4OUKX

Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
310
structure length
308
Chain Sequence
EAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYESADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAADMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase B
publication title Crystal structure of a C6-C4 SN3 inhibited ESTERASE B from LACTOBACILLUS RHAMNOSIS
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 120
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oukX00
5AM4A 3TGLA 5D6OA 2ZYSA 5HK9A 4UPDA 3OOSA 2ROQA 3EF3A 4G9GA 3H18A 2Y6VA 2XMGA 1YA4A 5K3FB 4KRXA 3FYTA 1LPOA 4ZV9A 2DHDA 4KAAA 1LBTA 4C4YA 1BN6A 3ANSA 1LPNA 4LYDA 2ZJ7A 1J1IA 4BZWA 2WHRA 4Z49A 1P0IA 1ZIXA 3WJ2A 2OAGA 1VE6A 5FV4A 3HZOA 4U2BA 2RGUA 1QIMA 4EUSA 5CBKA 1L7RA 1N1MA 5C8XA 4H18A 4KRYA 1LPMA 1EINA 3F67A 3SX4A 4KE9A 4F0JA 1XZIA 1L7QA 2J4CA 3JW8A 4YPVA 2PKYX 3C8HA 1LPAB 1WB6A 3G7NA 4Y9SA 5CT8A 4BDSA 1GKKA 3IUNA 1F6WA 4K2AA 5EGNA 2CEKA 3N0TA 1XQVA 5AI9A 2BGRA 2H7YA 5ALGA 4Q05A 3V1MA 1UKCA 5AKHA 4L3WA 4TGLA 3AINA 3DCNA 5ALYA 1TCBA 2ZJFA 1BE0A 5JYCA 2XUIA 2EEPA 3FYUC 2JBWA 4HTAA 3M3DA 2PU5A 5CT6A 2VAXA 1SOMA 3YASA 1IUPA 1CUAA 3I6MA 4OYYA 3FLEA 3QMMA 2HFJA 2VF2A 2FJPA 5A6VA 3FOBA 1ZJ4A 4X7BA 3G0GA 2HDWA 2XE4A 4FNGA 4G8BA 2PBLA 1HBJA 4IH4A 2BJHA 2WJ6A 3DJYA 5CH8A 7YASA 4HVTA 3PICA 5AHXA 4EY5A 5LKRA 4P93A 5FDFA 4K6GA 2FJ0A 4PSCA 4MXDA 1IVYA 1EI9A 2VJBA 5AO9A 2R11A 4U2DA 5BWBA 1PJAA 5LIPA 4INZA 1FFBA 2HRQA 4DMKA 3V9AA 2VEOA 1RYYA 1K4YA 2O7VA 3PI6A 3QM1A 4P9NA 3QPDA 1YAJA 4F60A 3UUFA 1VA4A 4Y2PA 3GZJA 2X8BA 4Q3KA 5K3DA 3AUKA 1P0MA 4G8DA 2XT0A 1A8UA 5AK3A 3HXKA 3GFFA 1MPXA 4QDOA 1UWCA 1ZGCA 4N8SA 4X6XA 1W76A 2JGMA 3DD5A 1XZEA 1W6RA 1ODCA 1SCQA 1VZ2A 4OU4A 4ZV7A 3PFCA 2DSNA 1QOZA 2FUKA 1CUWA 2WUEA 5LZ8A 4CG1A 1E8MA 4W1QA 4J3JA 2WHPB 4L72A 1JKMA 3R3VA 4C88A 2CUTA 5EHNA 5FLKA 5HK8A 4CIAA 3H0CA 3C5VA 5D3KA 3X3HA 3DS8A 1GQRA 5DTIA 1RWQA 5JARA 3FBWA 4BC1A 4DYHA 1DX4A 1MAAA 3WK5A 1BCRA 4RE5A 5HFNA 4M0FA 2YYSA 3IA2A 3R41A 1XRMA 1JMYA 4MEBA 1THTA 1XQWA 4Q3LA 1O6FA 3C45A 1CUGA 1E8NA 2GBFA 2PUHA 3A6ZA 2XUKA 2CJPA 3NWOA 1E3QA 3F97A 3L1IA 3S8YA 5CH3A 4U2FA 4NMWA 2OCIA 4A16A 3DL4A 4IQ4A 4MEAA 4MYSA 2ZYRA 1CUEA 1XZJA 2JEZA 3D4LA 2BGNA 4BVKA 2WFMA 2ZSIA 2ECFA 1ZI8A 3G02A 1JU4A 2XQIA 1CUCA 3MUNA 3D2CA 2X5XA 2D0DA 5K3CA 3C6ZA 4AQDA 5BOVA 4LXGA 1Q83A 3AIMA 4MWTA 3DOHA 4DLNA 4KE8A 1GZ7A 2XUDA 1JU3A 4QE3A 1E89A 5ALRA 2OLEA 1EB9A 4JUIA 5ALMA 1ZD2P 4WDQA 1FFEA 4OCZA 4UBKA 1XZDA 1U8EA 1H22A 3CN9A 4FTWA 3DLTA 3W04A 1LGYA 5HFAA 4F5ZA 3GA7A 3WWOA 2XUAA 4BAUA 2DCMA 4EA6A 2BAGA 5BV7A 1DQZA 2IX9A 1VKHA 1XZMA 4HAIA 3AIOA 1H2WA 4BDTA 4Y2VA 3WKCA 4B9EA 2VATA 3W05A 4S0XA 5CMLA 2HIHA 2OAEA 4UUQA 4A23A 4V2IA 4B9AA 1JJIA 2ACKA 3HRHA 1ZGBA 2AJCA 1XROA 3C6XA 3R3UA 1C7IA 2WFLB 3I6ZA 3QZUA 3H1BA 4OSEA 3OG9A 5A7FA 4DNFA 2JGIA 2WJ4A 3W06A 5ALQA 3STTA 3WKDA 2XMCA 5JAHA 4DMCA 2DQYA 1QE3A 4AZ3A 4GLBA 2JF0A 5AI5A 4UHDA 1VZ3A 3O4IA 1A8QA 5DYYA 4B0PA 2ONCA 4J0IA 5FOQA 1YAHA 5ALVA 2V97A 4K6HA 4BBZA 1DT3A 3ESDA 2J3DA 5AKXA 5EIHA 2AXEA 