4NBUA

Crystal structure of fabg from bacillus sp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
242
Chain Sequence
SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
pubmed doi rcsb
source organism Bacillus sp. sg-1
molecule tags Oxidoreductase
total genus 96
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nbuA00
2WDZA 3FBTA 1ZEMA 3IMFA 3PJGA 4LSWA 3UOGA 3M6IA 5KVSA 3JV7A 4FOSA 2HK7A 3OIGA 4G5HA 3K92A 1C14A 2GN6A 4DVJA 2VCYA 4GKBA 4HWKA 3H9GA 4CL8A 3WS7A 4E33A 5IDWA 3Q6IA 3LDHA 5DT9A 2PD3A 3TZ6A 2J3HA 4BMVA 1E5QA 2J8ZA 3JQGA 1YKFA 3JQAD 1B16A 2NWQA 4OJNA 4TRJA 2DTXA 1BTOA 1TEHA 3GVPA 4UVHA 1BXGA 3KO8A 4RLSA 1QV7A 2E49A 1HDGO 1ARZA 2I3AA 5A3VA 9LDBA 1E1KA 1CQJA 2JHGA 1PJSA 5CDGA 1BVUA 4BNYA 1I2BA 3P5SA 4BKQA 3AU8A 1AN9A 1KOLA 2B0JA 1M66A 2CDCA 5CDYA 1UZNA 3HWRA 4LRSB 3EHEA 3V1YA 1OI7A 3ZN2A 4CR6A 1P3DA 1WZIA 4PG5A 2ZTUA 3RC9A 2O3RA 5AQ1A 4MKXA 2QW8A 2PKQO 4E6PA 1QR6A 1RKXA 1ZZEA 2HMTA 3JQFC 1XG5A 1ZW1A 4B4WA 3C85A 5TIIA 2BKAA 1R16A 4FFPA 4CLOA 5HS6A 3WFIA 2IZZA 3F47A 3WNVA 3R3JA 4O1MA 1RM5A 3MTGA 4R54A 3BMCB 3S8MA 5EIOA 2BFOA 3ZI0A 4EJ6A 4YT2A 1JA9A 1O0SA 2I76A 3IC5A 3H9EO 3U0BA 3G0OA 3L9WA 2VRCA 4PRKA 2BD0A 2QRLA 1L7DA 1DRVA 1Q0LA 4BGIA 1DAPA 3AUSA 3N58A 1NWCA 4DL9A 3F9IA 4BGUA 1VKOA 4XA8A 3PK0A 4OMUA 1ML3A 2WJPA 3JQAB 4WE3A 4XZ3A 1SAYA 1NWHA 1XR3A 2D59A 3QVXA 4GGPA 3RBXA 4XDZA 3ZWCA 4CMIA 2D5AA 3BIOA 4BNUA 1KVSA 2YHIA 2FRDA 1GUFA 4J3FA 4HFNA 3ONFA 4KMSA 1VJTA 5F5NA 3M1LA 4JLWA 1CEQA 3PEFA 1GZ6A 2J3IA 4EJMA 4LK3A 2BI7A 1EVYA 4L76A 1KIFA 2QX7A 2VWQA 1EEHA 3L6EA 1EE9A 3U49A 3M2PA 4D0RA 4MVJP 4XQEA 2V7PA 3B1FA 3FCOA 3LU1A 5KKAA 5L4SA 3QHAA 4UUNA 2HCTA 3RQSA 1E92A 2PA3A 2Y66A 5HTOA 1YB4A 4FCCA 1RM3A 2XOXA 3BXXA 4BO7A 1GL3A 3ASVA 4IDEA 3JQDA 4DREA 3GQVA 2QRJA 5H81A 4JJFA 4BUCA 4DGSA 2GRAA 1XDWA 1LUAA 2G17A 5TNXA 3FNGA 5C7IO 4E5YA 2H1SA 3WGQA 3RUAA 5JSFA 5G0UA 2V65A 2WMDA 2YY7A 4XQ9A 1P1JA 3GN2A 3JD2A 2DTEA 1HE4A 5JBIA 4AL4A 3PDUA 4P4NA 4GSKA 1O95A 5I9NA 1BRMA 1Y8QA 4DXHA 5DN9A 1E7RA 3AY6A 1V0JA 4LMRA 4E4YA 1EK6A 3F5SA 5KTKA 4J0EA 4NDNE 3GZNB 4UEKA 1KS9A 4GBJA 3ZWPA 3JTMA 1YRLA 2NTJA 3V8BA 4HX5A 4Z9FA 5CPFA 4Z0HO 4D45A 5A04A 4EJ0A 3BAZA 1PZEA 2HJRA 4TVBA 4GX1A 3DZJA 4P4LA 3P19A 3TJRA 4D42A 4FJ2A 3RCBA 4GWGA 3RKUA 1E5LA 3OSUA 4Y6SA 1P77A 3LF2A 3JQFA 2JFGA 5DDIP 3WGZA 4JJIA 3V2HA 4OKIA 4JBHA 1JTVA 3OA2A 2NQTA 5FWNA 2AE2A 4J1QA 1NASA 3MJ4A 4R9RA 2D3TA 1P31A 2BMAA 2H6EA 3OJOA 1KY5A 2ZCUA 4I8XA 2EV9A 4JCOA 3DMTC 1XELA 3UICA 2YDYA 1A7KA 2VWGA 2JAHA 1NAIA 3RC1A 4FJ0A 1R4MA 3W4KA 4RORA 2O4CA 5B1YA 1LEHA 2ZTMA 1ISIA 3D3WA 4C4OA 3MJVA 3FPCA 1D7OA 2IXBA 1UDCA 3CIFA 2FPIA 2PZLA 4MJLA 2VUUA 4NJMB 2Y0EA 3BHMA 3PJFA 1GFSA 4CUZA 4EEXA 1HE5A 4PVCA 1XU7A 4ITUA 2PNFA 3GMDA 4CM4B 5FF9A 3G3EA 1KBZA 3WGGA 4B7UA 1GAEO 1NNUA 3O03A 5A3JA 1P1RA 2OGUA 2EP7A 4CMHA 4ZVVA 1HLDA 1LXCA 1WMAA 4FDAA 5A5EA 3IQDB 4QECA 5EESA 3O8QB 5EINA 1WMBA 4JXKA 2H9IA 3GLQA 1PJ2A 2D8AA 3M1AA 4L0QA 3L6OO 2Y0CA 1Z6ZA 2WM3A 1PJCA 2AQ8A 1E3WA 4PLHA 1QG6A 3PVZA 2V6MA 3D4PA 1JAXA 3S2EA 1W4ZA 4BNJA 4OXYA 1R15A 3MOIA 4O5OA 3ZWNA 2B37A 1VPDA 3W4IA 2QHXA 3GOHA 4WEOA 3PJEA 3U09A 4R1NA 5HA5A 5JC8A 1YDEA 4BQPA 1T4DA 3H9UA 4RPLA 1N9GB 3DXFA 2DFDA 2I3GA 3K2EA 4W9NC 2P9GA 4CUJA 2PZKA 4YAJA 5AOVA 3GG9A 4ZD6A 4BO2A 3GA0A 1QYDA 1MP0A 1KVUA 1ZK4A 3ETEA 3MWEB 4IS3A 2WSBA 1HDXA 4CLRA 2I65A 1D8AA 3G17A 5JPIA 4PFJA 1F8GA 5ILOA 2YYYA 1GCUA 3QVSA 3LT4A 5JS6A 2QZ9A 4BKRA 3LT2A 3INTA 1UXHA 1AGNA 4HV4A 4PZCA 3AM4A 1F8FA 4JP2A 1LDGA 4I5FA 2WYUA 1SNYA 5ER6A 4NBTA 4AJ1A 1U7TA 4CV3A 1JWAB 3EYWA 4QFCA 2UUPA 4TROA 3VZQA 4BO6A 3GGOA 1IHXA 5I7EA 2ZKLA 1P1IA 4QQRA 2O7QA 4XQGA 3RC7A 1QV6A 3C24A 2QYSA 3DZIA 3NDIA 5EQFA 2A92A 2JD2A 3WNQA 3ZV3A 3DEYX 3A1NA 5IJZA 5IXSA 1LI4A 2PZMA 4PIVA 4XX0A 1QXSA 4KP7A 2WTBA 1D3AA 1YBVA 2DPHA 4WNCA 4IQ0A 5BNIA 2B4RO 1E7MA 4B4OA 3PLNA 1KERA 4OO3A 5BR7A 5C3MA 1FJHA 1QLJA 3MEQA 1EK5A 3GT0A 6ADHA 2F00A 3NTQA 1I10A 1QRRA 1YQXA 2O23A 4R16A 2CDBA 3LZ6A 2R00C 3S2GA 4IXTA 3D3WB 3ZWAA 3H65A 2DBQA 2XF8A 4M87A 4KTVE 4CLEA 1PL6A 1DXYA 2BHLA 4PZEA 1V3TA 4CR8A 2X86A 1BVRA 3BZUA 2J3JA 2X5KO 5ES3A 1UP6A 2EKLA 4PGFA 3GMSA 4IBOA 5CHEA 5JCJD 1SPXA 4MP6A 3L07A 1DIBA 4Q3AA 4Q9NA 4AJKA 3KYBA 1W6UA 4QT0A 2NU8A 3ZWMA 2YV2A 4Y9DA 5JDCA 3N74A 3DBHA 4PVDA 2PD6A 3K6JA 5JFOA 4AJLA 5BQFA 3AI1A 5JAZA 3QWFA 4E0BA 2YQ4A 3AM3A 1Q7CA 1RYEA 2CDAA 3GPIA 1XLTA 2Q1SA 2Q49A 2FPPA 4XGKA 5DCYA 1C1DA 3OEYA 4D79A 2H5LA 2HK9A 4BB6A 3SLKA 4ALKA 1P1KA 1N7HA 3F46A 4IS2A 3DOJA 2OP0A 3ZHXA 4RPGA 2GNAA 3L4BA 3COSA 1A5ZA 3I3OA 5HBRA 4BNLA 4WOKA 4IZIA 5F21A 3ONEA 4IZHA 3TFQA 2EGHA 3DAFA 1R4NB 1PSDA 4FFMA 4E5PA 4CLHA 3R3SA 1I36A 3QWHA 3FTPA 3JD1A 1I24A 4FQ8A 4YCAA 5JMPA 1PJQA 1YBMA 2HMWA 3AOEA 1DBVO 3AOEC 1UAGA 5JY1A 3NEPX 5B4VA 5JW6A 3H8VA 3AOGA 1B2LA 4HFMA 5IZ4A 3Q1LA 4YRAA 3VPXA 3WJ7A 3GEGA 1XSEA 3JQGB 4R1TA 3DZFA 1K5HA 3JQBC 4J1NA 4R69A 4U0KA 1PEDA 2ZQZA 1Q0QA 1Q7GA 1FXSA 3E82A 1XGKA 2GGSA 2EXXA 3QJ5A 4WLVA 1BG6A 1GPDG 1H6BA 4D44A 2VTEA 3OHSX 3WICA 2D5CA 3ZV4A 5BSFA 1IOLA 1IZ0A 3BMQA 5LCXA 3B6ZA 