A 3EWAA 3ZD9A 4E6EA 3EDTB 3TXYA 5D84A 1SUIA 2GMWA 5J08A 1V5WA 2GN4A 2AJLI 4O2BA 5ADHA 1PUJA 3KSBC 3FHTA 3HVHA 3JZIA 4LRUA 5HTKA 3ZV7A 4I4NA 3DEZA 4QDZA 4V0RA 2ECPA 1ULHA 4IHJB 4MYUA 3UH0A 3K9GA 2MR5A 2L6BA 1CF2O 5K8IA 4A55A 3E34A 4XJSA 2XZTG 1Y42X 3JQGA 1DKRA 1BZYA 2F3RA 3JXEA 1AGNA 1ZNYA 3R6GA 4TWAA 4BRZA 1M6YA 2B5WA 1AQUA 2VLBA 3BWEA 3HPRA 1A98A 4JLDA 1ZRMA 2CNOA 4CM6A 4YUWA 1TJ5A 3P7MA 4YREA 5KU7A 4MO2A 3U6KA 2HSEA 4RA9A 1GNQA 3ASNE 1I3MA 2WMOB 4NU0A 2LE0A 4Q9HA 4GUDA 1D03A 3ZQ4A 4L51A 2VRCD 3DD1A 5CYOA 5IKEA 1PEYA 1DRVA 3V3KA 3BKXA 3Q98A 1MB0A 1G8MA 4XIYA 4OQDA 2B6NA 1NBAA 1VBFA 3R7LA 1WHSB 4OHOA 1B4DA 1HNWB 4I3GA 4Q3LA 1EM8A 2OLKA 1QGOA 2ZYSA 2VO1A 3B20A 2P9YA 1DUVG 4FE4A 2FZ4A 1VRCA 2VJDA 3UINC 1EVZA 3IPRA 1KSJA 3R40A 4HNHA 2I80A 3I1FA 4PXAA 3WDLA 4G0YA 2FE4A 4NC9A 3I5PA 1QGED 1ELWA 2NAFA 3IMKA 4JC8A 1OBFO 4MW1A 2E37A 4U3JA 1B14A 2HRDA 5JFTA 3MOSA 2BZSA 1II8B 5B3SE 1PZNA 4ZQHA 3R7AA 3WDSA 3PV0A 2CHXA 4PLZA 3ZUPA 5BWLA 3R24A 2Z4TA 1ZYUA 2UYOA 5FUQA 1NLFA 3L7NA 3H7IA 1A2OA 1F5NA 1YB7A 5FTMA 3DL4A 5ISMA 1ZVQA 4HTFB 4M22A 3VR2A 1KVTA 2OLEA 1OD6A 1S4MA 1YC5A 1N32B 4U8HA 4I55A 2W43A 3BM5A 1WTCA 2XZDA 3MYRA 1E3IA 4IZHA 3CQGB 4V2IA 1QQAA 5JDCA 4AC9A 3CLVA 2Y4TA 3QTTA 1ZBPA 4QNMA 2CLIB 2UYYA 4M0DA 5BSRA 1XZBA 5J4LA 3F6YA 1HDCA 3H2IA 1L5KA 3K9BA 2C94A 4M0UA 4MQ6A 3IDAA 1Q92A 4JS0A 5FEMA 4FKZA 3ZXIA 2VDVE 4L6CA 4NS4A 1GCAA 3NALA 1XYYA 4CUZA 1MAHA 4EPRA 3HYNA 1F6DA 2W2NA 4Q7MB 5L51A 2WIKA 2BOVA 1UADA 1YA6A 3FWYA 3I0ZA 3K2EA 4XR9A 1QIMA 4GPIB 1A4RA 3GJ8A 1IATA 4ZDIA 1DC8A 1TKBA 4OX9B 1U02A 3UXEA 4AX4A 4LC9A 1TJCA 2D8MA 1E60A 1IE3A 4GYWA 3U17A 5GOZA 3VTKA 4Q1AA 4G6ZA 3ZZNA 5F2KA 1W0JD 2WAXA 2GARA 1YDFA 3B2NA 1P91A 1ZD2P 2IEDA 4MRSA 5L7WA 4PY2A 1DKUA 4A6XA 5FAKA 3E18A 3FNIA 3EGCA 4DBLE 1KRXA 2QG9A 1HE1C 2BGWA 4HB0A 4EFDA 2PH7A 3AG6A 2YIMA 1YFKA 2EBHX 3P0FA 3KJEA 4RHUA 3PT9A 5KX5B 2ZEJA 4EY7A 1DDGA 3KHTA 5BR7A 2IDKA 2GI4A 4MKXA 2GJ9A 1GFIA 1RWXA 2QNRA 3TGPA 3J80A 2O2DA 3D6AA 5LP0A 2R8OA 3TJZA 3P8ZA 3WZLA 2YH2A 5JECA 2AJ8A 4DG8A 5LZ2A 1XZHA 