4HRXA 5ALHA 3WYDA 3E0XA 4DIUA 3LCRA 4MJ3A 4X00A 1CUIA 5AM1A 2PUJA 5JALA 4HRYA 4KR0A 1B41A 1W1IA 1DT5A 3I2JA 4ITVA 5IH7A 3CCBA 1AUOA 5I8PA 4KACA 4J7AA 2HM7A 1CUZA 4KE7A 3RM3A 5A71A 4Q1VA 4BAGA 4B80A 4WY5A 4AO8A 1AGYA 1T2NA 1OXMA 2WLSA 2XUHA 4D9JA 1F8UA 2QR5A 5DYWA 1UOPA 4OYLA 3G0IA 5ALKA 1XZGA 2ES4A 1CUDA 5BWCA 4J0KA 4Y2UA 4FFWA 1CVLA 5CTAA 1GQSA 4LXHA 4GW3A 1EX9A 5JADA 3I1IA 3I2FA 3H2IA 1DTEA 1MU0A 3I28A 2PSJA 5HZGA 4GDMA 2WFLA 2HU7A 3EBLA 2JEYA 5EHZA 5EHQA 3WWEA 2JGJA 5K3EA 5LZ4A 4KEAA 3V1KA 5ALXA 1IUNA 3BIXA 4ZWNA 5CT4A 4DMFA 3NUZA 4C4XA 3FLBA 4U2GA 5CRIA 1NX9A 5EI5A 1KU0A 1J06A 4AO7A 2WUFA 5HKAA 4AX4A 4PF1A 1DU4A 2Y2UA 3STUA 2YASA 1K8QA 1QFMA 1DWOA 4BYMA 2G5TA 1C7JA 3KDAA 2QS9A 1N8SA 3LS2A 1LBSA 5CURA 4BE9A 4G1FA 4BB0A 3RKSA 5E4YA 3FLAA 2WM2A 5ALEA 3P2MA 3KWFA 1ORWA 1CPYA 2H7XA 5ALFA 1NU8A 5EIAA 1QIJA 3WKEA 4AZ0A 3R3XA 4G5XA 1TK3A 3IULA 4AXBA 2V9ZA 4HS9A 4JNCA 4CFSA 3ILSA 3S2ZA 4ZGBA 3STXA 1QIEA 2WQZA 4WDRA 4QDXA 3WLAA 3VVLA 5AICA 1JFRA 4PSDA 1SFRA 4H0CA 3B5EA 3FYUB 3EQ7A 3N2ZB 1TAHA 4BZZA 4BRZA 5AM2A 4B81A 4Y2QA 5D3ZA 1CQZA 4AN0A 3ESCA 2O2IA 2QXTA 2JGKA 1KU6A 4E11A 4UHBA 2XQGA 3TEJA 2WG0A 4RGYA 4ZREA 5AM5A 1EA5A 1X2BA 3D0KA 5ALOA 5AKZA 2QT9A 3WWPA 1MX9A 1VOTA 3BWXA 4JH0A 4GEGA 3C6BA 3BE8A 4UBNA 1AZWA 2XUGA 1H23A 4EY6A 4I4CA 1XZLA 2HHAA 2VT6A 4J0GA 2HA0A 3FAKA 1QO9A 2X76A 4QEKA 2CKMA 2PPLA 1XRLA 3AILA 3G9TA 5ALDA 1LZLA 3I1YA 2GYWA 3F9CA 2AJ8A 4PQEA 2CBGA 1BROA 1WPRA 4B7ZA 4C6HA 1IUOA 1MTZA 1TIBA 3F96A 4LHEA 3A2LA 4DNPA 4E15A 1QGED 1ACLA 2XUFA 1BN7A 3G0CA 3D5EA 1QIFA 5A2GA 1CUXA 2I78A 3C8DA 2QJWA 2XMRA 3FSGA 2ZSHA 4BCDA 5C8ZA 5H3HA 2Y2VA 4W63A 2HA5A 5KWIA 5ALWA 3E3AA 5YASA 3FSGD 1A8SA 5K3AA 5AI8A 1JT2A 4KAJA 4UFOA 4TPKA 1IZ8A 4BATA 3FWHA 2QUBA 4U2CA 1S8OA 4G4GA 5ALZA 4OUKX 4UBIA 4X3CA 5FPQA 3WK8A 1W75A 1ODSA 1TCAA 4ZXFA 3DOIA 3D2BA 1BEEA 3U1TA 2HA7A 4BP8A 1AX9A 1YS1X 3PDCA 4UBMA 3A70A 3SC2A 1XZCA 4XWGA 4PNZA 5IVKA 2Q0XA 4KYVA 4H77A 4J0JA 2G63A 1WB4A 2BKLA 4GXNA 1NU6A 2O7RA 4OU5A 5FPPA 5AI4A 3V48A 5A7HA 2PSDA 1U4NA 1C4XA 4X90A 4CG2A 5ALTA 3LP5A 1Y7HA 2IITA 2VJCA 5FUMA 5K5EA 5DTJA 1CUYA 1L7AA 5CXXA 3M82A 3DDUA 3G0DA 1UK9A 2HA6A 3RARA 2HL6A 1QIHA 2NW6A 3FCXA 3K6KA 3LLCA 4WFJA 2AJDA 5DJ5A 3FVTA 1AMNA 1XKLA 5FP0A 4LXIA 2XI4A 3ICWA 5ALSA 2VJDA 1PV1A 2OQIA 2J4FA 5SYMA 2V98A 4J03A 3IURA 3V1NA 2DHCA 1LPBB 4EZIA 4Y2JA 3WL5A 5DYTA 5AKEA 3A2MA 5CH5A 3TRDA 3IUQA 1UOQA 1Z68A 4QWWA 3QMWA 3QBJA 1CUUA 3WQHA 4EBBA 3W9UA 1G4HA 3R3WA 2VA9A 4BRSA 5IVHA 3QH4A 3NOXA 1ZOIA 2QJRA 2CZQA 3BDVA 5AK4A 1DINA 2K2QB 2HADA 5E4TA 1MNQA 1QTRA 3OPMA 3Q0TA 4B83A 5AM0A 1UK8A 5DNUA 1N5RA 2PM8A 4EY7A 1CV2A 5HF5A 1VLQA 2HA2A 3O4GA 2GYVA 4K6KA 4ARBA 4G9EA 4H7KA 4W9RA 4X85A 1CLEA 3L1JA 2QRUA 4AN1A 4H7IA 1XZFA 3U0VA 5JAOA 4BC0A 1ZIYA 3MVEA 3R3YA 1ISPA 4BTLA 4GECA 3DQZA 3IBTA 5E4JA 2OGSA 3BJMA 5ESRA 3WK6A 4LKOA 1R50A 2BFNA 5FKJA 1P0QA 1MAHA 1UKAA 3AZPA 3DYIA 1K5PA 4B82A 1XZBA 3I2GA 5FRDA 5AM3A 3ESAA 1ACJA 3GELA 1EXWA 3WZMA 3PF8A 2BUBA 4HXEB 3DEAA 2XQKA 3VJKA 2VAVA 3AJAA 2WIJA 3AIKA 4B6GA 5ISMA 3ZI7A 2OCLA 3MGAA 