2C7VA 4YEDA 3ROKA 1RWBA 5DP2A 5TJ9A 3JQ8B 5LDGA 4BGVA 1U8FO 3G1UA 4D43A 1UP7A 2Y93A 2Y1CA 1DEHA 3ZHZA 3JSAA 2Q2QA 1VRWA 3NT2A 5COAA 4U7WA 1RM4A 3GFBA 4MP8A 4BQRA 3KSZO 4IINA 3H7AA 2AHRA 3L4SO 2QQ5A 1DJNA 4W6ZA 3L4BC 5ILGA 4YRBA 1S7CA 2AMFA 4JJGA 2X9GA 2DT5A 2PD4A 4U6SA 2Q1TA 2VYVD 3PYMA 4I5GA 4OQYA 1H6AA 2C07A 1H6CA 4CLOB 1JQBA 1ISFA 2J5KA 3CUKA 4QFDA 1R12A 3AW9A 3CINA 4WCFB 1O8CA 1ADGA 3EDMA 4OOEA 1X1EA 1RPNA 4PLYA 5KWEA 1Z82A 2W98A 3WMWA 1FDVA 2Q46A 2X1HA 4RO0A 4AG3A 4IDBA 4PLWA 1NTOA 4CQMD 3QLJA 4URFA 4YAIA 4ALLA 4BNFA 2NADA 4J1TA 1YL6A 2PFGA 4AJOA 2CD9A 2AE1A 5A5FA 3VAZA 4RVSA 1Y7TA 2DBZA 3K96A 3E18A 3TSCA 4MPDA 2HRBA 4IDCA 1SZJG 4OKNA 3E8XA 4LCEA 1DPGA 2FPGA 1UR5A 4FFRA 4YJHB 1Y9EA 5EMHA 5L9AA 3GVCA 3JCZA 1EE2A 3W6ZA 3FSRA 2C5AA 4OIMA 4E3ZA 5KJ1A 4FB5A 5T67A 2X23A 1BWSA 3FR8A 1VL0A 3DZBA 5JNLA 4E30A 4K6FA 2EF1A 2EERA 2IXAA 4BV9A 4YTEA 4PLPA 2B69A 1OC2A 4BNXA 1ONPA 1E7SA 1HDZA 3C1TA 2YJZA 1OMOA 2EW2A 3GR6A 2IEDA 3H5AA 4ZQHA 4TRNA 5ER9A 4PZDA 5A05A 4OXNA 3ABIA 4EDFA 1CYDA 1V35A 3FTNA 5F5LA 3A28A 1EVZA 4GVLA 1EUZA 2NTNA 5MDHA 4UVEA 4NIMA 3MZ0A 3FNFA 1PJLA 2EJWA 4E13A 3KV3O 1TLTA 1ULSA 4WEQA 3KM0A 3NDJA 4YT5A 2DBRA 5EERA 1W8DA 1PZHA 5IZCA 5U9CA 4BIIA 4CMIB 2PTGA 1HYGA 3E6AA 3ANMA 2GN4A 4GMFA 2NACA 4LCJA 1B3BA 1F06A 3NAQA 1E1LA 3GDFA 4R68A 5JYEA 3V1UA 5CG2A 5IG2A 2VHXA 2C5EA 4EUEA 4NI5A 3PZRA 3EUWA 4DIOA 2DFVA 2VQ3A 4MVJI 4CPDA 3FD8A 3GVXA 3UAGA 5L40A 2YV1A 2O48X 3LF1A 4II3A 4BO1A 3EAGA 4XD2A 3PQFA 1AHIA 1HLPA 4UEOA 1LX6A 1E77A 1NFQA 5FI5A 5T6BA 1M6WA 2CNBA 4TRMA 5DCUA 3DFZA 5EL0A 1NVMB 4CM3A 4O6VA 2IE0A 5GZ6A 5ENDA 3BHIA 1TI7A 5ENVA 3O8QA 3ETDA 1B7GO 3VH1A 3LYLA 3G49A 4Z0TA 4L4XA 1ULUA 4LVUA 1BW9B 1P9LA 4O63O 2BELA 3TNLA 4YACA 4EGFA 4CM1A 1WAMA 4CMAA 4YAGA 4YQZA 3H9QA 3DOOA 2CF6A 3A14A 3GPDG 4JBGA 4W7HA 4TQGA 5TSDA 3OICA 2NU6A 2Q1UA 3C7DB 2HDHA 3RD5A 4DMLA 1HTBA 4ZA2A 1DHRA 1SOWA 4MKRA 1IY8A 1FDTA 4BNZA 4WK6A 3U3XA 4H15A 1HDCA 4GAEA 4DQVA 3OH8A 1Y8RB 3U4HA 3TWOA 1U3WA 3Q2KA 2CZCA 3VC7A 3K8ZA 4J2HA 5JDIC 2GSDA 2QYTA 3N7UA 2AQHA 4RL6A 3EVTA 3H5RA 3H2ZA 2A94A 2W2KB 3BA1A 2FSSA 3LC1O 2XAAA 4LSMA 4JGBA 4M89A 4B4VA 3DO5A 3RFTA 2IYOA 3V5NA 1LDMA 2HKIA 3PHLA 1Z74A 5JYDA 3GDOA 2WYWA 4ILKA 1TVEA 1X13A 4NQZA 1ISGA 4W82A 3SC6A 1T26A 4RQTA 3WX0A 2DQ4A 1G0NA 2UV8A 3T7CA 1WNTA 1EFKA 1I8TA 2W2LA 4TZTA 3VTZA 1UDAA 1MA0A 4ALNA 2X22A 4YJFB 3ETGA 3PQEA 1SEVA 3QWBA 2C82A 4BKPA 1VM6A 4DQUA 3FPLA 3KVOA 3GZNA 1DC3A 3FR7A 2EWMA 1GZ4A 3QWAA 1MB4A 1T1RA 1U28A 3ULKA 3NDRA 1BGVA 3MJEA 2LDBA 5L3ZA 2FSVA 1LLDA 2P4QA 1VSUA 4ZRNA 3I1JA 4BO8A 3QVOA 3FRJA 4ND2A 4H16A 1E3SA 1JWBB 2Z95A 1XYGA 2SCUA 5A06A 2FR1A 3CTMA 4OXKA 3ENKA 2GCGA 2JFHA 3WSWA 1OBFO 4FN4A 1YJQA 2X4GA 3KXDA 5G4KA 4Q3DA 2W2LD 3KRTA 2HJSA 4U0JA 2ZTVA 4XB1A 2D1YA 3KSUA 5BSGA 4QUKA 1GEGA 1U1IA 1ZK2A 2B5WA 2OOSA 1EMDA 3WWZA 1O94A 2X0JA 3BMOB 5L4LA 1U7HA 1Q1NA 2HMVA 4RLHA 3P2OA 4XGNA 3ASUA 4NPCA 1MUUA 2BFAA 2B36A 2VWHA 4NZ9A 4WKGA 4BGEA 2E82A 4FPXA 3WGYA 4DWVA 4L8VA 1T4BA 1C0KA 3PYLA 3NRCA 3O38A 2PKQP 3VKVA 1YJ8A 5KNLA 3VPHA 4XYMA 1JAYA 3AWDA 3UUWA 4JNKA 1NVTA 4K28A 1Y9AA 1T2EA 1C0LA 5G4LA 4IQ8A 4CM8B 4JK3A 1SBYA 1GTMA 4CR7A 5KKCA 4MINA 2FR8A 5I8WA 1H5QA 2HUNA 4RF2A 3GRKA 5A9SA 3ZGYA 1ENPA 4OQZA 4HADA 4DBZA 3DAGA 4EITA 3RUDA 2X8LA 5C5IA 2ZB3A 1B8UA 5KJCA 1MC5A 4J91A 4QSMA 1DFGA 1DC5A 4TKLA 3Q0EA 3PIIA 1QYCA 1IE3A 2WE7A 2D4AA 5C7OO 2JCYA 2Q4EA 2FWMX 1B8VA 3L6DA 2ZJ0A 3AUTA 1TXGA 3VOSA 4F45A 4EUFA 2VHVA 4MVJA 4EEZA 4OHUA 1GYQA 1KEPA 4UEJA 4R01A 3RSHA 1I3NA 2EJVA 1O9BA 4CLDA 2VHZA 1IL0A 1SEPA 4U5QA 3ZH2A 3M2TA 1NYTA 1S6YA 4WPGA 2VNAA 4GMGA 3W4JA 4HNHA 1SB9A 3FNHA 3O9ZA 5KVVA 1DHTA 5COBA 1NR1A 5CG1A 1CWUA 1ZKMA 2ZB7A 3DL2A 4J7UA 5DNAA 5C7LO 4ZHSA 3ZU4A 2Y1GA 2JFFA 2NLOA 4BNVA 5I7FA 4KQXA 1JKIA 1N8KA 2CVQA 2VNSA 1V6AA 4J16A 3VTFA 1UXGA 1TT5A 1MGOA 4D41A 3OJ0A 1LC0A 4TZKA 4CMBA 4P8RA 3U62A 4CMJA 3IUSA 4C7JA 2R2GA 1L7EA 3ITDA 4XKJA 4N18A 1A4UA 1WZEA 2ILTA 1PZGA 4MVJD 2UAGA 3KUXA 3X2FA 2GR9A 1H2BA 1NP3A 3DHNA 3WIEA 3E1KA 2WD7A 3MWDB 3RJ9A 5COQA 3IKTA 1N1EA 4L75A 1AHHA 1VI2A 4MIOA 3P2YA 5U1PA 4NFYA 5AXBA 4ND1A 1LDNA 2A35A 2EG9A 1CETA 2OL4A 3KHUA 4WJZA 1N9GA 3RFVA 1NM5A 1LSJA 3A06A 5T64A 4HXYA 5FFFA 3ZWVA 5JLAA 3AM5A 1NXQA 4ID9A 3BTVA 4Z0PA 1I0ZA 1LC3A 2ZB4A 4XGIA 3E9QA 4RCVA 1BHSA 1HE3A 2R6JA 1B15A 2NTVA 2GASA 3ON5A 5DBGA 1T2FA 3IUPA 3VPFA 3K30A 3PYXA 5GY7A 4CMCA 1ADCA 4A27A 1HXHA 4BNIA 1PS8A 4DC1A 4Z3KA 5I7SA 3F4BA 4ALJA 1HL3A 1LRLA 4HBGA 1IPEA 3WBBA 2Y0DA 1LSSA 4YA6A 4YAEA 3JQ6A 4WGGA 1UAYA 2AQKA 3TDKA 1YOVB 4EUHA 3BMOA 3GHHA 1RJWA 4CUKA 4YB8A 1PQWA 3I9NA 2BLLA 3OECA 4E5KA 1H6DA 5K9ZA 1I3LA 3W6UA 3I9KA 1XHLA 2RH8A 4KUHA 4XRRA 5U4QA 2OMEA 4IJWA 4RDHA 5G0SA 3U4CA 1PGJA 1EQ2A 2C2YA 3HNPA 2Q1WA 1LDEA 3PFWO 4DLBA 1X1TA 3GDGA 1N2SA 3PP8A 5IDQA 3DBLB 3RC2A 4OOFA 5DCWA 2Y1OA 2Y1FA 1R6DA 4AICA 4ND5A 5IN4A 1P33A 4GLLA 3JD0A 3WGHA 2CSUA 3GFGA 3AU9A 3IS3A 3NX4A 2I6TA 4AJJA 5IN5A 4DRYA 4PN3A 4XCVA 4YT8A 3CH6A 1Z45A 4FC6A 4QX6A 1ZVMA 3WBFA 3E9MA 5A9TA 4OSPA 3DAPA 4FD3A 4D3DA 1M67A 2O50A 5DBIA 3OIFA 