3DE4X 4EKGA 3ILSA 4OQEA 1ZD3A 1NU8A 5T4YA 2Y93A 1YBHA 3PSAA 4FFWA 1NUTA 1U3GA 4MWSA 4J90A 4KN9S 1MPXA 1PI3A 3B1YA 4IDQA 3IR5A 2QT1A 3N2KA 2PXCA 5SZHB 4PTZA 4L3WA 1ORTA 3E3AA 4ZAZA 4J3NA 4EGSA 4BGUA 4QOGA 4KU4A 5KNBA 1E8YA 5EJ9A 5IKOA 4JB3A 1PRYA 3C4JA 1IULA 3ML1A 3D81A 3JCZA 2IP4A 4MJLA 5FA5A 3ZIDA 3EARA 2JLCA 4ER0A 3GRCA 2GHQA 4IMRA 1MJ0A 4BGIA 2NUTA 1GXSB 3ESQA 3ICQB 4Y9DA 3H0KA 2G83A 3DAOA 2V4HC 3GFPA 3HCRA 4B44A 1K9VF 3WFJA 3SVTA 5TF0A 2WB4A 1ZH2A 2JIRA 3ZY6A 3JZAA 4P93A 4Q00A 3MILA 3QGMA 1GV1A 1XMJA 3AJAA 3CTMA 1BJTA 1N5JA 4DFDA 4PAMA 4ES6A 4UYJB 4UULA 6GPBA 5I9IA 1QYCA 3ACDA 2OFWA 4KDRA 3CR3A 3DA8A 3MJRA 3NUZA 2NZ8A 4HX2A 1VZ3A 4ML3A 4HVLA 4AK9A 3EVFA 4FLBA 2O2YA 3ND5A 2WYHA 1V7QA 2P11A 3FDHA 4FHFA 3LSYA 4H0NA 4EKDA 3HJAA 1O5OA 3MJWA 1F20A 4G24A 1PL8A 1T5HX 3ND7A 4Y6CA 1QUEA 2E6UX 1BPOA 2GZSA 3I2FA 3MD0A 1YRBA 4HPXB 4JYCA 3HXTA 5J63A 2QD2A 1SXPA 1U5BA 3BQNB 4YBRA 5E1BA 2ZQZA 3RT9A 4MPRA 2PUDA 4RCZA 1P17A 1OZAA 4U04A 2C2YA 2P0EA 2X0RA 4WUVA 4AP9A 3UJDA 4B2PA 5ADUS 1GUYA 5CLIA 5H4GA 4II7A 2H1OA 2J0EA 2ZR9A 4AURA 2FFBA 2PZFA 4F11A 2VDRB 3KV3O 1AQLA 3E9EA 3OCCA 4FGSA 4U7JA 2OQVA 3SC3A 1MN6A 2AZMA 2XUIA 4HYQA 1DKQA 4M1EA 4EM6A 2W2VA 3HE3A 3NXSA 1R0XA 3GEPA 3E15A 4HXYA 5JYCA 1K68A 1WSDA 2G40A 3R5SA 1W36B 1TNUA 1TDJA 3QU4A 5BN1A 4B3RB 4BZWA 1H42A 5EIAA 1DTWB 2GM4A 3O93A 1DAIA 4FBMA 3RWMB 3ZU2A 3ZWOA 1T6BY 1G3QA 1OBCA 1GUFA 4B4KA 2ANCA 3CURA 3AHJA 2O8FA 1OCOE 2J46A 4RABA 4KO3S 3F5MA 3AHFA 4E21A 2JCGA 1XQ6A 4DQVA 3FNQA 3P5BA 2YYYA 4OB7A 4ZOEA 4P58A 3Q3VA 4ARZA 3CUKA 3PQ7A 4R1NA 1UT6A 2Q4RA 3MQ4A 1JXMA 4XI9A 3DEHA 4EMSA 3T7KA 1Z35A 3TXMA 4TN5A 1ONNA 1IDOA 2QI9C 3WRYC 5FBVB 3U4TA 4MLCA 5KTRA 2BF0X 2I3DA 2QUIA 4OK6A 3N0VA 4OY3A 5E6UA 3ZVNA 4WZAB 3GHYA 3SCZA 5LP6B 1V4VA 3I2GA 1Y3CE 5EAIA 5IC5A 2ZRAA 3NGXA 4QOIA 1EK6A 1QVRA 3BH0A 3EVDA 4ZO7A 3RW9A 4AUMA 2IPAB 4NDNE 3TD6A 4EECA 4XCXA 4B4DA 1SCNE 2CY0A 2GTIA 2QK4A 4B5LA 4HQDA 5AI4A 1JPJA 4E08A 1RXIA 2IZ6A 2XKAA 4WNCA 4AJPA 4F2DA 2YW9A 2J5RA 1LWOA 4L0CA 5FX2A 2C7QA 5DK6A 5IYZA 3OOJA 5K0BA 