4O08A 4UHEA 1FSSA 1QIKA 3WKBA 1A7UA 2P8SA 1IZ7A 1EB8A 5HF8A 2I3ZA 2WG1A 4GWLA 2I3DA 4DSZA 3ZLTA 4DTCA 2XUPA 2WHQA 1EH5A 3BJRA 1LNSA 3OM8A 4UBJA 1YB7A 3D3NA 1VXRA 4ROTA 4XX1A 1E66A 2WUGA 1GGVA 3WKAA 2WIFA 4X97A 5HF9A 5ALIA 3O4JA 1DX6A 5KBYA 1X70A 3KSRA 5JD4A 1CEXA 2G5PA 3I6YA 1GPKA 1ZJ5A 2Z8ZA 1F0PA 1LPPA 3WWCA 2VT7A 4C87A 2Y6UA 1CFJA 1G42A 3M83A 3VDXA 5AOCA 2GBCA 1XQXA 3IVMA 1LZKA 5K3FA 1EVEA 1BEZA 5AP9A 2XDWA 2WJ3A 1QIIA 2XQFA 3AZOA 3K9BA 3B3QA 1CR6A 1YSCA 1CUHA 1W4LA 3DKKA 1CUBA 5K3BA 4CG3A 2XMQA 4N8DA 2H7CA 2DQZA 2HU5A 4UBOA 3EIOA 4UFPA 4X95A 1WPXA 4GBGA 1MNAA 3VJLA 1R4ZA 5HF6A 3PE6A 4B85A 3AZQA 3O4HA 4JEIA 5DWDA 5J3JA 4WY8A 3W2TA 3OC0A 5T4HA 1ZI9A 1VE7A 1LLFA 5AK6A 4NS4A 1CQWA 1XKTA 1H2YA 1TRHA 2C4HA 2PSEA 4W1SA 6YASA 2XMZA 5LP1A 4OB6A 3LIPA 4QNNA 5IKXA 4Y7DA 4UHHA 1PFQA 2B20A 3F98A 1MT3A 1BCSA 1Y7IA 2HA3A 5ALPA 1H2XA 4RE6A 4NVRA 4QDZA 2WU3A 2R8BA 4L0CA 1OCEA 1FJ2A 1R9MA 1EK1A 4BE4A 1QIGA 2XUQA 3WYNA 5CT9A 2Z5GA 5AI0A 4OPMA 5HQ3B 2GBGA 3G9ZA 3HACA 1YR2A 4LIPD 5DNVA 2ZYIA 1U65A 2IIVA 4JYMA 4C89A 1GXSA 5ALNA 3WWDA 3H2GA 2B9VA 1B6GA 3H2KA 5HCUA 1CUVA 5E2IA 4WFKA 3ED1A 3GROA 2OCGA 5FXMA 2PX6A 3V1LA 4J0CA 2WTMA 5C8VA 5D7BA 1LPSA 1XZKA 3RK4A 1WM1A 2H9YA 1W52X 5LZ9A 3GBSA 4J0DA 1EVQA 4AMYA 2Z3ZA 1YASA 1XLVA 5JASA 4H7DA 4Y2RA 1QTIA 5JZSA 3DL7A 5T4FA 3KOOA 3I2IA 1ZD3A 1M33A 4B0OA 3VXKA 3WJ1A 1I6WA 4RPCA 1ODTC 4A5SA 5JZBA 5JZ9A 1FFDA 1WOMA 2OG1A 4JYPA 4CCWA 2H1IA 4EY4A 2C58A 4KJXA 1QJ4A 4IH9A 3G0BA 3BL8A 1HPLA 1MJ5A 2QTBA 3FNBA 3PUIA 2LIPA 5JATA 3HJUA 1USWA 3E4DA 1CUJA 5AK5A 3IIIA 4AO6A 1WHSA 1WB5A 3WL6A 2OPHA 3QITA 4FHZA 3DYVA 1SCKA 3ZPXA 5T4EA 4GHWA 4MWSA 5DNWA 1DWQA 1VXOA 5ALUA 1CIJA 4F21A 3PUHA 1BU8A 2VJAA 1WCYA 5EFZA 3VISA 4PSUA 3SK0A 4BVLA 4J0HA 2QKYA 2XQJA 5F4ZA 1R88A 4E46A 3VJMA 3JWEA 5C81A 5LLSA 3KXPA 4PO3X 4Y2YA 4X71A 1XRRA 2RI6A 2Z8XA 2VQ6A 3R3ZA 3H19A 2QOEA 2RAUA 2B61A 4ETWA 4IO0A 1ORVA 2OGZA 2D5LA 5JANA 1XRQA 4W1PA 4FMPA 1VA5A 1OILA 4HXGA 3TJMA 1BS9A 4QA9A 1MN6A 2VTVA 1QFSA 2ZVDA 3PF9A 3BXPA 3MUOA 5AOBA 1H2ZA 2WG2A 4BCBA 3W9BA 2XMBA 3O0DA 3IDAA 3T4UA 2XLBA 1G66A 2XUJA 3PFBA 2DR0A 4UBLA 2C7BA 1IMJA 4X92A 1DWPA 1JJBA 5CT5A 1O6GA 5IVDA 4Y2XA 4QLOA 4BAZA 2ACEA 3EQ9A 1ZD4A 2RHWA 5SYNA 4BVJA 3WIBA 4X91A 2W6CX 1Q84A 3D59A 4AB1A 3WK9A 1UK6A 3WL8A 4WJLA 3FCYA 3QPCA 4WCVA 5AI6A 3H1AA 2HRRA 1XLUA 2Y1KA 2CMFA 1MO2A 5IVIA 5LZ7A 3BF7A 4EB0A 1R1DA 4UHFA 5JD5A 2O2HA 4AMZA 4I19A 4N5HX 2JGLA 1EK2A 2AJLI 3FYUA 3WA6A 3HSSA 3K2IA 5JAUA 4DGQA 5AKGA 4FKBA 2FX5A 2YH2A 1Q0ZA 3WMRA 1J2EA 3HLKA 4P92A 3H2JA 5ALJA 4PV7A 1XFDA 1CUFA 3DNMA 1AKNA 3R0VA 3A2NA 2V96A 3HYSA 1E8DA 4MQMA 3O9MA 1DQYA 3G8YA 1EHYA 1YA8A 1FFAA 3ANTA 2WILA 2WUDA 1X2EA 3ESBA 3ZV7A 5JIBA 4M0MA 4MYDA 3ZWQA 2JGFA 3STYA 4RNCA 4KE6A 4HZGA 5AKLA 3FVRA 1UK7A 2WIGA 4CIBA 2PSFA 4FLFA 1Y37A 3WA7A 5LZ5A 3I2HA 2XB6A 3BF8A 4UHCA 1JI3A 4CCYB 1XRPA 3SWWA 3GUUA 4WFIA 1XRNA 2QUAA 1ZD5A 4H7FA 4DNOA 3HC7A 4QWMA 1AC5A 1QLWA 3C6YA 2C5GA 1BRTA 4QZVA 2I03A 4IHAA 3HABA 4IH1A 4CI9A 1AURA 1K6EA 4BTVA 1EDEA 2PL5A 2QM0A 2XUOA 4LYEA 2HA4A 2GBIA 2BCEA 