3JYOA 4A73A 5CAEA 1UZMA 3AI2A 3UGKA 2BGKA 3F5QA 3FWZA 1ZSNA 1NFFA 3ENNA 5TX7A 4NJMA 3GRPA 2V6BA 2X9VA 5TT1A 4CQLA 2YDXA 5LDHA 4XWYA 1R4MB 4AJNA 1F14A 3PXXA 1Q0HA 1DLJA 4X54A 5F3RA 4GI2A 4LW8A 4IM7A 4R4JA 2P5YA 3ZHBA 2ZIZA 5KOIA 1ORRA 2VYND 3BTOA 3TZKA 1IPFA 1B3RA 4FR5A 4MDHA 3T4EA 4LISA 3JYNA 3ZNNA 5MGBA 1E6UA 4PLCA 1UXKA 1BSVA 3OJEA 4GVXA 1KEWA 2OUIA 7ADHA 3SVTA 2ET6A 3BMQB 1GUYA 1I01A 1CJCA 4J49A 4XYBA 2Z1NA 3RFXA 2VN8A 3O26A 2JD0A 3IKVA 2P5UA 3S2FA 3NJ4A 3L9XA 2DM6A 3MJSA 4MVJE 3D4OA 2Y99A 1HWYA 1D1SA 2GN9A 3ROMA 4UAGA 4FJ1A 1U3UA 2UYYA 2BH9A 4PLZA 4NJOA 4XYGA 4IMRA 2NVWA 4CMEA 3DWFA 4J7CA 4NK5A 3BMCA 3EW7A 4RVGA 3GK3A 1UP4A 5AXCA 5JXWA 3OQ6A 1SCUA 3GHYA 5G0WA 2YQ5A 1E3LA 1JU9A 3PHHA 1G0OA 3WGOA 2Y68A 1K3TA 5JCXA 4LMPA 2V6FA 4Z9XA 2DU8A 3A9WA 4MVJM 5DF1A 3KTDA 5A1TA 4KDEA 2JCVA 2PWZA 3C1AA 1ZJYA 3I9MA 5G2OA 3S55A 3ZWBA 5HWSA 3NJ8A 1IULA 4BB5A 1QYXA 2AEMA 2RIRA 4R41A 1HT0A 4BKUA 3G1TA 1R0SA 4B3JA 2HAEA 5L53A 1EVIA 2B4TO 1QP8A 4GQAA 3U4DA 1ZBQA 2I5PO 3AFNA 1NX6A 2VZ8A 1EDZA 3PGJA 2ZATA 1CRWG 3OFSA 3PDJA 2Q2VA 3SEFA 1P44A 1JLLA 3SXPA 3IIEA 4Z6KA 4I9UA 1WLYA 5BT9A 4XR9A 1KY4A 5I9MA 5I8ZA 3HUDA 4DLLA 4NG5A 1HRDA 3IAHA 3INGA 5GMOA 3UKOA 1B14A 1NQOA 4AJIA 1LRJA 5JAMA 5IFLA 4CM6A 3LLVA 1PJBA 4WASA 5KJ6A 2NSDA 2GUGA 1GADO 1P1HA 1SO8A 2VOJA 3CE6A 3IP3A 3HB5X 1Z7BA 2UDPA 4F3YA 4MOWA 2EW8A 2CVZA 1WDMA 1DAOA 3U4IA 1ISMA 3D0OA 4MVJG 3TL2A 3LVFO 4W99A 2C2XA 3PFFA 3AY3A 3I9JA 1FDWA 1Y1PA 3WMXA 1EZ4A 3EGOA 4DBVO 5IZCC 1E0DA 2VWPA 2JJYA 4AJPA 4E21A 5L95A 3WQRA 2FP4A 2X9NA 3L77A 3GGPA 1SMKA 3KETA 1C3VA 1HEUA 3O4RA 3BTSA 1X7GA 1E7QA 3GVIA 1LJ8A 1UZLA 5TRTA 3AJRA 1KEUA 3B1KA 4PCVA 5HRUA 4B8WA 5ICSA 3NKLA 4PLVA 1YE3A 1GDHA 2P2SA 4Y6RA 3HDYA 3QP9A 2I9PA 1YXMA 1HKUA 5T57A 3WQSB 5L4NA 3ZWYA 2Y05A 3ZV6A 1PWXA 3GNQA 4FSHA 4UVDA 4IDFA 1ZK0A 3E48A 1KYQA 1VSVA 1U2GA 3DBLA 1KVTA 1BDBA 3JD4A 2W90A 5T5QA 3U9LA 2O7SA 1E6EA 3P7MA 5J23A 4JP3A 3QV1A 1P1FA 4E2YA 4ALIA 4TKMA 3ZNPA 4H3VA 1VE9A 2AG8A 2PR2A 1WP4A 4J4BA 3UF0A 1GQQA 1MG5A 1VKNA 2X5OA 2DPGA 1YONA 3KYCA 3RIHA 3FNEA 2GZ2A 3LSYA 1NR7A 4IY1A 4KUGA 5DOVA 4AFNA 5F1OA 4BOYA 1I3MA 3HQ4O 2YFQA 5IXYA 5JE8A 3LC7O 4RQUA 1WXDA 1U9JA 2FHSA 3CKYA 2G82A 4G2NA 4H7PA 4DIFA 5JAQA 2O3QA 2ZCVA 1W73A 3QVWA 5THKA 1LU9A 4YXFA 4RJTA 2HK8A 2O2SA 4BO5A 1AE1A 2O3SA 1B8PA 1W0CA 4PG7A 2UUOA 1Q7BA 5JMWA 3DMTA 3NTRA 1T2CA 3KSDO 3I83A 2E6UX 1WW8A 4II2A 1E1NA 2CVOA 1ENYA 4BL5A 1T25A 2PGJA 4YDRA 4RVFA 1KVQA 1ZUD1 1DC6A 3AUUA 3PWZA 2RCYA 1PGPA 5EN4A 5JCJA 5FEUA 4Q3EA 5H82A 3HDHA 2JAPA 4ZICA 1NQTA 2IYPA 1LLUA 1EBUA 1WDLA 2JHFA 4GH5A 3ZZNA 1GPJA 4ND3A 4J2OA 3ZWWA 4A5OA 1H9AA 2JD1A 4MO2A 3KB6A 3VDQA 4DPKA 1DC4A 5A4DA 4R51A 4NMHA 4A26A 3SX2A 3LK7A 4CM4A 4BNWA 2Y67A 4WOJA 1V3VA 3JYPA 2QG4A 1BW9A 3GF4A 3ONDA 2B5VA 4XIYA 1K0UA 1T1SA 3I6QA 2HLPA 1DIRA 4XRGA 5IAAA 2BI8A 2X6TA 3BYZA 3PLRA 1N5DA 1C1XA 2GPTA 2EGGA 3JQAA 4E12A 3V2UA 2RBEA 2GZ3A 1A72A 1JKJA 3PWSA 2YHUA 2VYVA 3WWYA 3PPIA 3S1LA 4UVGA 2G5CA 3VH4A 1B26A 3EVNA 3SJ7A 4W9NA 1WPQA 3JD3A 2HMUA 4JBIA 2C20A 8ADHA 1YQGA 4MVJF 2YW9A 5JDIA 2GF2A 3VZPA 1FF9A 3WDSA 4G65A 1O89A 1LQTA 5JO9A 3H3FA 3HADA 5CDUA 3HB4X 3ROQA 3LT1A 2NVUA 4PG4A 1DIGA 1N1GA 3MOGA 4U6QA 1NHGA 5B37A 4RGBA 3NGLA 1IUKA 3PGXA 2O2YA 2WE8A 2WYVA 3NTOA 4IGEA 4RF5A 3WQQA 3H2SA 4DTIA 4E31A 4QO7A 4K6CA 3TOXA 1NHWA 2NUAA 2YUTA 3HN2A 5L7TA 1WWKA 5TT0A 4MIYA 2Z1MA 3MCVA 4J6FA 3FWNA 3R1IA 3GC6A 4A10A 1YB5A 2HO5A 1P0FA 3GUCA 1K6JA 4PLFA 3VPGA 1OZAA 2FY8A 3I5MA 1LRKA 1KETA 1NPDA 3JQ7B 3DR3A 2A9FA 3KLMX 1PJ3A 1HF3A 3JQ7A 4J9UE 1HZJA 1TT5B 2TMGA 4L4RA 3VHRA 1UJMA 5IF3A 1HSOA 3RVDA 3FHLA 1ZXBA 4QXMA 3KBOA 4O59O 4DPLA 3RBVA 3BMNB 4D3FA 4YBZA 1NBOA 3K73O 4B7XA 4DYDA 1Z7EA 3I23A 1VC2A 4ZQFA 1U3TA 4CV1A 1R4NA 4FFLA 1XCBA 1G6KA 4YJHA 1GYPA 3NGXA 3WG9A 1JDJA 4S3MA 1XA0A 4BVAA 4HFJA 1ZXLA 1F0YA 4MIEA 3Q9UA 1NPYA 4B79A 3LC2O 4GX2A 3ZU3A 5K6AC 3TL3A 4P22A 3I4FA 3VPSA 3Q9NA 3VZRA 1BXZA 4BNMA 1GEEA 2PH5A 3HG7A 4L9RA 4KOAA 3FF4A 1LSOA 1KC3A 4P38A 3SJUA 4YJGA 3TZHA 1ZK1A 4N5MA 4WLOA 2HRZA 5AYVA 8LDHA 1PWZA 4OH1A 3HZZA 4E2ZA 2J5QA 1ZH8A 3I9OA 1I3KA 2B83A 3DDNA 3GZ4A 4GGOA 5L45A 4YJDA 3RWBA 3GG2A 4YJGB 4GSLA 5GZ1A 3I52A 3I9LA 1YOVA 1B0AA 5GZ3A 4BHTA 3UCEA 3SLGA 4CM7A 4XJTA 1OFGA 2Y1EA 4KWIA 2G1UA 2X0IA 4DYVA 2JL1A 3TRIA 3GY0A 4Z3DA 4PG8A 5KVQA 1I2ZA 4Y98A 1WDKA 4UUMA 2GO1A 3KOUA 4JROA 4K9DA 2JKVA 4XYEA 3H3JA 3OBBA 3H5NA 4ROSA 2DUWA 3JQEA 3QSGA 1MC4A 5KJFA 2PZJA 2O4UX 1MFZA 5A02A 4DA9A 3NV9A 1DDOA 2GN8A 1UUFA 1I32A 1YL7A 4OYRA 3ZNOA 1U4SA 3WJAA 1GQ2A 4CMGA 2GDZA 3F3SA 3ZDFA 3A4VA 1UXIA 1DSSG 3R0IA 3RAJA 3GGGA 1VLLA 3JQBA 4WUVA 2R00A 4WCDA 4TMFA 1MLDA 2BGMA 3AFMA 1ZSVA 3CPSA 3TN7A 1C0IA 4DQXA 4HNGA 2HMSA 4Q39A 3ZWOA 1HDRA 5CEJA 1QMGA 4U8GA 4BNTA 1DIAA 3PZBA 1PS0A 4I5DA 5K0ZA 3F6YA 1LNQA 3HN7A 2ZB8A 2HU2A 2PH3A 4D46A 4CV2A 3C3XA 2Y1DA 3PQDA 3Q3CA 2HSDA 3B1JA 3WGIA 3ZCXA 3TF5A 3MJTA 5G0TA 1XWFA 2X7HA 1X15A 1GU7A 2NV6A 1UH5A 2C0CA 4OSOA 4RPHA 3E5MA 4Y67A 4A2CA 2NVUB 1YO6A 3KYCB 3RUFA 1ADBA 5KCZA 3UW3A 4FIZA 1EVJA 1XIVA 3ANNA 3S2IA 3C8MA 