2H7VA 5EXSA 1P6XA 1ZPDA 2AG8A 1WQ3A 1QGUA 2NO4A 2XD9A 2DWZA 4Z4IA 4QQKA 4BKRA 4CKEA 1GFSA 5FT9A 1Z62A 4ZCTA 1GAXA 4YP6A 3ESLA 2OCGA 4L0QA 3QG1A 4KXLA 3KALA 1FVHA 1EFVB 4FFBB 2WI8A 2ETXA 2MINB 3OZWA 4JBWA 1UXGA 1M67A 2YJ4A 2X6JA 3R7SA 2GT1A 4LNAA 3IP8A 5BYAA 3W1WA 2AZ4A 4LJSA 5BSMA 4HLEA 2FR1A 3KJZA 1IJKA 4A8JC 2RG1A 1XDGA 4TYMA 5K09A 5SZIA 3ZHSA 1DCKA 3KOYA 4R40A 3HBFA 1U3UA 5F76A 4NPCA 2M6KA 2CMFA 2HJVA 4G23A 4LHEA 1V96A 4PFKA 1LWNA 5EPUA 4OI1A 3FE2A 3HGQA 2BTDA 2WTXA 3L1HA 2I1WA 3KSAC 2AOTA 5DH9A 5JHGB 3I2KA 4MWOA 3S29A 5PGMA 5KDDA 5J5CA 1PZGA 1G41A 1XVUA 2AKYA 4Y2RA 1RWOA 3TGOA 2Q9AA 4UAVA 4G5OA 4D9KA 5ALZA 1XZAA 1LPNA 4Z68A 1P0PA 2IKQA 5HNKA 3ZBQA 4N1AA 2AUTA 3IVGA 1JHMA 2CC2A 1OT3A 3R3HA 4IYRA 4N9WA 1WDTA 4NCNA 1N5IA 3L7CA 2ZBQA 3R77A 3GRUA 3GWGA 4LV5B 5FJJA 1GRRA 3TI7A 2FMHA 2YL2A 4YUVA 1FFHA 3OQNA 3H99A 3NW9A 4MPDA 5HIIA 5LVAA 3LPLA 1YK0A 1DCTA 1J24A 3ILVA 2OORC 1O3YA 4D3ZA 2V6MA 1OR8A 4FLHA 3IAS6 1G9SA 3AF4A 4TZKA 4KVMA 1JKFA 2CXXA 3KE9A 4ILGA 3CLUD 4YDRA 4F56A 4JLMA 4YC7A 1Z6YA 2GGFA 4ZKEA 2XUGA 3ID6C 2R79A 4JXKA 2FEAA 3BG5A 4UMFA 4Y2VA 4TV9F 2EJBA 4HC4A 5E1MA 1RYHA 4QPJC 1P9NA 3WGJA 3CRQA 5BWCA 5FWXB 1NG9A 2IH2A 4M7PA 4CTKA 3HL0A 1RBZA 4D4HA 2XYPA 4DMMA 2D0DA 3V30A 2A5YB 1XJQA 3BF8A 3GY0A 2D13A 1SRRA 3UT5B 3PX7A 2ZRJA 3O5AA 4MRRA 2HA2A 3RVLA 1QJ4A 3HG7A 2ZI6A 1P0QA 3N8KA 2ORYA 1JBEA 1U4NA 1AS3A 3KKKA 4OKNA 3B7UX 2BMFA 2NUAA 4Z2YA 3KDPA 2IK8A 2Q0SA 2FH5B 4ME2A 1VLZA 1WBJB 3B9BA 1X3LA 3Q3HA 1DO0A 4BJ5A 5EVCA 4YT5A 1T3TA 2WNSA 3A1EA 4JUIA 3UXMA 2CB0A 1OFGA 5T8IA 2XA1A 4KGDA 5BV1A 1DU4A 3HHMA 1RYDA 1RJGA 1M2KA 3FHOA 2J6IA 3QFCA 4LDJA 5D6OA 5DBOA 4DG5A 1CP3A 1Q0TA 2OZVA 3ED5A 5BOSB 3E2IA 5TS2A 1I7LA 1VL8A 4TKVA 1QQ7A 3A4MA 3QWAA 3HJCA 3FWZA 1O96A 3EISA 1WM1A 2DAPA 4QT0A 1DC7A 3MRXA 4ODIA 4R8SA 4WKPA 2Q1XA 1H66A 1KQOA 4LTNA 2KPOA 2WZQA 3E33A 4IDFA 1Z3CA 4ZFNA 1P5JA 2PL2A 1T0JB 4FYPA 1CQPA 4LSGA 1U63A 4B2LA 2H17A 3PXEA 5FQOA 2C5BA 3GBPA 3WVNA 4N48A 4GU5A 5I7VA 1KAEA 4I9HA 4DIBA 1XG5A 5EHNA 1QH8B 4YRSA 3D7NA 4A1GA 3F4KA 1ZKDA 