3F8SA 3G9UA 4EHBA 2ZJ6A 1JJFA 3H17A 3IUMA 4DM7A 1CRLA 4G8CA 3WIOA 2WFZA 5HKBA 4N8EA 5AOAA 3C43A 4GI1A 4G4IA 1GT6A 3OURA 4FBMA 1YCDA 1UXOA 2W22A 4L9AA 4B84A 2OCKA 3OTQA 1QONA 4U2EA 3VVMA 2XMSA 4XIIA 1KEZA 1YB6A 2O2GA 1CUSA 4G4JA 2WHPA 2XMDA 1FFCA 4ARAA 2OGTA 5EHXA 5LKAA 5KREA 3BDIA 1SC9A 1E5TA 4OD0A 3T52A 3C87A 5AKYA 1R3DA 4NZZA 2Z3WA 4YX9A 4KAFA 3DKRA 4HXFB 1YS2X 3B12A 1XLWA 3M81A 3STWA 4QDUA 2OXEA 5AKJA 4H35A 3IB3A 1HQDA 2QVBA 3WZLA 2ORYA 1UFOA 4DSAA 3O95A 5AJHA 4K5QA 4UFNA 2EDCA 3WK4A 4CCYA 3I2KA 4BP9A 4E14A 3KWJA 1ETHA 5HQ3A 4C4ZA 2PVSA 3UUEA 4DMHA 3KD2A 2WIKA 4H7EA 4FFVA 1K63A 1WHTA 2C5FA 3EQ8A 3CXUA 5LZ2A 3LIIA 5CXUA 2WU4A 2BUAA 2UZ0A 4OB7A 3CCCA 2GZRA 4C01A 2WKWA 2G4LA 1A88A 4ZRDA 4X94A 5CW2A 4OB8A 3D2AA 4QLAA 2J3QA 1VJ5A 2QZPA 4N5IX 3UMJA 3D7RA 4FOLA 3QYJA 4H7HA 2BUCA 3VKFA 1D07A 3BIWA 3E1GA 1U2EA 3H04A 4EY8A 3G9XA 2WTNA 3R40A 2JGEA 4H7JA 4QDTA 1GPNA 2GZSA 3WK7A 4PW0A 5JAPA 3STVA 4P08A 3ZLVA 2CB9A 1UT6A 3ICVA 2EDAA 3L1HA 1R9NA 3NGMA 2C0PA 3QPAA 2PSHA 1EDDA 2WIDA 1JMKC 4X6UA 3O9VA 1QO7A 1Q0RA 1UKBA 2AJBA 4FWBA 3ZLUA 5AKKA 1ZI6A 4Q34A 5I7UA 3HI4A 1AQLA 1HKHA 1UOOA 5EIEA 3HEAA 5AKIA 1RP1A 5I9IA 2VSQA 2QMQA 5KWJA 3QMVA 3QVMA 4W1RA 2QXUA 1GPLA 4Q3OA 1ZICA 4Y2TA 2RHTA 5AIAA 1P0PA 5T4BA 2PU7A 5A7GA 1F0NA 3C5WP 4I3FA 4TVKA 4Q82A 1SCIA 4YK7A 4DNQA 4X93A 1TQHA 2ZYHA 1G5FA 1GKLA 4FBLA 1HDEA 1UZAA 1TKRA 2RIPA 1THGA 1HLGA 1MX1A 4MQLA 3H2HA 5LYYA 4XJVA 2DHEA 5DLPA 1QZ3A 5A62A 2HU8A 2GYUA 3Q8WA 1XZHA 3WL7A 4X6YA 1HL7A 4Y2SA 3JYHA 5ALLA 3IUJA 1N5MA 2XLCA 1MX5A 1XQYA 4XVCA 1EDBA 2C0QA 3C70A 5AH0A 2B4KA 4ZI5A 4M0EA 5JD6A 1QIDA 1J07A 5AIBA 2DFPA 3RLIA 4BCCA 2RONA 4FLEA 2YXPX 1T4MA 1TCCA 2OQVA 1XZAA 2WSLA 4FNMA 5C7YA 4FLMA 4FDMA 3WI7A 4YASA 2JIDA 2E3JA 3CN7A 2HFKA 3AFIA
chains in the Genus database with same CATH superfamily
2D2XA 4C2AA 3HB1A 1CR2A 2ZRCA 1QGAA 4PLHA 2VP6A 3LBHA 2AX4A 4HWPA 6GPBA 721PA 3QPBA 3L6BA 3VR4D 1UT8A 2QN2A 1RABA 1QRDA 3RAGA 1N0WA 3ZNPA 1O97D 3DA8A 5EXXA 2XMGA 2C8JA 3FTCA 3H9QA 5GIOE 4ZEXA 3QOXA 1VQ1A 2BM9A 2A9RA 2PUVA 1W0CA 3CZRA 1FLDA 4M6WB 5AXCA 3OO0A 2EARA 3RYFB 4TVSA 3NHUA 1LBTA 3KTOA 3TVTA 1OGYA 3ANSA 4LYDA 2ZJ7A 1EXDA 3OTHA 1G19A 4BZWA 2JI7A 3OTIA 3EJ6A 2NAFA 3SNKA 1OYWA 1SXIA 3LY8A 4BZQA 1XPJA 1PUIA 3FOEC 1Y1PA 1N5IA 3K1ZA 3RFFA 3GRRA 4R9UC 4IEEA 5JD3A 4M37A 1P7YA 2FSVC 3PS9A 3BGDA 5AVYA 3NHYA 4UNIA 2XYGA 5ICEA 4DZTA 3SM9A 2EC5A 4D4GA 1QIMA 1VGRA 1PJBA 2ZE7A 4BUCA 3PR2B 3VC2A 1L7RA 1N1MA 3JQ7B 3V7UA 3QNWA 1FNCA 3SLKA 3W8DA 3RS5A 3ENNA 4CDMA 1NNSA 4BO5A 3BBLA 3F67A 4EI2A 3K0CC 2C0CA 2WM9B 3JX9A 3PE3A 2QSUA 4FFBA 4IIBA 4KE9A 4NFHA 1KKMA 4Q24A 2QE7D 5TGDA 4X41A 5DCWA 4F0JA 4HAWA 1QVWA 1NW7A 2IZ7A 4JOSA 2PUBA 2HXGA 1NJFA 3ZIUA 4U39A 4ACBA 1MH1A 1QLHA 2EG5A 2CXTA 2HLNA 2PZJA 1MABB 4ND4A 1JDZA 2PKYX 5BVGA 5F2KA 3KT6A 1CG6A 1I01A 1BA2A 1ZJ6A 1ZVJA 3ES9A 4HDNB 2CXQA 2GK3A 5JRJA 3BERA 2I34A 5A9SB 1AXRA 1L5QA 2DUNA 3M9WA 2ZSJA 2H92A 3MOIA 3NUGA 4H6VA 3UK0A 3DH0A 3PUVA 1Q95A 2FAXA 3HS3A 5LOVB 5EGNA 1EFLA 1Y98A 3RTGA 2O7SA 1FRNA 5FT9A 2ORED 1QNLA 5AI9A 5CB4A 