3KYDB 1M76A 1ZMTA 1QLHA 4AJEA 5BSHA 4UVIA 4CL3A 3RUIA 3VDRA 4AJ2A 5KIAA 4KZPA 1LBEA 1HDOA 4LVCA 2G76A 1HDYA 1AUPA 3W1VA 1J6UA 1RYDA 3RU9A 1DIHA 3C7AA 4RV9A 4FGWA 2VT3A 4I5EA 2ZK7A 4R5HA 5EPOA 3HJAA 3W8DA 3KZVA 1J0XO 2BRUA 4M86A 4DUPA 5BSEA 1KVRA 3IL2A 1XQ6A 3RUHA 4BKOA 3K9QO 4RF3A 2X58A 3AK4A 3GEMA 1PGQA 1NQ5A 2AA3A 3T7EA 1T2DA 2YFHA 1Y8QB 3F4LA 4Z9YA 4JIGA 3PRJA 3AY7A 4RVHA 3IJPA 5JO0A 1U4OA 1XQ1A 4J4TA 4CQLB 2VHWA 1C1XB 3SC4A 4BMSA 3ANLA 3DBRA 2NM0A 4RZIA 4NHEA 1QYWA 1X0XA 2CMDA 1I2CA 3ITKA 4NFSA 4OAQA 3ZNQA 2X0NA 2FZWA 5CEFA 3GVHA 4DC0A 3Q11A 3L0DA 3IJRA 1GV0A 4A0SA 5DZSA 1NPTO 4BNGA 3E9NA 1P74A 2TMDA 1L1FA 1XU9A 4E32A 4E2WA 3FN4A 4CM5A 4XJSA 1NQAO 5CDTA 1O5IA 4CV0A 5TC4A 1CF2O 3QA9A 2C54A 1E7WA 3MJCA 1FDSA 3TQHA 4GX0A 1RM0A 1FDUA 3ZW8A 2QIOA 1N7GA 1CQIA 3RASA 2POQX 3ZW9A 2IZ1A 3WYEA 2YZ7A 9LDTA 3LQFA 1YL5A 4N54A 3ZHYA 4FS3A 3INRA 2IEBA 2VUTA 4IJUA 1ZCJA 3OETA 1EUCA 1EUDA 4FFNA 2IODA 3MTJA 4GL4A 3T4XA 4WCFA 3B20A 3OJLA 1E1MA 1ZSYA 4BO3A 4DMMA 1U5CA 5H83A 3D5QA 2PKRA 3EY4A 1Z73A 2DLDA 3NYWA 4NNJA 1H9BA 1QYVA 2ZYDA 2Q50A 1NAHA 1T2AA 2CUKA 2EHDA 4D3SA 1NFRA 5IDYA 5T8KA 1YQDA 2OBYA 4IIVA 3IOYA 1J5PA 1R0LA 4D7AA 2UVDA 2C59A 4CLRB 4ZGWA 1ZFNA 4IDGA 4WLEA 4UUPA 3D3EA 1HETA 3CEAA 2O3UA 3UCXA 5HM8A 1PR3A 4IJVA 2LDXA 4UREA 1ZEJA 4Y6PA 2B4QA 3OEWA 3QY9A 5TJHA 2DKNA 3DBHB 4CLXA 1M75A 1LQUA 3IP1A 5L51A 2Q45A 3GUYA 4HP8A 1PGNA 2ZJ1A 2VZ0A 2EEZA 2OHXA 1CERA 3E5RA 4IQGA 4HKTA 1CDOA 1F12A 3DHEA 5CPBA 5A9RA 1J4AA 3GAFA 4YT4A 2GYYA 5FYDA 4W4TA 1MXHA 4GX5A 4QEDA 3PHGA 1IZ9A 4DPMA 1ENZA 1HYEA 1U8XX 4HUJA 2NNLD 3NUGA 2GERA 1DJQA 5DOZA 5THQA 3RROA 4EYEA 2Z5LA 5B4TA 2W8ZA 2OZPA 4N7RA 3RI3A 2VRCD 3OP4A 2VZ9A 3ZU2A 2ZYAA 1R66A 3DQPA 1ID1A 1LTHR 1ZK3A 2OO5A 4Q3CA 4WCFC 4FBGA 4Q3BA 4E5MA 6LDHA 1PL8A 4XIJA 2OORA 3STHA 3D4NA 2J5RA 3E03A 4ZQBA 3ROPA 3DTYA 3UH1A 5EQDA 1K2WA 1SB8A 5C37A 4NU6A 1R0KA 1ZO8A 2YHIB 4M1QA 2OP1A 1PX0A 2P91A 1FK8A 1XKQA 4JQCA 3VVCA 1U5AA 2EKQA 5TS3A 4R9SA 4RPKA 4IMPA 2XXJA 4PLGA 5AXDA 4BNHA 4XQCA 7MDHA 5TF4A 3RUEA 2NU9A 3BTUA 2GLXA 1EBFA 1DFIA 2AQIA 3QE3A 2PK3A 2NVBA 1H0KA 3ORFA 3WOHA 3W8FA 3HSKA 2VTDA 3ADPA 4ZQGA 4UULA 4YYZA 1HZZA 1A7AA 1WVGA 4N5NA 4F6LA 2PGDA 3H6KA 4JX8A 1G1AA 2V6GA 1D1TA 5HS4A 1DLIA 3QQPA 4KDFA 4FOOA 1H2HA 3K2BA 2IDZA 1DRWA 1ADFA 3WR5A 1EDOA 2EP5A 3WYBA 3VH3A 4W7IA 5B4UA 4IPTA 1PU2A 2P9EA 1F17A 4GKVA 4CQMB 5JC1A 2DBVO 4L73A 3WB9A 4KWHA 1I30A 4CM8A 2VRBA 5T8KC 2BGLA 5JY6A 1KC1A 2FZEA 3EMKA 1VJ0A 5I7VA 2AEJA 3PWKA 1AXEA 2OXIA 1DFHA 4ONEA 2G0TA 4BO4A 5DULA 4XB2A 3UHAA 4Y8VA 3EK2A 3TZCA 1NVGA 2VHYA 4CM9D 4G81A 3ADOA 1IHYA 1C0PA 3C7CB 4TSKA 4TWRA 3WLEA 3F1KA 4IXWA 4RVUA 1Z75A 1V8BA 4EI2A 2IRWA 2J3KA 2I66A 1EQUA 1OC4A 2VYNA 4XR4A 3OM9A 4I9HA 4YVFA 2XPCA 1GUZA 3DONA 2NQ8A 2Q4BA 5TGDA 1Q2XA 3OMLA 1M6HA 3DC2A 4L4SA 1GZ3A 3PJDA 2WEKA 1OOEA 3DZKA 3KLPX 4ZRMA 1YB1A 4M54A 4WLNA 3WYCA 3ZV5A 4ZQEA 2QRKA 2GD1O 5LC1A 1JVBA 3BHJA 2X5JO 5TQVA 1JKFA 3DFUA 4MP3A 1HSZA 2AXQA 4CM9A 3QIVA 4D0SA 4UUOA 5ADHA 1PTJA 2WD7B 2WWRA 4I9NA 3KYDA 3U5TA 1PJ4A 2A4KA 3HFSA 3NT4A 1Y5RA 3UVEA 1PGOA 3KEQA 4YAKA 4IJKA 4NBVA 5CFZA 1QSGA 3QVTA 4NH4A 2O3JA 1U3VA 4BV8A 3IDSA 1U2DA 4ESOA 2O3TA 5AXAA 3PHJA 3QW2A 4R5MA 4ALMA 2BFMA 3EZYA 4J0FA 1T24A 4F6CA 1LDBA 1GCOA 2W2KA 3NT5A 1TA4A 3RBZA 4IIUA 1I5RA 1ENOA 1VL6A 3ZWXA 3TZQA 3WTBA 2DAPA 4LRTB 1Y8RA 4IUYA 4KUEA 4YRDA 1K6IA 2D0IA 4BO9A 5ITWA 3TPCA 4XDYA 1MV8A 2E48A 2PGLA 5KJEA 4BS9A 1LSUA 2DUUA 4KQWA 3HE3A 4AJ4A 3PHIA 4NFHA 1X7HA 4WECA 4F46A 1PQUA 4OGWA 5EJ2A 3ZU5A 2QZZA 4NBWA 5CP8A 1MG0A 4M49A 4HFRA 1JVSA 4ZN6A 2AEFA 4CODB 3DBRB 4B3HA 1PR9A 4TVOA 2CF5A 3OA0A 3AI3A 4DLAA 1YWGO 3WGTA 5FI3A 4GLOA 1K89A 3UCFA 4B3IA 1BXGB 5A9SB 2NU7A 3ICCA 4E5NA 1A71A 4A7PA 1YH3A 1QKIA 3GEDA 1JN0A 4J43A 1CIVA 1VJ1A 1UXJA 4EZBA 1SC6A 2ZQYA 4I1IA 4WNIA 2HQ1A 2RH4A 3GH3A 3QRWA 1D4FA 4NBUA 2EIHA 2B35A 4RPJA 1J49A 1PZFA 5JAIA 2PLAA 2ZYGA 3Q2IA 1YGYA 3DHYA 4K1LA 2C29D 2P68A 4E2XA 5A03A 5K6AA 4BO0A 5F1PA 1Y81A 4B7CA 4AJHA 4Q3NA 3DBVO 1GR0A 4M55A 1X0VA 4LN1A 3I6IA 4NK4A 4BMNA 4GWKA 4MKZA 1OAAA 1P45A 3GAZA 2BF7A 3BMNA 2DVMA 1A27A 3WXBA 4S1VA 3X2EA 2Q3EA 3OIDA 3OJFA 3WFJA 4PRLA 2RHCA 3VH2A 1GV1A 4OM8A 1PIWA 4I08A 5L7WA 5G4KB 1XEAA 3VZSA 3WIDA 4AVYA 4TRRA 1E3IA 1Y5MA 3DB2A 3K5PA 2J6IA 4JN6B 3LT0A 3CMMA 5BNTA 2IZ0A 3DZGA 3SBOA 4IGFA 2I99A 3LLSA 1LLQA 3DMYA 4L74A 4RVDA 4BNNA 3RUCA 4WLFA 5L7YA 1PL7A 3JQ8A 3WLFA 2OFPA 4FFOA 2JCXA 1DO8A 1FMCA 4FW8A 2CY0A 1H94A 4INAA 1A4IA 3EC7A 4K26A 1DOHA 4HY3A 2PY6A 4PG6A 1MFPA 3TOZA 2BFPA 3WTCA 3PI7A 1I33A 3PTZA 1HYHA 2OBNA 3HDQA 4YQYA 4YJFA 4C7KA 5KVCA 1E3WB 3CZMA 1YVEI 3HFGA 1O6ZA 1BXKA 1SOVA 3H4VA 3UN1A 4ZJUA 2PV7A 1GYRA 2ZTLA 4RDIA 1EFLA 3D5TA 2GZ1A 4M8SA 3VKUA 1DRUA 4EBFA 2E4AA 1GQYA 2X0RA 4B4UA 5BNFA 1ONNA 1C1DB 4IDAA 2FMUA 4QO8A 3K31A 3FBGA 3HHPA 3D1LA 3ST7A 5CDSA 2DTDA 3I4CA 1V9LA 5B12A 5DBFA 4J4HA 1X14A 4R3NA 5G0VA 2YV3A 3RU7A 1YS4A 3W8EA 1H93A 2AW5A 4RZHA 3G79A 1ZNQO 3GNTA 4OL9A 1X7DA 1YDWA 2CFCA 1N92A 4ND4A 1ZIDA 5TLSA 1E3EA 1A9YA 3OQ1A 2P9CA 4LGVA 4B8ZA 4J1SA 1PJTA 4FGSA 4NU5A 