3L6AA 1Z5UA 3DM5A 2DBAA 1BWPA 2P3SA 4QGBA 2EW8A 5DI3A 4JLWA 2GRQB 5HJ2A 1DC2A 3PC8C 2XGOA 4HBDA 3WLIA 2V74B 3RK1A 2AW3A 2OZEA 3ANNA 3PQDA 2ZRHA 5C4IA 3ZYMA 1G21A 3KYCA 1HT1E 1EIZA 4C1NA 5CA0F 5IT9A 2VSXE 3P9ZA 1DTEA 4JBXA 5D1NA 2I6UA 3D3JA 1X38A 4ZARA 2VPWA 2IIVA 3KS2A 1UOOA 4QDOA 4LNBA 1J0DA 1L8QA 2A5UA 1QH9A 1E1CA 1H0SA 4PWYA 5J1TB 1SZDA 4EAAA 5HWSA 2BPOA 2B78A 3ZU3A 1H6CA 4FFSA 5LLDA 1C30A 1NA5A 2X6TA 3SI5A 3OFJA 1EDUA 2KM1A 4CL8A 1AMNA 3R4CA 4QLBA 1EEHA 3AJEA 4HRVA 3DMGA 5HQ3B 3R41A 4RKEA 4TS3A 4WOBA 3KTAB 5KAPA 3TXNA 3ZBPA 4N76A 5FWYB 1RI4A 1G2OA 3A4LA 1SVWA 4Y6SA 4LDPA 5TIIA 5IWAB 1KVUA 2I54A 3NHKA 1HTBA 4QICA 3B1WA 3FSEA 4CM7A 2UYCA 3ICEA 3LE8A 1EP2B 2WVJA 3TWXA 1CZHA 1LSUA 1CF4A 1Y6IA 5DTRA 1MO5A 3A32A 5ITWA 1X1DA 2PRIA 2VNIA 3ANLA 3T5GA 1XNRB 4DI3A 2Q1UA 4D9EA 3C1TA 4HMOA 4PBRA 5K2OA 1SXJE 3ZEIA 3G5LA 4B7XA 4EELA 1TD1A 2PANA 3D3WB 4M9SA 1JTVA 1G5FA 5JQWA 1TUBB 4J0CA 1QQ6A 3PTZA 1TYCA 4WXEA 2C5GA 4NH4A 1JDUA 1FU8A 1J09A 2J9GA 3JQGB 3L6EA 4RM3A 5CFPA 1BJKA 1T1RA 2ZT8A 3LDAA 1AKWA 5DGDA 1N2EA 3AFIA 4D3XA 4DA4A 5IPFA 1ZITA 5EKDA 5H5JA 1NE2A 1TJYA 2XVZA 1OLUA 3ESXA 4N0EA 5E2IA 1ZR2A 2A5DA 1M54A 3IC5A 2D1QA 4JB8A 4QD3A 3L93A 4W5HA 3SJUA 4A1OA 3KM0A 3TMKA 1N1MA 2QXYA 1IVSA 4B6OA 4J16C 4HUQA 4ZZ0A 2BP7A 4KOAA 1V1MA 2WT9A 2JVKA 4CM4A 4X64B 1C9NA 2P67A 3C14C 3G6KA 1EVLA 4FJ2A 4HBGA 1E7RA 1Z2DA 1K06A 1SVKA 5BSFA 1Q1AA 2J30A 4LWQA 4WTOA 4ZAXA 1WB4A 4DT1A 2WT4A 5MGBA 1H2VC 4CIWA 3Q41A 4ZV4A 3GEBA 2X0DA 2QU7A 3H2GA 1O94A 3GDWA 3LCMA 4P80A 2NADA 2D5LA 1UJBA 1FLNA 2M6SA 4WBSA 1KO5A 4DIDA 4P29A 3THRA 1P77A 2C8LA 1SKMA 1DWUA 5A03A 3HMKA 2DB3A 4K0RA 4CE6A 2REQA 1ZMXA 3I39X 4J2HA 2JB9A 1ITZA 3FBGA 3H8SA 4W9NC 1J9ZA 3H2JA 4X41A 4U6SA 4DC9A 2XCCA 4JLJA 4QUIA 4BETA 2YRWA 2W2KB 4OXIA 5AKGA 3DF7A 4PLPA 4BC0A 3P2OA 4GPEA 5LB2A 3GVHA 4AIIA 3TFQA 1FYXA 4R3WA 1T6YA 4RXMA 1N0VC 4EQFA 4J16A 3EHDA 4J2TA 4DKXA 4DAEA 1E6LA 1FUIA 3HDHA 5KQMA 4BAGA 5AVWA 1EAYA 3QLUC 3IULA 1M1YE 2VNJA 3KWMA 4GBED 3BK7A 4IDBA 3RRMB 2VPIA 3AHDA 3I4CA 3L16A 2VWHA 3FSRA 3GCXA 