3UQYS 4BUZA 5ALGA 1U6KA 3BX1A 3ZGOA 3KV3O 4PBRA 4QBHA 2I3GA 3FFXA 3WL3A 4X1IA 4XUDA 1H8ED 1J2TA 4HB2A 4H7PA 3U3OA 2V6GA 4TGLA 3T3PB 2IY9A 1EEHA 3N7TA 2QL5A 2ZBFA 2JLZA 4U7WA 2FR8A 1SPBS 1ML4A 1IHDA 2VNSA 3REQB 3I04A 1XTZA 4Y0VA 2J9GA 1H2AS 3JWPA 3OZCA 4ROSA 4W9NC 3WLMA 5IHXA 2CV1A 1TCBA 1WW8A 3JD0A 2JIZD 4LGCA 1NI4B 3SZGA 4BNJA 1M3SA 4D98A 4LGYA 3A1CA 5EIFA 2XUIA 1YZTA 4WXRA 1DAOA 1HE5A 1U8UA 3AUTA 2JBWA 3EXHA 2CL5A 4HTAA 3DDZX 4MZDA 4N6NA 3MWJA 5H3LA 1SVWA 3A9TA 4WV3A 5EE1A 3DM9B 5CFPA 2E4WA 2IYLD 4V02A 1QH1B 3YASA 4CV1A 3TKYA 2QHXA 2JIPA 4HPWA 4LJAA 2QG4A 3I9MA 3SSAA 3FLEA 4CCSA 1KJQA 2FSUA 1AE1A 5K2OA 4LOJA 4M1WA 2D7JA 4OMUA 1YS9A 3TNDA 4TUYA 2XXJA 4RD2A 1Y9JA 2VF2A 1H3FA 2FJPA 1KVUA 2VH1A 1BDBA 2OG2A 3FKQA 4WOBA 1P5JA 4Z9AA 5A6VA 1D2NA 1VMEA 1B26A 3C7TA 1QFXA 2VG8A 3HA7A 1FIUA 4G8BA 4RABA 2DHQA 2QM8A 3OJFA 3B6EA 2LVBA 1PQ4A 1HBJA 2RH8A 1WPGA 4KC0A 2R8YA 5A4DA 4MUXA 2BZ1A 3Q6IA 3DM5A 3OHSX 2WJ6A 1SRRA 4LXTA 2B1RA 2RHLA 3PICA 4RPJA 5AHXA 1Z37A 4KKXB 3NRCA 2Y0CA 3B82A 4F4DA 5A5VA 3ZK7A 3WGIA 1UOEA 2QAGC 1PVVA 1SOUA 4RLSA 1I2ZA 4DLXA 4URZR 1Z2CA 1P72A 2Q0HA 4N18A 1IVYA 4JUAA 3R3SA 2YXEA 4JA2A 2C2GA 4PFJA 5BWBA 1PJAA 1OTYA 1MO5A 4U4AA 4E5YA 1ZJYA 2XCQA 3T7EA 3VZRA 2DOKA 4X7MA 1JTVA 3PUXA 3OQOA 4TZKA 3ONEA 1GR1A 1KVSA 1V3TA 4ND1A 3I42A 4P1ZA 2WJJA 1V9SA 1WW2A 4DCPA 1JKIA 2VP5A 1XEWX 2B35A 3I76A 1K86A 1CB0A 2EBWA 3MWDA 1NHGA 3OM9A 3QW4B 2B6NA 3I9V1 4RDCA 2ZUDA 5BSHA 1U7PA 2OWEA 2POCA 1YBVA 2R6JA 2ZRAA 3QPDA 1DL5A 3IMCA 4ZO6A 3UUFA 1VA4A 3TSOA 1SEVA 4WT7A 3E8XA 1OBCA 2AOUB 3K53A 3HDQA 1I3OA 2M1XA 4Y1FA 4HQNA 4Q3KA 4Z99A 2DQSA 1TA4A 2FNAA 3EOAI 1IXRC 3GGJA 2PPVA 3QU4A 3CQ9A 4KYUA 4Z9XA 3H1PA 4CM8B 2FN4A 1TAUA 4UUPA 5BSFA 3VU9A 4QXQA 2J7PA 2XT0A 4RA9B 1BQ3A 2FMKA 4NK5A 3O38A 1Z0KA 1GQYA 3IXLA 2C1ZA 3GFFA 1NATA 1DFIA 4N8SA 4EKDA 1F4LA 2CXOA 3ZG6A 2MSKA 4C30A 1BU5A 4EPRA 1AOXA 3VBCA 1XZEA 1E64A 1W6RA 5JYBA 3AFGA 1C7EA 3EBPA 1BKYA 1SXGA 1ODCA 4Q1BA 1SCQA 2JBHA 2A92A 3B1YA 1VZ2A 1KFEB 2F3UA 2X2OA 3DSRA 1X13A 3AUFA 3JVUA 4OU4A 1U80A 3R7FA 4ZZ2A 1LB1B 3LHDA 8LDHA 1ZSNA 3PFCA 3D8NA 2B5WA 2I7XA 1OYOA 4BX0A 3IV9A 3DCYA 1DC6A 2EKPA 2IUUA 5DW3A 2P65A 3BSFA 3DL2A 3WO1A 1TXGA 4I50B 1Z35A 4CIXA 2WDPA 2QU7A 3LF1A 2Q6LA 4W1QA 3Q7QA 4CIDA 4BMYA 3JSXA 5JCJA 2H2HA 1Y3BE 3GLFA 3BK2A 3KB1A 5A0VA 4LOAA 2CUTA 1OX6A 2HO5A 5EHNA 2P6RA 4Y9RA 4JXXA 1J0CA 5FLKA 2QYOA 1LC0A 2P6PA 4CIAA 2YINC 3AEKB 1WNTA 4LZAA 5E1MA 3H0CA 3N2KA 5D3KA 3SC6A 3G1UA 3WLRA 5A4JA 1GL3A 1OXSC 3MC1A 4FCWA 5KSOA 1NR1A 1QVZA 4DCTA 3VTAA 1KWKA 3O8RA 1GQRA 4E6EA 3UF0A 3T4XA 1CW2B 2OEPA 2CDNA 4YDHB 1OH5A 4AYWA 1RWQA 4MVJP 1X92A 3TE6A 1FFWA 3FBWA 2XXAA 5IZCA 3MQFA 4ZAFA 1UFKA 3CEMA 2AVNA 3ZLVA 3HO1A 2NU9A 3E9DA 1N6KA 2X7HA 1TDJA 3BEDA 5E3IA 1XF1A 3EF1A 1T43A 1OGIA 1VRCA 3ANMA 3VR4H 2FUCA 2Y0EA 3AKCA 2DH5A 4QGSA 5ED4A 3LAWA 3RH0A 3JQDA 3ZNQA 4F2PA 1FEZA 3IAUA 3OM0A 4GX0A 2X2FA 1RQRA 4KZKA 1V3QE 3JS5A 3ZCQA 4Q9AA 3LBIA 3T9DA 1THTA 3KPYA 1RI1A 3WNDA 4A2WA 3DJFA 4OQXA 3FAZA 5HOQA 5GM2A 2MOKA 3IAM6 4W9NA 2ZJAA 3CPSA 1O6FA 3I4FA 3KELA 4YLEA 