1LDYA 1YBAA 4NBRA 2FR0A 3CXRA 2RHRA 3V1TC 2WD8A 3EZLA 4J90A 4PLTA 1V3UA 4O0LA 3V2GA 4R1UA 4NR0A 4DIBA 4QTZA 3RJ5A 4FC7A 4GPD1 1Y6JA 3JYQA 3KEOA 3C1OA 3DOCA 2VT2A 4YWJA 3QWIA 4WLUA 4ZU3A 1ISJA 1HE2A 1AXGA 2H63A 3B70A 3CZRA 4EW6A 1P0CA 2XXBA 3TFOA 4RF4A 4R1SA 5DP1A 4CMEC 3PIDA 3DTTA 5ICMA 4MVJH 1IB6A 1IYZA 1ZMOA 2D2IA 3FI9A 3D64A 4P4GA 3WSVA 1ISHA 5CEEA 3VVBA 1VL8A 1DB3A 1KEVA 1BDMA 3CMCO 1E6WA 2FN7A 4YR9A 1MX3A 5IDXA 1M2WA 4CQMA 1K6XA 3H9JA 1PQPA 1ONOA 1TB4A 2W4QA 2P4HX 3GNSA 2VUSA 3JQCA 4IDDA 2FOIA 2EKPA 5F1KA 1GY8A 1LLCA 1R37A 1TT7A 4BNKA 4YPOA 2Q2WA 1PS9A 3UFXA 3RKRA 3OQBA 3D7LA 5AVOA 3JQ9C 5I9LA 3JQ9A 3HDJA 4A03A 2I67A 3ICPA 4CMKA 1ZJZA 1E3JA 1E7YA 4R3WA 2VOEA 2E37A 4J7XA 5ITVA 3GN1A 2AG5A 2C7GA 2F1KA 1UDBA 3F1LA 4XYLA 5JDCC 1QORA 3DZHA 1A9ZA 1BMDA 1JW9B 2DC1A 1GD1O 1LA2A 3CSDA 4J9VA 3JYLA 1MXFA 4N5LA 4CJXA 3R6DA 2RAFA 3AUAA 2Q99A 4XEHA 3UXYA 4KTTE 3OF2A
chains in the Genus database with same CATH superfamily
3UMFA 3IMFA 4LSWA 4MCJA 1NC3A 1TF5A 4BPRA 3A4LA 4N7JA 2OPBA 4FOSA 2HK7A 2NU8B 1DRKA 2ZITA 3RTCA 2DEUA 3GLRA 4QDUA 3C4JA 2VCYA 4GKBA 3ZVRA 2H11A 2CN1A 4GRAA 1H9CA 3H9GA 3WBKA 1EK0A 1L1RA 1NDQA 4CL8A 3NFRA 3TYXA 2J9YB 1OAOA 3Q6IA 1SVWA 4Y2VA 3CNHA 3TVYA 2PD3A 5BN4B 1KO5A 2J3HA 3M4XA 4BMVA 3ILHA 4QAQA 2V0NA 1PBTA 2XUKA 1XRMA 3SNKA 1WU8A 5JHHB 2C0QA 3EVGA 3QLVA 5ENZA 5IT0A 3PB3A 1QU2A 2NWQA 4M1MA 4O4IF 3WLNA 2V98A 2VS1A 3SJAA 1TEHA 3K9NA 3L0SA 5LQJA 2DCMA 2VK4A 3D6JA 5KYVA 1HDGO 2WB4A 2I3AA 5A3VA 3ZVNA 1CQJA 3DMRA 1H5UA 4BNYA 4TYQA 3EOBI 4BKQA 3L5KA 4PQYA 4FHFA 4L5BA 1OWLA 2B0JA 2FZ5A 3SFTA 4EQ6B 2I0FA 3E7PA 3EXHB 4LRSB 1DKOA 3U4AA 3ZN2A 1OLSB 4L72A 1P3DA 1O94D 1TK3A 4DVGA 4CCYA 4IW3B 3KTAA 1HNZB 4HVAA 4PG5A 3FHTA 1PUIA 3BK1A 3JZDA 4ZZ1A 3JRWA 1UQRA 2ZEJA 3R7AA 4Y2YA 1NJ5A 3IVXA 1SUFA 1JHPA 3ZGZA 1ABFA 1GZDA 4TL9A 1RKXA 4E70A 2ZSFA 2G77B 3C85A 3U19A 3GGDA 1R16A 4HQOA 5HS6A 3CUWA 1JEYA 2Y4NA 1Z08A 2QJWA 2QVCA 4BB0A 3F47A 1DXOA 1Y89A 3R3JA 4UNRA 3WXMA 2DX7A 4TQUS 3S8MA 2QUZA 2CXSA 3ZI0A 3AR9A 4QUIA 2UUAB 3IC5A 3U0BA 2YC4C 5I51A 5M7EA 3G0OA 1N5IA 3L9WA 2HQBA 3LG2A 4TKVA 1VP3A 3RF6A 4IR7A 1D6NA 4KVZA 1XXHB 1L7DA 3N8KA 2HY7A 4RTOA 3GMTA 4MUJA 4C21A 3HK2A 2F1RA 1U0EA 1VECA 1GPAA 3N58A 1NWCA 1N2XA 3RBAA 1EGAA 3F9IA 3C5CA 4DL9A 4JT2A 4R40A 1C8BA 2P3LA 3VU9A 4FWTA 1D09A 1T8UA 1ZI9A 2PL1A 3S5JA 5DI3A 2WJPA 1U1DA 3ZY2A 2VTVA 3JQAB 1C8VB 2BHNA 4GGPA 3QVXA 4XDZA 2XB8A 4CMIA 2DFLA 4RH1A 4ZO8A 3SGLA 2R25B 1SUEA 2ZT8A 2NGRA 2O7NA 4HGYA 4RLFA 4YRNA 1KVSA 4A8PA 4KR7A 3D02A 2FRDA 3FI0A 4OAOA 2CB9A 2GWRA 4JLWA 3TR6A 4X1KB 1CEQA 5FV7A 5HK9A 1G66A 1M1NA 3W79A 4BVJA 1J99A 4EJMA 3ND5A 5KOHA 3JVUA 4L76A 5BN3A 5C32A 2YV4A 4P4SB 2PGIA 2B8TA 5KKAA 3B1FA 5L4SA 3CVXA 1JS1X 3LU1A 1F20A 4XTRA 1BXRB 1E1RD 2GEKA 1EGHA 1I2MA 4F1WA 4EFNA 1E92A 4DUYB 4FZ5A 2ZR8A 3W5CA 3P0HA 4ZPJA 1RM3A 4RMNA 1Y4UA 1FSZA 2D1RA 1V11A 5EWLA 1UFRA 2V4ZA 4FUTA 3IXQA 2OQVA 1RHMA 5EMKA 2QRJA 1H2WA 1HM5A 1ISSA 3FPFA 4HX9A 5EFZA 4TUYA 4BUCA 4ZGBA 1JXAA 1AKYA 3EY9A 3AIKA 1DIOB 5EEGA 4QHSA 2ZP1A 1FVFA 3DWEX 2O07A 3UA4A 3QFFA 1YZKA 5L3SA 2PS0A 1DUSA 5JSFA 1XTPA 2WMDA 1B8NA 1KK3A 3EZ6A 4FUQA 5G0UA 1C3JA 3UWKA 3YASA 2HA2A 4BZQA 3GN2A 3ZUPA 3Q15C 1HE4A 5CCBA 4RCZA 1T9GS 4AL4A 4O33A 4FFBB 1S89A 4GP9A 4P4NA 3IOBA 1W25A 4KQ9A 4PZZA 5GJBA 1Y8QA 3SLRA 2XB4A 3UFXB 2PMEA 1RHJA 1V0JA 5HM6A 4C7OA 1WP9A 2P7HA 2PCLA 3CNQS 3A9RA 1EK6A 2WU8A 3F5SA 4LXQA 5AI9A 2EBFX 5FNVB 3TRHA 4UEKA 4A4DA 4EGCB 4X7RA 3MHTA 4G2TA 1K8RA 1VZ3A 3S7ZA 1MQAA 1XVIA 1XJ0A 2OOKA 3JTMA 3V8BA 3CO0S 4O2BA 1XNGA 1M6VB 4I66A 2CXPA 3V4FA 1VPLA 3ZLJA 2J3DA 4ES6A 1LK5A 4TVBA 1VJDA 3BIFA 4KBGA 4KIUA 3TJZA 1XRPA 3DZJA 4CF4A 1NXTA 3LS2A 4Q7QA 1XCGB 1Z38A 3H1TA 1JDTA 5KDLA 3AF4A 2R8XA 3CG4A 4Q1EA 3G0GA 4BBPA 4JJ4A 4JUAA 1IM2A 1E5LA 3JZFA 1P77A 2YOGA 2JFGA 4F3KA 1YNSA 2C2WA 5FUXA 4C30A 2JPDA 2O8DB 4JJIA 4D8VA 1AS0A 3E9YA 4WA8A 4YV0A 4F91B 3C1UA 4ZAGA 1BQ4A 4BBAA 5LXTB 1ZUIA 4M8NE 3T1HB 4YJ3B 1A8UA 2YHSA 1FSGA 4X7BA 1NIJA 1NASA 1Z5NA 1F0KA 1P31A 2H6EA 3REQB 1RRFA 1B74A 1T2VA 5IBQA 3FZEA 3A1WA 4D9IA 2B8WA 2EV9A 1L3BA 1YQTA 1XELA 4JXJA 2YDYA 1Q1AA 1A7KA 4H7HA 4KYUA 4MW4A 4YCNA 1PFQA 4FJ0A 3IUQA 5KC9A 1ZHOA 2E4ZA 3GP8A 2JFZA 4X94A 3W4KA 2G7ZA 4HLCA 5AW8A 2CW5A 2FPWA 4R8VA 1XYVA 2P2LA 2ZTMA 1Z3IX 3LDAA 3MJVA 2Y1WA 4MJLA 1UDCA 1VL1A 3KR0A 4MRAA 1SHKA 3AVVA 3WAGA 1E0AA 2Y0EA 5LP6C 4TTPA 3D54D 3UJ8A 5EUQB 1PDVA 4OREX 1OREA 4KODA 4O4LA 1HE5A 4YRTA 1KYTA 3JVEA 4PVCA 1XU7A 4EO9A 4YHHB 2IYSA 2PNFA 1NURA 1SQ0A 2HJWA 2WPNA 2XDQA 1SUWA 1WZNA 3NH6A 3GLGA 3AFOA 3WA6A 3OOEA 1CJTC 4S1NA 3E3OA 4ATNA 1ZD4A 4B7UA 5HZGA 5J4HA 5A3JA 2Q21A 2G80A 1KJQA 4Q1CA 4K9LA 4U2FA 5K45A 1VE7A 1WMAA 3NCTA 4OQFA 1SHJA 3TRFA 5B3JA 4AKIA 1H1TA 3EXHC 5TB5A 5EINA 5KSYA 1WMBA 2I80A 2O1WA 2HM7A 3WIVA 3NYQA 4UJ3A 2Q3MA 4DCJA 3OBIA 2H1WA 1EJBA 1U28C 2ZYSA 3GLQA 3RRMA 3UFBA 5C8YA 3ZHCA 1V7CA 3FG9A 1Z0AA 5BO5A 5T3YA 4ZKDA 1Z6ZA 2Y0CA 3O94A 4I2NA 1CR4A 5JEDA 1V1JA 3HKEA 4QYIB 4QBGB 1AHPA 1RKVA 3SM3A 1TAGA 1E3WA 4PLHA 2JRCA 2W0MA 1HFJA 1QAQA 1QNLA 3D4PA 3VI4B 4O4IA 