3NDPA 1XX6A 2OV2A 4U2GA 4CIYA 1U9JA 1T1GA 1W48A 2FPPA 2J3HA 2O48X 4HRNA 2Q21A 1KZ7B 4F8EA 3A4VA 1H22A 2IOQA 2W2MA 3V2GA 3GP5A 1II0A 4Z7NB 5DCLA 5C8VA 5J2UB 2V7EA 3T35A 2EV9A 1C0PA 5F1YA 1IY1A 2PZJA 3BAZA 3RVBA 3SGLA 4RULA 1QP0A 1J2TA 1FP1D 1NUUA 1N4DA 1QO7A 4E5DA 2ZRFA 1OOEA 4JUAA 5TPWA 2P9LG 5FUBA 3I6BA 1L1RA 2C97A 1ZWKA 1GNRA 3JYNA 3K5WA 3MAAC 4Z3DA 3ZCSA 4H7JA 3B12A 2QYUA 2KI5A 4PR3A 3FOEC 1A4UA 4FCTA 1QM5A 2I34A 4ITRC 3C45A 1TTQB 2QMQA 3GHHA 3RC2A 621PA 1ZW6A 2JGRA 4BFSA 2WVGA 3HB0A 5ITZB 3LQ2A 1U3WA 3B9QA 1RCTE 4OLJA 4N5NA 1UJMA 5JJBA 3HA2A 3L7LA 1NI4A 4RMNA 4NIKA 2I8CA 3N6XA 4MB0A 5EIWA 1X1BA 2JI8A 4QU9A 4MVJH 3NHAA 4MRAA 2DC1A 1S8FA 4IRUB 1TCBA 2RAFA 1UEJA 2JA1A 3HJRA 3MCVA 1V48A 4M7RA 2J5QA 4NYIR 2HDNB 4Z9YA 3TNYA 3WYBA 5CDSA 3ZEAA 1GNSA 1JDJA 2R8BA 2DULA 3H42B 1V11B 3OFNA 1OWOA 4JJIA 3RUIA 2NXNA 3OMLA 1VMIA 1TVEA 2CDCA 1GVHA 1SBTA 1ZFNA 4LVCA 3F78A 2GWRA 4LWPA 4ALKA 1APBA 4HNAA 1H5UA 3BHJA 1I6KA 1UZMA 2X6RA 2G77B 1OUVA 1HEYA 2RK4A 1Z17A 2I6FA 3OH8A 3ONFA 5E7QA 4ZI2A 4DBLC 4K2HA 1GYPA 4IR7A 1WXQA 4BMNA 1UMCA 3E7DA 2HUPA 3VTXA 4TQGA 4Z4FA 3AFMA 4CV0A 3RM3A 4PPQA 5EC8A 2HWKA 1R10A 2AC4A 1IFXA 2J45A 2XUOA 3HYCA 4NG5A 1VG0B 2HSGA 4NP6A 4C9BB 1BU9A 2WE8A 2WHYA 4AS3A 1DLJA 1G2PA 1B0PA 1KMHB 1PWXA 3NEAA 5CM9C 2FP4B 3D7SA 4KR2A 2V9ZA 3AJDA 1U3FA 4DMCA 1J4AA 3MS4A 2DYSE 2BELA 2A0UA 4BX3A 1Z2PX 2XMQA 3WMWA 5M5BA 3IQDB 5IP5A 4QOEA 4QQNA 2W2QA 3RLIA 1JQAA 3M2PA 4DQLA 2HPZA 4Y30A 4DUIA 1VMDA 3IMGA 3QWFA 1O58A 1DRWA 4KDEA 1A9ZA 3DE7X 4MVJF 5THKA 1IBKB 5AVUA 3GLHB 3ANXA 2I3GA 4PZLA 4LYJA 1ZM3A 2VTBB 4H2DA 2O8VA 2QTGA 1QVAA 3DCNA 1O5TA 3GGGA 4HX5A 2VDNB 4Y3UA 4YT2A 5C18A 1KWKA 4KQFA 2YXDA 3LA6A 3VGPA 3UPVA 3QC1A 2AXQA 3F7NA 4OQFA 2QN9A 2VEOA 2A0WA 1QCYA 1MC1A 2HK6A 2WD9A 1RDFA 3QDNA 5E4TA 4D99A 3UPUA 3KR0A 4KFUA 3UPTA 4DX1A 1SCQA 2I1VB 3VU0A 2PJRA 3OPNA 5IK2D 2DFTA 2J0SA 4A4DA 1ESCA 2Q62A 5B7PA 4MI3A 2C2XA 4A91A 1VKRA 3I4FA 4N6GA 2EKQA 3GA7A 4Y6WA 1C3LA 4L8VA 1P1IA 4L2LA 2B4KA 3OCJA 3ZXPA 3BE5A 2HLDA 2H08A 4B7CA 4M9ZA 2QL7A 3TAHA 1R0LA 