4GUAA 3HEMA 1CUGA 2VNJA 4TYQA 3VZSA 2E85A 3HU5A 3LUCA 3K0BA 1ZUNB 1AGPA 3A6ZA 1S8AA 4ZVMA 3ONDA 4OVKA 4FI3F 5ENZA 4F5DA 3JVEA 3HSKA 3PRJA 4OHCA 4US2R 2ZPAA 4I55B 2CJPA 4KXNA 1YBHA 1WP4A 3D6UA 3ELDA 3AVOA 5AVVA 3EOBI 3S8YA 4D7AA 2FPIA 3KZKA 1N9KA 1HEUA 2R8ZA 1N7HA 2VP9A 5DEOA 3W90A 3U80A 4G0OA 4JJEA 3MLBA 4NMWA 4GPZA 4A6PA 5JMTA 2AFHA 2G06A 1J1UA 2DCUA 3JATA 3EMKA 3MNFA 4IIYA 1OLXA 4IDPA 5K0BA 3U60B 1QANA 3IIEA 3SVTA 3DL4A 3L8YA 4RIGA 4GRDA 4EAAA 4GYJA 2JDIA 4TTRA 1V5FA 2P9CA 1DO2A 1TF2A 3BWEA 2F17A 3TLEA 4UU7A 1ITZA 3WSTA 5H59A 3NU1A 3SC2B 1R6AA 2P90A 2XB8A 3CX8A 1ONNA 2OO5A 3WGLA 4AY5A 1EFCA 1Z12A 5T3YA 1UJCA 3UT6A 3DFUA 4LCBA 3O1HB 2BGNA 3E58A 3QEKA 1U98A 2P4EA 2Q46A 2VOEA 5LM3A 1Q11A 3QIVA 1XMIA 1Z13A 2BFWA 1D04A 3PXUA 4KO2S 4UTRA 1PEDA 2V7UA 1RPZA 1FUUA 4I99A 3O1LA 1C3EA 4NENA 3WIVA 1DC4A 1Y4ZA 2O19A 4DR1B 5IEBA 1TPZA 4FGKA 1RMQA 3HXTA 3BMCA 4ZI7A 3UHFA 2F1OA 2O2XA 3PGKA 3ACDA 3MTIA 5DRTA 3RVNA 1Q14A 4IIJA 4TTIA 4CTMA 3MT0A 1CLUA 1C9EA 2BRUA 1QGYA 3QFSA 4D0SA 1KDTA 4FFOA 1YDFA 2XECA 2BI4A 2GNAA 1GZ7A 1M2VA 4E21A 2XUDA 3K9FC 1JU3A 3EK2A 2QE6A 1TA0A 3BQ9A 3LDFA 4NOLA 5JVDB 3GAFA 5IARA 4BNFA 4EL0A 1U99A 1JQEA 1NN3A 4I4TA 4FP9A 4ENRA 3H5AA 4MKXA 3NHMA 1QRSA 3GEHA 3KETA 1R5NA 2IYFA 2KJQA 3I34X 3LK6A 4RVHA 4MWDA 1FFEA 3L1VA 4KI7A 3QQPA 1D2GA 3PXDA 3KDSE 5IMSA 1FYWA 3OAAA 1W85A 4UE3S 3DAOA 5CNIA 4ZU1X 1H22A 5FI5A 4PTLA 3K9NA 5EJGA 5FTNA 1Z47A 3PI7A 4MWZA 4YO8A 1V1MA 2B92A 3DLTA 1YWGO 3GLHA 2O54A 3ON5A 3L8HA 3W04A 3AHGA 1GL7A 4BKRA 5FUYA 2YKGA 1RHJA 1RC8A 4M7OA 1XQ1A 2BI7A 2FEKA 1VJ1A 2VH5R 1NW9B 1YL5A 3LQ2A 4HNGA 5DP1A 3HRIA 3U1VA 3WWOA 5K0SA 2VAPA 2INGX 2VAMA 4EA6A 5G0VA 4BJ6A 1T9KA 3GW8A 1D6JA 4DKJA 1IG0A 2NZWA 2FQYA 2XDQA 2E5WA 1YQQA 4XARA 3VNAA 3VSBA 3E4CA 3UGTA 3V33A 5CIYA 3W3AD 4HXYA 3K30A 1ZD1A 3MILA 1L5WA 1F60A 2I4LA 1KZ1A 3L06A 3TLAA 1H2WA 1C1HA 1FTNA 3MTGA 3S2FA 3OY2A 4QHSA 1F3OA 1I9CA 3ZKAA 1QWOA 3BGIA 1YOBA 4Q3EA 4QYMA 3LI2A 4OQZA 2YWHA 3NT5A 3R75A 1B8NA 4HDKA 1H4TA 3OCCA 1ZGGA 1JG2A 1M34E 3GHHA 4A23A 3E3NA 1V39A 2YWFA 4Q4JA 1JJIA 3OUUA 3GPLA 4J6EA 3WRYA 4IL5A 1XPUA 3K20A 3IKLA 5TMDA 4YRTA 1EFTA 3OZIA 4EG1A 3NYIA 2E87A 1XTRA 4PYQA 4R1TA 4X45A 5CG2A 5J4YA 4R4JA 2HBQA 2D1RA 1JE1A 2J9FB 5DHFA 3VUEA 4WZAA 2PDAA 1OC4A 4HB3A 4PZEA 1N78A 2VSFA 1CYEA 3FTQA 2JGIA 1XK6A 3W2EA 4FQ7A 3X2EA 1M1NB 3ND7A 1JR2A 1GUFA 2HT1A 3VTKA 2I7DA 3E3OA 4RZSA 2ZULA 3V8VA 3F7NA 2CVOA 1Y81A 3FLMA 4O5AA 2NSYA 3ANNA 3ZUPA 3TXXA 4BO6A 4BY9E 1ZVMA 4BEWA 4F4JA 3OPYB 2O5RA 4FXPA 5T6BA 3C1OA 2DQYA 3CPJB 3CEHA 4MIOA 1J00A 2B3DA 3RLFA 4AZ3A 3HGQA 5AI5A 3U26A 1N1EA 3WSWA 5L4LA 2QG9A 5AFSA 3HNRA 4AIIA 3AF1A 4M88A 4KXXA 3VC3A 3P52A 2BI8A 4QFMA 5D8DA 1JHAA 1M2WA 3UBMA 4PC6A 2P9ZA 1HYQA 3D7LA 3RREA 1R12A 3H6HA 3ZE9A 1YAHA 1KPGA 3OX2A 4EX7A 4LYFA 4F9FA 4AICA 4PLGA 1G5QA 3ESDA 3M5DA 3VDQA 5AW4A 2H0QA 1J99A 3KTDA 4KL8S 4WNIA 1CJTC 3IE1A 3IRVA 2FK7A 4HAOA 4P4SA 4E32A 3NRBA 3NG1A 4LMRA 2RSLA 4IV0A 4RIHA 5ALHA 3E81A 4UTPA 2QLLA 2VC2B 4XGQA 3ABIA 5BXQC 5DTRA 2P67A 1OLSA 4IIVA 4R40A 1HDGO 2QSZA 1A7JA 1UZMA 