2NPIA 4FFBA 1EK1A 4OXYA 5AWFC 2YZGA 1OIXA 3WWOA 1EWRA 1FFXA 1LVHA 3HY4A 3HRIA 4TV9F 4R1NA 3FFTA 1T2UA 4WBXC 5HA5A 4B2YA 4RPLA 1TIBA 1SD5A 3V4SA 5BNWA 3K2EA 2GX6A 2P9GA 3IIJA 4OMCA 2FOLA 2TMYA 3W1EA 4XAQA 5FPTA 2OGTA 2FNAA 2RHHA 1DX9A 5ED4A 1KQGA 1FUUA 2C78A 1T8SA 2GQ0A 2H4FA 2VJKA 3OE4A 3LT5A 2VP0A 3PIRA 3W0LB 4CLRA 1UIRA 1W93A 3IHWA 5EJ9A 1WU7A 1RLOA 3B36A 1UKAA 1U0LA 4PFJA 2FPLA 2Z8XA 1X6VA 1SZDA 3NWJA 4TTIA 3BULA 3RREA 4H1WA 2QP3A 2PZEA 4BKMA 1QOQB 1WF3A 2QZ9A 5CYPA 3SC2A 3UJCA 3VHXB 4NATA 1FVXA 3INTA 2DB3A 3BHNA 2PS1A 4OQPA 3CBQA 3SQNA 2O0KA 4RGQA 3C3KA 2P2CA 1PTJC 3O5AA 1IEVA 4I5FA 4WADA 1XLWA 2VT6A 3EQ6A 3FMVA 4MGEA 3MWEA 1R8XA 5AMXA 4CV3A 2I4IA 1X74A 4HZUB 3M5CA 4ZV7A 3FF1A 5EZQA 5D3KA 4BO6A 4RFLA 5JNVA 3VYWA 3IO5A 1MEOA 4D8XA 2R6CA 3SPXA 2ZKLA 3BE6A 1P1IA 4FSDA 1D04A 1ULTA 4LPKA 1X70A 4A2WA 3C24A 2X2OA 2QYSA 4CKYA 3Q12A 3HY3A 1ZH0A 3A04A 2A9QA 1LX7A 3PGLA 5B3KA 4HNAB 4CCWA 4FGLA 5IPFA 3I8OA 2PZMA 4G8CA 4PIVA 1LWOA 3TNFA 2CB0A 2GF0A 2WHEA 5KNDD 1ZGZA 1XZIA 4AM8A 2H7YA 4EY7A 5HCIA 4TV9B 2XVMA 3AG6A 1T6ZA 2Y92A 2IW3A 5SYNA 5C3MA 1X77A 4O4LB 1ZC4A 4D9FA 1C3EA 3P2MA 2GNOA 3SCZA 2V1UA 1EK5A 3THOA 5EHGA 1CD5A 1ZCFA 2F00A 1I10A 1YQXA 2IHBA 3FVTA 3IP8A 4OM7A 4R16A 5B7QA 1HT2E 4RENA 2KYRA 2AZ4A 3QF7A 3WDMA 2YWEA 3ZWAA 3H65A 1F7UA 4Q15A 2HPHA 3KQHA 4CR8A 3ELYA 1L4UA 2GBFA 1KY3A 2A9VA 5BWNA 2ZT5A 4Q24A 5ES3A 2H1IA 4PGFA 2GI4A 1PWEA 4TX1A 3GMSA 3GX1A 4H3HB 4ZAZA 4W5JA 4MP6A 5ALDA 5FWXA 5JCJD 3MGGA 1XXLA 1JIUA 1NN0A 5DTRA 3UW1A 3SYTA 1KDTA 5KAMA 4AJKA 3KYBA 3AB7A 2O7VA 1Y6FA 3CUTA 5KYTA 3AR3A 1MIHA 4HAZA 5FI1B 1L6RA 2A33A 2NV0A 4LXYA 4JI6B 3VR1A 5JS2A 3WA7A 3W5VA 3JWJA 2GFQA 3EVCA 1DWOA 2C4NA 4WQMA 5BQFA 1PT5A 1VMDA 3HU3A 4M6WA 4QAJA 4RJLA 3T6KA 3ZPXA 3AM3A 1Q7CA 4ESVA 2PRIA 5HIKA 2CDAA 3IR5A 4XGKA 4MVCA 2A4MA 5MN6A 2O8EA 4B34A 3FTCA 3FOZA 1QIGA 2IL1A 3FMGA 4HXGA 4PYLA 1RQLA 3IERA 4MQFA 4MNTA 2HK9A 2JIZA 4NF2A 5JSQA 1N7HA 2BC9A 2G0NA 3F46A 4CGYA 4ERNA 2HYIC 1EFPB 2WJVA 5IXJA 1HG0A 2OP0A 1QO0D 3DLBA 1N0HA 3EUAA 2OB2A 2C99A 2REOA 2BI4A 2XWQA 3EIUA 4JP8A 5A3SA 5HBRA 4BNLA 1SOUA 3LZDA 1WCWA 4NDAA 1WTCA 4UDXX 1RRMA 4G9BA 4WOKA 4YAFA 3X2SA 5K0CA 1BDHA 3BWXA 2JEYA 1NMXA 3HYSA 4OU4A 2FW7A 2VPWA 4UDYX 3TFQA 1H66A 2G8LA 2PBFA 4H4CA 4LMAA 5H7XA 5I8PA 4NMXB 3HCRA 3IBGA 4LHSA 1QRTA 4B4DA 4CLHA 5C80A 2QENA 1GGFA 4LJ9A 5DNCA 2Y6UA 4ENQA 2FI1A 3HJTA 4FQ8A 5JMPA 4P0PB 5BWMA 3OD1A 4TSFA 4EB6A 1PJQA 5ITZB 2CZGA 2HMWA 3AOEA 3G8AA 3GRFA 3AOEC 3BOSA 5IW8A 3UJ9A 4ZJZA 4I4CA 4Q01A 4TLCA 1KTIA 1B2LA 3DYBA 3FSGD 3QXGA 4EGQA 4FYMA 2ADMA 4L8GA 3GEGA 1XSEA 4K0RA 3OC6A 4U0KA 3IYLW 1PEDA 1XKXA 3G5UA 1Q0QA 2YWRA 3E82A 1TM5E 1XGKA 2C42A 2EXXA 2YHBA 3E4CA 1A8HA 3IKJA 4I1OA 4KSCA 3K1TA 1K98A 2AVNA 5AUPB 2G5TA 2VA8A 2PYZA 4D44A 2EZTA 3L40A 2GJ9A 2R2AA 1K4YA 5FTMA 3QUBA 3I30X 3E61A 2JHPA 3OHSX 1Z26A 2P5SA 1T0IA 2D5CA 3ZV4A 4QICA 1NW4A 1OPRA 1IOLA 2DHDA 3BAFA 4CETA 1IZ0A 1JHDA 3GLTA 5LCXA 3O3OB 4F2GA 5LB2A 2OFWA 1GN9A 1EQAA 2INGX 2WP8J 3VR6H 4IZOA 4EPRA 1CR2A 4YCDA 1KZHA 1QGUA 2XQVA 1M2VB 3MGBA 3CURA 1KI1A 4MPRA 5ICCA 3JSAA 5K0JA 1VRWA 3IHLA 3NT2A 4ZI2A 4D8UA 3LUPA 5COAA 3KPJA 4MI9A 5HCNA 1OFVA 4B8YA 4BQRA 4IRMA 1XNJA 2FCRA 1UMDB 4UASA 1LS1A 1C9EA 3DTVD 3DW3X 2BMFA 4P3YA 1ZLXA 2ZRHA 2IUEA 2X9GA 4JJGA 3AHIA 3TLKA 3PYMA 4HYTA 4BFSA 1EIWA 1H6AA 1DKNA 3U3ZA 1H6CA 2YC2C 1JR3E 3KDPA 4XD7D 3RYFB 3SVZA 1KHHA 4PBRA 4JGGA 3PUHA 4KH0A 1O8CA 5TQ0B 1OXSC 3S3TA 1IZ8A 1L3CA 2G8NA 5K3CA 2LBPA 5KWEA 4IEFB 2Q46A 4W5RA 3CUSA 3O4IA 3QMVA 4H7FA 3TCNA 3SSOA 4AG3A 2P4EA 4H0CA 1IJEA 4YAIA 3RYCB 3VR2A 2WTUA 1P5JA 2I1VB 5JJKA 2YXNA 4AJOA 3AESA 4I1RA 2J3LA 1E6MA 2DXIA 3IILA 3SKYA 2DBZA 3K96A 4Q48A 4RE5A 4BXOB 3I64A 2N1BA 2OQIA 2SHKA 4IDCA 4QELA 4OKNA 2Q9CA 3E8XA 3ESZA 3P2KA 2VZEA 4WSOA 4E88A 2HWUA 3KJIA 4W1PA 5EMHA 1KJIA 3KTAB 4BB9A 1GGEA 1Q57A 2YH2A 4HVTA 3FFWA 1X7ZA 4QXQA 3NGMA 5KJ1A 2JBWA 3FYTA 3U56A 2IPNA 1E6KA 1BWSA 1VL0A 3DZBA 1HR0B 5LQCA 3GJ6A 3X1WA 3EIEA 1XDGA 1C9MA 2IGBA 1JJAA 2IXAA 2VP4A 3MTIA 4JKOA 4Q18A 4IG9A 3AEUB 2VHCA 4Q3KA 2G9QA 3H2JA 2FFAA 3K70B 4WN9A 3ZDZB 4OL0A 3QX7A 2IOFA 1F0NA 1NLMA 2EW2A 13PKA 4LE1A 2ZIWB 4ZQHA 1M0TA 2B8JA 5ER9A 3U7JA 1G3IA 1RHRA 4HAYA 3ABIA 3HGTA 1CYDA 1JV2B 1MZVA 3FTNA 4OXNA 5A05A 4IO1A 5K4AA 2E4WA 3T3IA 1EUZA 4JVNA 2BKXA 1O87A 1NN1A 4UVEA 1RCTE 2BMWA 1NVAA 3MZ0A 2AK3A 2GCOA 2EJWA 3DMNA 4UEQA 2Z9CA 4E13A 1GITA 1OVMA 1E1DA 3AERB 4ND8B 2NYUA 3KM0A 3NDJA 3U7RA 2IOHA 1PZHA 4ZDKA 1YBHA 4BIIA 6NULA 3T1TA 4YAOA 2PZAA 1FY2A 4ZI3A 3NAQA 4H77A 4HEQA 1IAQA 1WQ3A 2YIDA 4ENVA 3ANTA 1Q0ZA 2VHXA 2WDPA 5IG2A 3AF5A 3CRNA 2LW7A 4GYJA 1KKUA 4BTLA 1ZOSA 4EUEA 3EUWA 2A30A 4DIOA 2DFVA 1RVDA 1DDGA 2VQ3A 3PVCA 4UKDA 3T8YA 3BWEA 3E2MA 2W6ZA 1ISPA 2WAOA 1XOIA 4OUKX 5CT5A 4ZAXA 3OZSA 2O48X 4V0OA 3SHWA 5JCZA 4BY9E 1G2OA 1O96A 4GZ3A 1SU4A 4QU8A 1HLPA 3VMMA 5KS2A 3R6GA 1E77A 5FI5A 5T6BA 3HBJA 1VA5A 5KQGA 2BFCA 1O95C 1JL3A 1JDNA 3PUZA 3K3PA 1YA4A 3ROTA 2IPOA 5T41A 1HNWB 2IE0A 3T95A 3L4JA 2UUCB 1U1CA 5GZ6A 5F33A 2GPJA 3BHIA 3SHFA 5CT4A 2QX6A 1B7GO 3BF7A 2X77A 2RGBA 