1BMDA 1AIPA 5L4SA 4AKGA 2C3YA 3KUDA 1QH0A 2FSSA 2WPVA 3DFUA 4FOPA 4HSEA 4IL5A 1A8IA 3THOA 3CNEA 3NTLA 2GN1A 5FFFA 4ZI7F 2IVZA 1VBKA 3LHDA 2HYIC 1GQRA 5L6LB 3AFHA 4WVFA 1T2NA 3KKMA 1M66A 3LCUA 3ZBUA 4B75A 1Q0PA 5ALOA 1U1FA 2Q5CA 3PRKE 4DLPA 1NQVA 4F60A 1XAJA 5CEDB 2J3IA 3LDFA 4BECA 1UC5B 2H6HA 5JHAA 3B78A 3EF0A 4RXTA 4TL9A 1ZVVA 1E1QA 3GIDA 4U8YD 4WPGA 1J2JA 1FDRA 1K8RA 1PFVA 2WOJA 3HXLA 4ENTA 4G8DA 4DYVA 1UN8A 3TFOA 1R3UA 4IIXA 2NO7A 1DAEA 4LDRA 4TVKA 5L3ZA 1I3LA 2FPGA 3RTBA 2WHPB 2DPMA 1MP0A 2EATA 1UPTA 1T13A 3MZLB 4MVJG 4BU0A 5IEJA 2P58C 2Q50A 1Y4UA 4FSHA 5EE5B 2IHBA 2XB9A 2YMMA 1RI3A 3ESRA 3GO4A 4DMLA 3U09A 3TLKA 4QU5A 1IWPB 1R16A 3BJIC 4FJ1A 3VNRA 3GMDA 4WLNA 4N39A 5LDDC 4KPGA 2WWHA 4DJFC 4RMJA 5KS2A 4CKYA 2P9IG 2H16A 1GSOA 1XZ8A 4FFRA 1IDN1 3KYIB 1KSGA 4AVYA 5HE8A 1AH2A 5DHSA 3UWKA 4A73A 1Z16A 3EYAA 4N5HX 5HFNA 4AXXA 3JD1A 4XGKA 3CH7A 4ROSA 4HG2A 4RGVA 3Q7PA 4MHOA 1LDMA 2GVDC 2RAPA 3FYTA 4IQFA 4L5YA 3A06A 4TSFD 4RE6A 3LPNA 1OU4A 1RSZA 4R3UC 3ZGNA 2HREA 5LOVA 2WIFA 1X7ZB 3V4ZA 2ZUTA 4FHGA 1E3EA 1KAOA 1GO2A 2OV8A 2A5EA 2O6HA 4BJHB 4TZ6A 4OMUA 1JHDA 3R9WA 2P30A 4BNLA 4MUNA 2EFJA 3GEHA 3BT3A 3ORFA 3V1KA 2O5EA 2Q46A 5DASA 1Z8NA 4ONEA 1FXWA 3CX3A 5KOIA 4HNQA 4MJ7A 3QKRB 4KZKA 1AMUA 1OILA 1UXKA 3P2JA 1E96A 1MO2A 3CR8A 4G1CA 3S7DA 1JEJA 3OP1A 4LDNA 4LGYA 2ONJA 3X3HA 4RPCA 3HYMB 2FYTA 1TNYA 1Q7BA 4MUBA 3ONEA 2C2MA 1SUDA 4RVGA 2I8LA 5CFMA 2G06A 5CLQA 1OYWA 2J08A 2IP1A 4LMPA 4R2MA 4DEVA 1H6KA 5CXSA 2XCSB 1D2GA 1TLLA 2AWOA 3NHRA 3GOQA 2FWJA 1DARA 4HZGA 2I91A 3LKZA 1JUDA 1N4RA 1U2ZA 2MDTA 4U96D 2P4SA 3NANA 4ZOCA 1RACA 2QRPA 3BDVA 4DS3A 1TK9A 2YRXA 4NRDA 4NNJA 4X92A 4BO8A 5BSGA 1WDLA 4P5DA 2GVNA 4MMXB 1TVMA 2YVKA 4Y9SA 1E2PA 4O4LA 1SHUX 1B2LA 4WEOA 4X63A 3B51X 3OT4A 3MHTA 5DXJA 4A0SA 5ED4A 2JPDA 2AYXA 2EXXA 1TZJA 4OQMA 4QXQA 4KQGA 3FHEA 1G7TA 1SVMA 2VCHA 5FNVF 3MIIA 4CVNA 3JQ6A 4NL4H 1P1BA 1R9NA 5HDQA 2ZDHA 1KZPA 4QYMA 5HUHA 1O0BA 5KDLA 4FWBA 4KTVE 3QLJA 4QNNA 4XWKA 7REQA 1BC5A 2HM8A 2CHVA 1FUUA 1RE1A 2NO0A 3QFRA 2QTCA 3PLRA 5KQLA 1XKLA 1PR4A 