3PZRA 4LK2A 3UEOA 4TRJA 3G6WA 1D1PA 3A9WA 4N39A 3JQEA 3B6IA 3P19A 1HSOA 3ZW7A 4Y98A 1G8HA 2PUJA 5BO5A 1XTJA 5FTMA 4WNCA 1MORA 1NSFA 2J9YB 3PEEA 4M8IA 1W1WA 4O0LA 3HLTA 2C2XA 2H52A 3FZQA 1RAEA 1W1IA 4PHGA 4D0NA 4E31A 1P18A 4YUAA 3CCBA 4JT2A 4RSGA 3WISA 2ZUFA 5I8PA 5UKDA 3EXAA 3OWXA 3DFMA 4J7AA 4KACA 5J2TA 1YQXA 1FLVA 4IX9A 4KE7A 3CJQA 3Q6NA 3KZXA 3T12A 3TR0A 3O82A 4QHYA 3DBHA 4WJKB 2EAUA 2M6SA 3PDHA 4Q1VA 2AFIA 2YC4C 4QUIA 4YEDA 5KYVA 4JI1B 2CK3A 1XTQA 1RQ2A 3H1TA 2ZVQX 1YB1A 3NKVA 2P0AA 4YONB 1M2OA 3WGOA 4BU1A 1Z22A 3LTNC 2DLNA 2IPOA 5KU1A 4GE0A 3OT1A 3ILXA 4LJ5A 3SLGA 4Q01A 3RASA 4NOJA 2QR5A 5IK2A 4AU1A 4BO4A 4PLFA 1UOPA 4BGIA 1HFJA 1I4TD 2YFHA 4NCBA 2I2BA 3LKDA 3FUCA 3S2YA 1XU4A 4GI3A 4NNOA 3QJYA 5ALKA 3T5CA 3T1OA 5GOZA 3EC7A 2Y92A 1XHLA 4J0KA 4NBKA 1TYDE 4Y2UA 2PXHA 2OCXA 4F6CA 1E7RA 1N2XA 3GRUA 4WOJA 4LRSB 4LXHA 2Q8NA 1SQ0A 2QE7A 2MCFA 3R7WB 3GLTA 2FSHA 1SWVA 4H16A 2D2FA 4R8KA 2XB9A 1E79A 1XVIA 4D41A 2OC9A 3VMFA 2I4MA 4J91A 4YUZA 1X0XA 4QXRA 4EG7A 3J81A 2BZ0A 3KJZA 1DXQA 2IZ5A 3PD7A 5ECYA 5C46F 3LC2O 4D9HA 1DTEA 1I33A 5GZ1A 4X8LA 2FUG1 1HNWB 1V16A 2P5UA 3WRWA 5KYWB 2PSJA 4JZKA 4GDMA 1ODIA 2HU7A 3DKVA 1GSAA 4KODA 3CWQA 3EBLA 1QE5A 5EHZA 1B0UA 3NETA 4XPIA 3TZEA 4CQJA 2F00A 5FHQA 7REQA 2O48X 1M1NA 3C4QA 5A4IS 1WD5A 5CB4B 3RSFA 5LZ4A 1NN1A 4UD6A 3W7AA 4P4LA 1CYDA 2CLKB 1OB2A 1SBNE 2Z1NA 4KEAA 1G0NA 1IUNA 3EDQA 4I9NA 2G9VA 1AQ6A 2EYQA 3MBIA 1M1ZA 3URKA 2OL4A 5B3JC 2PBFA 5CT4A 2R97A 4Z4QA 3I32A 1T1EA 4G37A 5DNYB 1NOJA 2C9CA 2PLAA 4AJLA 3DBIA 3SBEA 1P80A 2C7RA 5JBIA 4QPPA 5T5QA 5EI5A 2NXWA 3TQHA 1QZUA 5JQGA 1KU0A 1J06A 4GZ5A 4P7JA 3RKUA 5JHHB 4HKTA 5JUWA 2NZXA 3SM3A 4AX4A 1SC6A 3RRNA 1NOIA 3ZCPA 1KEVA 5EAIA 3UH1A 1U2PA 1O54A 2H4FA 3ELBA 4MP6A 3UJNA 4E07A 1IY9A 2LP4Y 2IEGA 1Y8AA 2DT5A 3HA3A 4KLRA 2QMOA 1NUSA 3D7SA 5LA6A 2YASA 3EH1A 5C4GB 3PRYA 1DWOA 1QFMA 1LJ8A 3GEGA 3R9KA 2G36A 1C7JA 3KDAA 5LU8A 1Y6ZA 5JT1A 3E2MA 1P77A 4OK5A 1OH7A 1Z8NA 1KH2A 3OZUA 3WAJA 3N76A 5AW8A 2H29A 1P0CA 1SPXA 2OBNA 1S6YA 4HAUA 4L22A 2WAYA 1VSBA 1QH1A 2BJVA 2Y71A 2V0CA 4HRAA 5K51A 5DXFA 4EHLA 2PUAA 1ORRA 1SBIA 4BPBA 2ZTUA 4MV9A 3FLAA 2VSNA 5TEWA 2NO1A 3VC1A 3GJ4A 4OHUA 1KBQA 1NUUA 2NXCA 1GJRA 1VECA 4WA7A 1ORWA 1HY3A 1CPYA 3H5WA 4PU0A 1JPUA 2CCKA 4P2GA 5EIAA 1W73A 3L18A 3KQTA 3R3XA 4G5XA 5AW9A 2BBSA 2X6RA 4X1KA 3HB5X 3CVJA 3IULA 3JTMA 1PJSA 3O2SB 3D6FA 3P96A 4M8SA 1B43A 2Q3EA 3S2ZA 2VDKB 2P1DA 4B4VA 1JEQA 1V5IA 2WQZA 5FYQA 5IKOA 1G5RA 1NKSA 4INAA 3UAGA 2PTHA 1KQPA 3NHKA 2FPSA 1YIDA 3FWPA 5BNZA 1NBMD 1JDJA 1P5ZB 4TLEA 2YVQA 3LQFA 4PYLA 1ODKA 4D8TA 5JXHA 1MJFA 3ZWNA 3GRZA 5D5PA 1E9DA 2V74B 2B83A 1SFRA 2HWXA 1DXHA 4N5DA 2D62A 4NI5A 2X9NA 1W94A 3ONNA 4H0CA 4AROA 4J9UE 3K2EA 4BJ1A 3WOHA 3WYGA 2Y1EA 3WDMA 2W83A 3DOCA 3OPNA 1JQBA 4RMHA 4RPLA 4Y2QA 1NTOA 1FSGA 1N92A 2KMLA 3A6EA 3L4SO 3NI2A 1G38A 2HYIC 4QGAA 2NM0A 1XZQA 2QJTA 4MS1B 2HQRA 3ESCA 4HWOA 2B2XA 4MYTA 5J40A 1NBOA 2CLMB 4NAVA 4OHYA 5IDVA 1PG0A 1TUGA 2VUTA 3H4MA 2J3KA 2VHZA 2XQGA 2GD6A 4E11A 2FW1A 3O31A 1L5MA 2HPVA 3KCNA 4TLCA 1Z5NA 2XPCA 2WG0A 2QLNA 