1HX7A 4MLDA 4M21A 5JZ9A 2OV4A 1BW9B 4UZSA 2QN3A 1Q0PA 4G67A 1P9LA 1W4AA 1X9GA 2PUJA 2NZWA 4EATA 4P9NA 4ZEVA 4QRIA 5K8VA 2WU3A 1MRNA 4I6GA 1WAMA 4K6HA 1X7ZB 4CM1A 4CMAA 3H9QA 2XODA 4LIPD 4LI3X 3IT0A 2NZXA 4JBGA 1FNDA 1RLJA 4QVIA 3OICA 2PUHA 2NP7A 3FWPA 1GZHB 4PYRA 2CJWB 1S3FA 4OBBA 4ZA2A 3UWPA 3VJLA 1UM9A 3ZYCA 5FDFA 1SOWA 3QEAZ 5CH5A 3DUWA 4MKRA 1IY8A 4JFAA 1OR8A 4KE6A 3A32A 2QVZX 4IGAA 2R6GA 4PNEA 3EX7C 1HDCA 3ZIUA 3DYVA 2VXYA 3R4CA 3O4VA 1Y8RB 1PEAA 3JSXA 1FU8A 1U3WA 4FDMA 4J2HA 2QYTA 2R6AA 3N7UA 4U39A 4RL6A 3JW8A 4URWR 1CZRA 3SY8A 4G23A 2W2KB 1IN5A 5JZOA 2HEIA 4UPEA 4C6TB 4DM4A 1QV9A 3MRSA 2Q6LA 3JATB 3RFTA 4PCAA 2DYKA 2I2BA 4QTYA 3GQBA 1Z74A 1EUQA 3KOYA 5E9QA 1GXSB 3CRVA 3HUTA 2OO3A 4BQFA 1ISGA 4RQTA 1TVCA 2Y1KA 4LHVA 3HV2A 4EECA 5LQNA 1Z2NX 1WNTA 1I8TA 1UKCA 1Q95A 1QVZA 2W2LA 5HRCA 1ZH2A 4TZTA 4DCCA 3VPCA 3CCBA 3AERA 4AURA 1DCMA 3LWBA 2FK8A 4G1CA 16PKA 2GCPA 1L7NA 5MN4A 5SV2A 1SEVA 1XLUA 5CITA 5ECYA 4BKPA 1VM6A 1IOZA 2AFHE 1HA3A 2JGLA 1Z83A 1MHPA 3GZNA 3NKFA 5CX4A 3UJ3X 3UM9A 1MB4A 1TMOA 5FEMA 1VYVA 3NDRA 4L57A 1BGVA 1D07A 1JPJA 1G59A 3HDTA 1GFZA 4B6QA 5IK2D 1QUFA 4ZRNA 4LZPA 4ZXPA 2A8YA 3I1JA 3AR6A 5CVUA 5HKLA 3CX3A 1U0JA 2OMKA 3JALB 4ND2A 1FQKA 1UAAA 1ZESA 2ACEA 1E3SA 1JWBB 4H16A 1C9YA 5BWCA 2W42A 3EH1A 1XYGA 2SCUA 3KU4A 4PTLA 4MX8A 2ZUCA 2YMPA 2CXUA 1LZLA 4Y2RA 5GGYA 4YS6A 4QODA 5KINB 3W9SA 1P1BA 1Z07A 1OBFO 3LGAA 2J0UA 5JOQA 4FN4A 2CBGA 1YJQA 4S1WA 4JYAB 4BE7B 2DP4E 1DKQA 1G8MA 2VF5X 3B2QA 1QOPB 2NZ2A 2JFOA 3KRTA 3OPYA 2PDAA 1E58A 4U0JA 1ZLYA 3O83A 1PFGA 4Q47A 2ZTVA 3LUKA 2F3SA 4AS3A 4AN0A 2LIPA 3ZGOA 1WABA 3KSUA 4LVNA 1DI0A 1NC1A 3M6LA 2HSGA 3CISA 3KAQA 1ZK2A 1EMDA 4QUBA 3BMOB 2JZCA 4RL4A 1GT91 3ZOKA 1Q1NA 3ASUA 2ZU0C 4NJEB 2HRRA 4TXMA 4BGEA 1XEXB 1KA9H 3F0TA 5J4YA 4YROA 3EZGA 4TS9A 2Y0PA 4DMCA 1DVRA 1SUPA 3G5LA 4N7MA 1C0KA 2GK6A 1GA1A 3INYA 2XTAA 1WY7A 2PAFA 3TD6A 3STUA 3UUWA 1WSAA 3BDVA 1U1EA 3P9QA 4JNKA 2L69A 1G3RA 2CNKA 4K28A 1JA0A 1C0LA 4AF7A 3V4ZA 4CM8B 2RGDA 3HU5A 4IQ8A 1G38A 4JK3A 3U7QA 4ENUA 2PUBA 2NUAB 3T9CA 2MCFA 2ENWA 2IYTA 3AEXA 3FUXA 2B4YA 3L7IA 4DJAA 4FMBB 2I33A 1ZD2P 2IUSA 3I45A 3H99A 4LG1A 4ZOLF 3NOOA 4OQZA 3WNCA 1R7RA 4DBZA 3RUDA 2XB2A 2GUWA 5KHLB 5C5IA 3T9AA 1MC5A 4J91A 4QSMA 4UD2A 5K3DA 1QK4A 1XKLA 5AW2A 3P9ZA 4MYRA 4UOEA 4DRZA 3Q0EA 3GROA 3PIIA 1G9SA 1PG2A 1RYYA 3D6MA 4YCMA 2D4AA 2WI8A 3ASYA 3AUJB 1Y4ZA 4KQJA 1B8VA 1XXHE 1FNBA 2ZJ0A 3A1CA 3IQEA 1Z4MA 2O54A 1THTA 1YHZA 2I6GA 5FO0A 3COWA 5ALSA 4BWVA 2VHVA 1JRLA 1OLXA 2B1QA 2XNSA 3QHPA 3QOXA 3PKJA 1GYQA 4MYSA 2BMDA 1G4AE 2LCFA 3KKMA 3I58A 3RSHA 4YQFA 4BLVA 3SR0A 3K0AA 2OXRA 2JLQA 4V0MA 3ZH2A 5AM4A 3I62A 2FWJA 2EJBA 4L85A 3Q5GA 4FWIB 4NYJQ 1AT1A 1BCSB 1RIIA 2FFHA 2JGKA 3GJ3A 3W7VA 2H9YA 2OAP1 1ZKMA 2WVAA 3SHVA 3BPSA 3ZU4A 1YB2A 4YJ2A 1IWPB 1MJGM 4BNVA 5FWYB 1FRFS 3KJNA 4MR7B 1K0FA 3PNLA 2CVQA 1OX5A 1RBYA 1T3ZA 3TI7A 1Z6XA 2VNSA 1V6AA 4FX5A 1TO1E 4J16A 2I6XA 4J16C 4URUR 3VTFA 3BORA 1E4EB 1GVHA 1HQCA 4CIBA 1MGOA 2OR3A 4TZKA 1JU3A 4YNBA 4P8RA 3IQXA 4CMJA 4EG4A 3NASA 4C7JA 4FWBA 1GAJA 3ITDA 1RZUA 1DKUA 2B3DA 4XKJA 1YI1A 4ZYZA 3U61B 1G7TA 1SCNE 1VXRA 1A4UA 2AFRA 4RK7A 3SIRA 3VU3A 5G1PA 1RJ9A 1RHQA 1ZM9A 3KUXA 3X2FA 2EKBA 2HSJA 5C53B 4Q19A 2QAGB 1HT1E 1PRYA 2GKGA 2LRHA 3FLMA 3G0CA 3GGCA 1XAGA 2WD7A 3OWHA 1EFDN 2VFAA 4FONA 3NOQA 2HQOA 3O8OB 4JLBA 3B3JA 2GEJA 4Z7OB 4G25A 1EA5A 4MAFA 5ALHA 2J0UB 3ZXYA 1PF7E 5SY9A 2WIBA 5AXBA 2G3YA 2OL4A 1A8IA 4P33A 1N9GA 4FEYA 4RY9A 3A06A 1U02A 2JGMA 1NE7A 2G4CA 3IEXA 4ENWA 2F43A 3W34A 3LSTA 2PKYX 4JU8A 4RD2A 3ZWVA 3AM5A 1K4MA 3ED5A 4R8MA 1Q7EA 1O7JA 2I4OA 3EGXB 1H22A 2JJ2D 1KDOA 3W9YA 1BHSA 1HE3A 2R6JA 3OOHA 1B15A 5CB4B 2GASA 2RKBA 3ON5A 5FPQA 2IYUA 3KB8A 3ZS8A 4CMCA 5J58A 2PRJA 3T3MB 1ADCA 4A27A 1VIMA 2BR3A 4PEVA 3MWJA 5I7SA 4JEMA 4MCAA 3IEMA 4ALJA 1HL3A 1ZD3A 3IAXA 3NEAA 4MO9A 1IPEA 1O9HA 2J9FA 2Z2IA 2Y0DA 1A96A 1FLAA 3MTQA 2L18A 4Q00A 3VSEA 1UAYA 4S1PA 1YOVB 4U2BA 1UC4B 3WLPA 2LUOA 3LNTA 3MPUA 3RS7A 5DM70 1RJWA 4ZVQA 5EP4A 1PQWA 4HDMA 3DFKA 1QVVA 2H7VA 4MYDA 4UBMA 3G8CA 4E5KA 4EM6A 5K9ZA 1IRIA 2PANA 3LW8A 3K9HA 3BUSA 4N47A 4PE5B 5JNTA 1Z2EA 4PW0A 3ODPA 2O2XA 2J0QA 3G9QA 3D2AA 2DKFA 2W6CX 1MTZA 4GXTA 4LE0A 5U4QA 3TIIA 2MMGA 4RDHA 3RABA 1AK2A 4H7JA 1C2TA 4O2BF 2Q7XA 1U3DA 5D00A 2C2YA 1PGJA 3HNPA 1NJ2A 1UBFA 1YVDA 2BGNA 2JIBA 3PNOA 4HNRA 3ZEAA 4CKWA 3UBMA 4B81A 1JJFA 3PP8A 5IDQA 1SKYB 1XZFA 1SU6A 2ACKA 2Y1OA 3DVLA 5DRTA 1PUJA 1AK9A 2J31A 2H85A 4BQIA 1W1IA 1KRWA 4LI0A 1U7DA 1LJLA 2XXAB 5ABPA 5IN4A 1RDFA 1VBMA 1QHXA 2GM9A 4G4SP 4LUCA 3GFGA 3WGHA 3IS3A 1WBDA 2I6TA 3LFUA 3NO4A 5C31A 3MWGA 3VPDA 1ZP6A 1TE2A 4YT8A 3IP6A 3P71T 4TQAA 1I6KA 1C5KA 3JVIA 1Y98A 3CPEA 4OVKA 2P65A 4FD3A 3TSAA 4K9KA 3TFWA 4KXLA 4V0LA 2GBCA 3DGEC 5GINE 1GNQA 1XZBA 1JFRA 1Y5NA 4MHTA 3KQQA 3PC7A 1UZMA 3AI2A 3UGKA 1Z37A 5BPFA 4N5DA 3ENNA 4UUBA 1TZKA 5EKTA 3T1OA 3K2IA 3LUFA 3I9FA 2X9VA 2P30A 4CQLA 1R0BA 1PZNA 3ITEA 1G1MA 2JZNA 2ODQA 2XUOA 1DAKA 4CKBB 6YASA 4XWYA 3MWYW 2GN2A 1U0HC 2X8AA 3PXXA 4FFDA 2WF9A 4C2AA 3A1EA 4R4JA 5F7OA 1VKHA 