1AUQA 4FZ5A 5DCUA 4EEXA 3AU5A 4F8JA 5HTOA 3D0QA 5ARCA 3A4IA 3PI7A 5JWOA 1CIJA 3FFWA 4GKJB 3EAFA 4YX9A 3KL2A 1Q0SA 4TYWA 4HAOA 1PJTA 4IJVA 2XUQA 1XL1A 2F3SA 4XUGB 4MROA 3Q8WA 2W4QA 5K1ZA 4AKTA 2E4WA 5KB3A 1VCIA 1H1LB 2O3RA 4FUTA 5T64A 2GR9A 4AN0A 3DZFA 2F37A 2O2EA 3P1JA 2CUTA 3IO3A 4GX0A 1FRVA 1UPUA 3U4GA 5EZYB 4QYXA 3LYAA 4OU4A 2C2GA 3CG0A 2LDXA 2GO1A 4M9RA 3UPDA 4DWJA 4EUSA 5ELMA 2ERYA 1XA3A 4AZWA 1J8DA 4MR9B 1UXIA 3AUXA 3LUBA 1NPTO 2W11A 1U0SY 3KEQA 1K2WA 4RF2A 1XUOA 5TY0A 3W7AA 4DV2B 1HTWA 3CHMA 1BRMA 2WZCA 5JS8A 3ORRA 3GLSA 4HAWA 3IIKA 3VDRA 3LUFA 5CVDA 1JNYA 4UKDA 5CTJA 2XKBA 1SQ0A 1TT7A 4IBOA 4J07A 3V4FA 4BFLA 5L7TA 3IILA 4HNRA 3WGOA 5JMPA 5EIEA 4XE5A 4DT1B 4Q3OA 3ZTTA 5F98A 3CO5A 1Q2XA 3V31A 3DSSA 1U0OC 1N5RA 3W05A 1JJVA 4GKKB 3PE4A 3QWVA 4FILA 4X5OA 3UMGA 3BWYA 3FUUA 3L6BA 1G20E 3FPGA 1ORDA 3SM3A 4M8KA 3C3XA 2C7BA 3ZX5A 4BJ6A 4GA2A 3NBZC 2Q5EA 1Y5IA 5EXTA 5AKKA 3IAXA 1UBEA 2GJ8A 1OREA 1P1JA 5C3UA 1GNLA 1YUNA 2CZQA 2GEUA 4CYMD 1KI6B 1ODSA 2XMZA 4P31A 3S7TA 3TSZA 4C07A 3LDUA 4PCLA 4RA6B 4AMBA 1IN8A 2ZUCA 1B89A 3HL4A 4N3AA 5J5AA 4PYJA 4TXLA 1TTHA 3ZIAA 4UEOA 3RKSA 2J33A 1N6HA 1EG2A 4R1PA 5AKEA 3A6EA 2OFPA 3VJLA 3HXPA 4BP9A 1U5BB 1UJNA 1M2WA 2P9CA 1U28C 2FPRA 3BU8A 4M1KA 1JHQA 1UPXA 2PRZA 3CLHA 3SC2B 5T4HA 1CETA 5I3CA 2Z0MA 5DJ5A 5TJ9A 4FBLA 3IGFA 4MJ3A 1L8LA 1PT6A 2Z9BA 1HORA 5LA6F 1E4EB 5TQ0A 4HFGA 4M1MA 1YZFA 4YLYA 1TUEA 3GCWA 3VTFA 1NRJB 1VA4A 3AWIA 3P9QA 3QOUA 1KI3A 3UCXA 4DYHA 3K5IA 4BV3A 3LPZA 1ZP6A 4Z9XA 3ODGA 4Z1MD 4OAOA 5DBIA 3GJYA 1RZUA 1C3XA 4DVGA 3NZEA 1XDBA 4YJHA 3SSAA 4B45A 4E4TA 3H2KA 3IAAA 3WKEA 4HX9A 4CI0B 3PNTB 3K09A 2O07A 4K87A 2QPTA 2D2EA 3DDZX 3PNBA 3REFA 1ODKA 1P60A 3GUVA 5F64A 2XZOA 3F7MA 1PGOA 4FYJA 2OCBA 2PL9A 3FUXA 3DQPA 4NDAA 4DMGA 4MMYB 1M9NA 1XLWA 3W5JA 1V7PC 2K7FA 4EP1A 2WE7A 4MQFB 4Q3KA 4TM7A 5FTKA 3BMQB 5LJIA 3LP5A 4RTMA 1MXHA 4LA4A 3WAKA 2HMAA 4QDXA 3MTDA 1ABFA 4I7EA 4HB5A 4K5QA 1U81A 4PZYA 1HWYA 3CMCO 4Q4DA 4R16A 5B6IA 3T0FA 1DQPA 5BMVA 1M7GA 1QOZA 1EE9A 1Z7YA 3AFNA 4HEHA 4F04A 4AKSA 1WZNA 2X38A 2UYQA 2H07A 3F8SA 2B69A 1IHYA 1WMAA 1TR4A 3GH1A 1Z7WA 5F12A 5T6MA 4JA9A 4XGQA 3R7QA 2G4VA 2V96A 2ZUUA 4O29A 2CJFA 2I9CA 1RRPA 3VR5D 1BA2A 4ND8A 4YRPA 4Q5IA 1UWVA 4F3VA 2Y1GA 2ZAYA 4W8GA 4Q9KA 2VDJA 1R0RE 3LCCA 2CBXA 1XU7A 5D3ZA 1JIIA 3T6KA 3CZQA 4YYEA 4ZN6A 5IM4A 2HA4A 3FCOA 4IHAA 3ZW8A 1KK0A 1SZPA 4JXJA 5F4ZA 5BUCA 1JZQA 2AHRA 3S44A 5I4KA 5JS6A 4QHTA 5AUOB 3I61A 3DVAB 4BWVA 2JAQA 1R8YA 5KX5A 3ROFA 1ENOA 1NZNA 3IQIX 3LKDA 1WHTB 2BD0A 3SF0A 1GKYA 4WZ6A 2JRLA 3O4GA 4HWTA 2F64A 3MS7A 1T8WA 3HR8A 4IH4A 5CGQB 3UCFA 5B4UA 4GG1A 5ECWA 4IO0A 1SURA 2G82A 1V47A 2ON6A 1J8FA 3EBOA 3JQEA 5J2TF 2ZYAA 5EWLA 4EHDA 1FT1A 4QA9A 4QQIA 2IFTA 4NZPA 2HTEA 3ELYA 3PJFA 4IIFA 3U1TA 1ZN8A 1QQ5A 1K0FA 4LG1A 4DQDA 1LTKA 5H68A 3O4VA 5T67A 5L3SB 3NORA 1YQDA 1EZ1A 1JVNA 2O06A 4J8YA 5LUAA 5KYXB 3JYSA 1XTIA 4CIBA 3H17A 4L9WA 4LXIA 3R6DA 3PJDA 3BIWA 1QRSA 4YCAA 1YE3A 3S3TA 4K6MA 3FFAA 4QDJA 3CKKA 2HBZA 2AJDA 4B83A 2IYQA 4OO3A 2VH2A 1VGVA 4LVNA 1DC4A 4ARVA 2ZUEA 2EIKE 3RBZA 3LH5A 4RCVA 4G1EB 4LGCA 2G1UA 3ENQA 5BW5A 1VHJA 5IN4A 2V7TA 1C9YA 3K4QA 2BZ1A 2EFCB 2QTVB 1VP9A 2WD7A 2ZITA 3E3LA 4K6OA 4N12A 3SLGA 3G7UA 3FOCA 4GGPA 1GPUA 5COAA 2JAWA 3QVGA 4CGWA 1Z75A 2FPUA 4A0QA 3IODA 1QHGA 2PFSA 2HQOA 2ODBA 4MCIA 4HDRB 3TTUA 5AKHA 2F0YA 4YCDA 4XIFA 2TECE 1SOVA 4RM2A 4YGXB 4YRAA 3A37A 1V71A 1ZUD1 1NVBA 4D4MA 4RTSA 2JFZA 3AIIA 4BX9A 1E5DA 2VPXA 2D7JA 5REQB 1WCIA 1QG4A 2I22A 4NI5A 2YNMC 4X0EA 1CUSA 2I87A 3M1AA 3HUDA 5EJMA 4KNYA 3O8CA 3RWOA 1BDIA 3OOYA 3OIYA 3LBNA 5AAOA 2FR8C 2PZAA 2JG3A 4QFVA 4G0WA 1Q1QA 3CVWA 1AKTA 4TTIA 4DLSA 1T24A 1FYVA 3N2YA 3QWWA 5JO9A 4UUOA 3Q7TA 1WABA 4HNVA 3WKBA 2KMLA 1TYAE 2V7BA 2QDKA 3NOGD 4FFBA 4LJRA 2Z98A 3V33A 2C07A 3LGSA 4OP1A 2QRLA 3B85A 5HF6A 5ALEA 5B7GA 4BRUA 1OFHA 3G5AA 4OP3A 1NF8A 4EZJA 3UIPC 3IHLA 3KT0A 4FJYA 1A9QA 1DIAA 3DAGA 4PZCA 5J5VA 3WA7A 2KB0A 3E5NA 2L42A 1ADGA 5KYUB 2SKDA 1F3LA 2C58A 3O92A 2X5HA 1CY7A 4Q05A 5EUCA 4M7CA 4TXHA 1VMKA 4YONB 1JAIA 4H6WA 3CVVA 1CUIA 1IY0A 4DX6D 1JHOA 5CU7A 1BYIA 3Q49B 3OT1B 2R0QC 3QELA 1MQ8B 3DTTA