3BTOA 4G0ZA 2WF7A 4DW8A 1Z2DA 3P4YA 4XIIA 1WHTB 2HC9A 3SE7A 1S3IA 3I8XA 3O2QB 4MDHA 1STOA 3T4EA 3JYNA 3AR2A 1TM3E 3NVMB 1E6UA 5MGBA 1J5EB 4G3XA 4OHBA 1UXKA 4PLCA 5AT1A 1QP4A 5BSMA 3RF7A 4F60A 3UHFA 2ET6A 3P0RA 4FZVA 4U3JA 1GUYA 1I01A 4KNWA 4TVKA 4E3WA 1ZKDA 4NHOA 3E1SA 2PUVA 2VN8A 3O26A 4I4TA 3IKVA 1NV8A 1GGMA 3NJ4A 2DM6A 4JUDX 3D4OA 1OI3A 3EBOA 3WYDA 2OK8A 5B6PA 4CIWA 2IS6A 2TRSB 4BVGA 5JSUA 1ZM3A 1KSHA 2AKYA 1EFAA 3MD9A 1J25A 2LVBA 2VQ6A 3B3QA 3NUZA 1U3UA 4RZUA 2OCKA 4ZWNA 4QHYA 3SFZA 3HYRA 5KKNB 1LD3A 1GPBA 1WB4A 3G0IA 4L9SA 4PLZA 1DAMA 1Z8HA 1D2GA 4WIAA 2GVNA 2K5UA 4RPCA 3DWFA 3IQHX 4J7CA 2QTAA 3EW7A 4NK5A 2PMKA 2A1UB 4RVGA 5AJUA 4DJJA 4M0DA 2D5IA 3ROGA 1RXUA 3HCAA 1SWWA 1UP4A 2PJUA 3AGQA 4ABYA 2XTJA 4Q4HA 3DV0A 1AA9A 1YSCA 1CZKA 1OX4A 1JU9A 4AUNA 1TLLA 4P7FA 1UWLA 4YALA 2PQ0A 5LU8A 3A9WA 3EFEA 3OX2A 4MVJM 5DF1A 1QCCA 3IPRA 2DKOA 2W2NA 4P98A 2PWZA 1FCJA 1NKVA 2WF5A 1XA4A 3I9MA 5G2OA 3U3JA 1B6RA 5HKBA 5FUWA 3G5AA 3NBYC 4UD6A 3AP2A 1ORHA 3B51X 4N40A 1YA8A 5J4LA 3PXDA 4RXTA 3G1TA 1SC9A 4RHXA 4X5OA 4GQAA 1TM1E 4V0QA 1NX6A 2DY0A 3MTEA 3FOWA 1DV2A 5CLIA 5B6IA 5IJ0A 5IMSA 4F71A 3KJEA 3WK5A 4MW2A 5HQ3B 4QJIA 1NXVA 2I3ZA 5ELMA 2W43A 3PDJA 4DAEA 1P44A 2WK1A 1UBCA 2ZE6A 3IIEA 5CT8A 2IW1A 2OA0A 3JR7A 1L7QA 1NF3A 4Y1RA 5IM4F 2PA0A 5BT9A 2QU8A 3GLGE 3IAAA 3N2GB 3BWYA 5I9MA 3HO1A 1KJ8A 2E89A 2VBCA 1HRDA 3FTEA 1B14A 4CEIA 1YCHA 2Q5IA 3Q98A 4AJIA 3ZD7A 5DNVA 2YRWA 4AX4A 5IFLA 1ZIPA 5JAMA 2QORA 4EGSA 2VL7A 2NSDA 1L5SA 4HGNA 3BWDD 1PNVA 1R9JA 4MHOA 5BSKA 2KQUA 2VOJA 2YJNA 3FHCB 2FZKA 3CE6A 3OOJA 3AO0B 1Z7BA 3AUFA 1D03A 1T36B 3KJFA 1SVIA 3P8ZA 1E9CA 1V9CA 2YWCA 3KVVA 4MVXA 2BM1A 4WZBB 1G8FA 5FPSA 1ISMA 3D0OA 3JXEA 1GPUA 1PWYE 3JZIA 3LVFO 4MVJG 3TL2A 2CXQA 1QH8B 1X9IA 3NC0C 1MNAA 2OCAA 4PAGA 3WMXA 2WSYB 2P9FA 2VC2B 1VBFA 3LTEA 4ZIRA 2REQB 4X1YB 3UK2A 1JHYA 3ZK9A 4MMZB 3WQRA 1QHFA 2X9NA 3FSJX 3L77A 4WZAE 3KYIB 4MMYB 2NZJA 1JDUA 2FN8A 2H4HA 2IVFA 2EARA 1X7GA 1E7QA 2DWUA 2ZAYA 5EIAA 1TYAE 3IMKA 2IY7A 2ZYRA 2DR2A 1P4RA 4RMJA 4W8HA 4KXMA 5DASA 4C2TA 2ASVA 3OUUA 4A0HA 4KQ2A 1YE3A 4PLVA 1ZH6A 3QG1A 1WG8A 4RTKA 5AHXA 3HDYA 3LFHA 1Q50A 4R7GA 4W7SA 4PX3A 3HJHA 1OH8A 4HGZA 3LKDA 1H2YA 1XZDA 1P62B 1ZJWA 3VNVA 2P2DA 4D9CA 3WQSB 5T6MA 2F3TA 2KHZA 3ZWYA 1V4BA 2A1IA 221PA 5AOAA 3SEQA 1T34A 3ZV6A 1I7NA 2KLBA 4F4DA 5MN5A 4IDFA 3TKLA 2I2FA 1L8XA 2PGNA 2SCUB 1VSVA 3SIWA 1QFSA 3Q3GE 1O96B 4N3NA 3TDNA 5J23A 4K9QA 3B5JA 3R20A 4HH0A 2WFAA 4JP3A 1R8SA 2GM5A 1Y6QA 3SR3A 1QB7A 1N8NA 1P6UA 1GPMA 2J5BA 2Q6VA 4NBLA 4Q3LA 4TKMA 5F98A 3CSUA 3LYUA 5KTPA 2AMYA 4JUFA 3AI7A 3T9DA 2J5XA 1KI2A 4JOQA 1Z4LA 2H17A 1GTL1 2PR2A 2ZOSA 4X20B 4PYQA 3EYAA 3RTDA 4RTQA 3ABZA 2W2MA 2X5OA 4B45A 2DFNA 3OT1B 1YONA 4ZT5A 4BRSA 1ZNYA 2QRZA 1NR7A 3LSYA 2Z3WA 3K70D 1M9NA 4BTVA 3T5BA 1OA0A 2WVGA 2ZU6A 4G36A 4ZVKA 4C4XA 1I3MA 1TKAA 2BDEA 3G9TA 5IXYA 5JE8A 4YRKA 1KI9A 1WXDA 1IY1A 3CO5A 4PS1A 3CKYA 2G82A 4G2NA 3R0ZA 3IURA 4H7PA 2PFSA 4IF6A 4B73A 5JAQA 2IPMA 2O3QA 2FRVA 1W73A 4AO8A 1S3GA 5A4IS 3A4TA 1LU9A 4YXFA 2HK8A 2O2SA 4BO5A 4G4SO 1AE1A 2AW3A 2EFGA 4ZI5A 2GJKA 1SUCA 2GDJA 4KXQA 3N87A 4DMFA 2PL3A 2Z4SA 5CM2Z 2FMTA 1QF9A 1AUVA 1LWNA 2F1IA 4UTXA 1XNRB 3HA2A 1OKKD 3MXTA 3K16A 3KSDO 5ALQA 3IMCA 1GAXA 1KZ9A 5SYMA 4D3YA 1ENYA 4D82A 1J5XA 1YFKA 2G7MC 4M0EA 1VHLA 3DKKA 4YDRA 4UNIA 1ZUD1 1Z29A 4HAXA 5JISA 4AS1A 1DC6A 4Q12A 2WWFA 5F35A 2NO0A 4LRWA 3RG8A 2RCYA 2M6RA 3G0HA 4ECEA 2CL7X 2OENG 2RJ3A 2UZ3A 2G28A 4XEUA 5B2FA 4OHZA 5FOQA 1HRKA 5IAGA 5KWSA 3IQIX 1TJ4A 1WXWA 2QZSA 5IVPA 1V95A 3TLEA 3FCSB 3Q3IA 1JYSA 3UMSA 1PVOA 2MINA 3PS9A 1PQ4A 3JVDA 4C20A 1F5NA 2FMIA 3RANA 1XF1A 1PD0A 1SXJA 4GH5A 1JQJC 1VB5A 1J8MF 2VPZA 4P86A 4MKHA 1AH2A 1YTUA 3UATA 1MJFA 2ONZA 2ORVA 4MO2A 3CGWA 1B2RA 2VSFA 2O8NA 3W3AD 4R51A 3ZE7A 1E2DA 2PYIA 3HKDA 1M2OA 3FRIA 4OXRA 2PE5A 3AR4A 5I4IA 3SX2A 3E3MA 5LQRA 1XI2A 4BNWA 4X66B 5IAOA 4AYTA 1E2BA 3JYPA 3TRDA 2B5VA 3KT3A 2X3YA 1OHHD 2H2GA 3I6QA 3QEMB 4WHMA 1BWRA 2RIPA 1E8NA 4H7KA 3W78A 1OW3B 2YXLA 4KV7A 3ZK8A 1UQUA 4Z2AA 5JWOA 4INJA 1KPHA 2XTNA 2ZRFA 3O95A 1AQ6A 3R0QA 1P39A 5AICA 3UJ7A 2QMYA 3H8SA 1K6EA 2LIVA 4JLOA 4KQCA 2I62A 2ZWAA 3JQAA 4E12A 2G4VA 5JZSA 2C4HA 2GZ3A 1A72A 1EFVB 3LOUA 2VYVA 1E99A 3PPIA 4HAIA 4KI0A 3S1LA 1OSNA 5DX1A 4ZT7A 5K8JB 1EAMA 3SF8B 2Q5OA 5C5EA 4P3OA 3OPNA 5TMBA 1XFDA 1OXTA 4IICA 4ZQIA 3IOMA 4BP1A 3THXA 4ZAYA 1PV1A 1K9VF 3RU3A 8ADHA 1SCAA 2C1ZA 2SKCA 3EQ7A 2HIGA 4RULA 3NQ41 1L5RA 2IKQA 5KTYA 2ZRJA 1SELA 2VJLA 2YWDA 3K1ZA 1G6HA 2VH2A 5D7BA 5B7PA 3HADA 3GLKA 4R2XA 4XUGB 4AY6A 4O4HF 1L5QA 2XCRB 5BVGA 2PRSA 1TAUA 4X8LA 1IMOA 1SN7A 1YRHA 1D2NA 1DIGA 1G8PA 3MOGA 1NHGA 4Q3OA 3EXEA 2XZOA 2H4XA 3I92A 1XRNA 2WU1A 3I37X 3M6AA 1Y82A 4RGBA 2WIKA 2YOFA 3VPBA 3ZZ0A 1L7XA 3L46A 1WL8A 2YCLA 4HB4A 4M2LA 4JITA 1TYEB 4B1FA 3NTOA 3WMFA 2G1JA 1T29A 1KZ1A 1Y33E 5BT8A 4DTIA 3G2LA 3V8PA 4HLUA 2WIGA 4QO7A 3RRXA 4DLVA 4IJ6A 3D81A 5CA0F 2WOJA 1NHWA 1X2BA 3HN2A 4F6RA 1FU7A 2QN8A 4MZXA 4YMGA 3SOZA 5REQB 1DRJA 4EW1A 1NMQA 4L51A 2RGNA 5FWYA 1G3UA 1C7JA 4W1RA 3NW9A 4I3FA 3PI6A 4PYIA