4I3GA 5AM5A 3CUEF 3UGQA 3THOA 1ZAYA 2D7DA 4LY3A 1JE0A 3F8TA 5EWLB 3VU9B 5ALOA 3QSGA 3DZGA 1IXYA 2P3QA 4F96A 4ALJA 1RT9A 2I55A 1L2TA 3CUVA 5IXYA 4DANA 4FZVA 1MB3A 4E2XA 5LBIA 1C1YA 2DUWA 3IAEA 3BWXA 3NONA 1KRWA 4HH0A 3C6BA 2AHOA 3VMMA 1AZWA 4PTZA 5L3QA 1SVNA 1H23A 4N1AA 2WPDD 2ISCA 4G01B 1CULC 2X0EA 4M1KA 5IABA 3TJRA 2WA1A 2Z1DA 3FM9A 4DF3A 3M6UA 4LQLA 1RYMA 1XKXA 4J0GA 4PLVA 3ILHA 2HA0A 4UREA 1QO9A 4TTSA 5BP7A 3BFXA 2PT9A 3ND9A 1D6MA 4BLRA 1RTTA 4JBGA 5HWSA 2PPLA 3NOVA 1BEUB 2CVPA 1V45E 3AILA 3G8BA 3G9TA 4X3PA 4EOGA 5C3MA 4WXEA 1LZLA 4NPAA 3MMNA 3F0TA 1II9A 3I1YA 3ZCTA 1NI3A 3TIFA 4LNUB 4CKEB 3IRUA 2X23A 2YBDA 3E2IA 2XVMA 2WICA 4MR9B 4EJMA 1WPRA 3AEKA 2WD8A 3M6AA 4M9SA 3WJ7A 4C6HA 1KWGA 1E2QA 2FF7A 1RKXA 3TNYA 3GD5A 1CEQA 3L8MA 4CR8A 1TIBA 2PGDA 3CO0S 2J0UA 4LHEA 3UATA 1N1DA 4DNPA 4OFZA 3L8CA 5GJVC 1EP1B 1AHNA 4IOJA 4TUYF 3LBFA 4ARUA 2AI1A 5BMOA 1MXHA 1SY7A 1WLYA 2PZEA 4PZ9A 4S1NA 3UMCA 5AUPB 2YZNA 5FAKA 4JT8A 2EJBA 1BN7A 2RHDA 3D8SA 3NOQA 1F6DA 3WDSA 4HX5A 2Q4RA 3I0MA 3KVRA 4WOCA 2DFVA 1JBQA 1UODA 3AL2A 1CUXA 3LUKA 3PQ6A 2PFKA 2QJWA 2BFDB 3AHFA 3MTAA 4G5RA 4RK6A 4IVNA 1Z7GA 4QNRA 2HGZA 4A0HA 5KSWB 2P4QA 2F8SA 1NXSA 3BMOB 2CD7A 1N57A 2Y2VA 3AHHA 3GA0A 3SS7X 2VWPA 4W63A 5AYVA 4DXDA 1EUDB 5KWIA 5B2ZA 5FPKA 1RACA 2WOJA 1UMDB 2BBTA 3C4JA 3E3AA 4XUCA 4JUFA 4CQLB 5HJ5A 2UUAB 1CQIB 2FRDA 2ZIXB 4QJBA 4EYSA 4LPKA 4ARVA 1D4AA 3L7LA 1SXJC 4XWWA 4L4RA 4ZV4A 3PFWO 2OZLB 4HZIA 3PEUA 6NULA 4UFOA 3KZCA 3E9EA 2N3ZA 1XG5A 4TPKA 5HA5A 1JKJA 1XGKA 4BATA 2VXBA 2C5LA 3FWHA 5BQPA 4DCOA 1QH9A 1S8OA 4ZT4A 4D74A 5CDFA 4YMUA 1AS0A 3MN1A 4TLAA 5CHYA 1WSAA 1P2GA 1WU7A 4G4GA 1V5WA 3NX4A 2FWAA 1I7PA 1J0XO 1LK0A 3DLCA 3Q3EA 4HZUA 5DGHA 5DT9A 3MJHA 2QPOA 4N47A 1NE2A 4CLRB 5K9ZA 1Y8QB 2VWQA 4NZYA 5ALZA 2VJQA 4X3CA 3WK8A 3DLHA 4XQCA 1ZM9A 4YGYA 3K70C 3NORA 4GX2A 5SY4A 1PDOA 4B6QA 3OLQA 1NPYA 1E3EA 2EOAA 1CY7A 1S02A 2EZTA 3D2BA 3KJNA 4JVOA 1Y6GA 4BP8A 1K3UB 1GCIA 1KQFA 3I52A 2ZR9A 1NVAA 4IDQA 4O4IB 4LBVA 4LN1A 1J6UA 5EC8A 4DDKA 1SOVA 3G2JA 2P1ZA 4F12A 4CMEA 4IM7A 1U8YA 4XWGA 1R4NB 5K99A 4Q4HA 2HUPA 4EB6A 3ZDYB 1E77A 1FUKA 3DGEC 1UC5B 4HLNA 5AOVA 4JXKA 3ABRB 1CX9B 3HE3A 4H77A 3PWKA 5LDHA 3QVTA 1RZ3A 4RSHA 2JJ2A 2Q27A 2NO6A 4FMCF 3MWGA 4C0SA 3T3HA 3CF2A 3PPYA 2O7RA 2YJZA 4UJ5A 1QU2A 2P2CA 2IRWA 1A9RA 2AIRA 3DUFA 1T5BA 2B37A 4JJAA 3V48A 1SKMA 3NPMA 2XYVA 3BMCB 1VCIA 4WESA 1P0FA 4K9SA 3KB8A 2QTVA 4CG2A 3AF4A 3GLHE 4JWTA 4DJDC 4L8YA 5CJJA 4L74A 3TRFA 3V32A 1KEEB 3LQ4A 2V3VA 3CZAA 4EJ2A 2JIRA 5K5EA 3W6PA 5DTJA 2O14A 2DQKA 3PL5A 2BP7A 4AJ1A 5C1BA 4RY8A 5CXXA 4PG8A 1YB4A 2D5IA 3ETDA 3ZGXA 3G0HA 3T3OA 2MMGA 2P2SA 1SOAA 4FE7A 4EG4A 1SA0B 3OJOA 2HL6A 2R47A 1POWA 1GZ5A 4EUSA 1ZIDA 3ETHA 2QTZA 3QKSB 1I2AA 4A8PA 5KOJA 5IT9A 1FX0B 3K4QA 5LCXA 2QWXA 3C8MA 1GTZA 2FRDC 3CS3A 4KQMA 1DOAA 4RQTA 1UC4B 3DBLA 4E08A 2X4IA 4BN4A 4ZHQB 5TSDA 1KETA 1XKLA 2G88A 5FP0A 2PUEA 4FJ0A 5JNTA 5K0GA 2XUZA 3ZYZA 4H4CA 4BGEA 4AG3A 5ALSA 1BFUA 3SF0A 1X94A 2VNKA 2GI4A 3RYCB 1PV1A 3PKIA 5L51A 3W6OA 2CXRA 2ZUVA 4IHKA 4F85A 3CKLA 1UMBA 3CPEA 3WNVA 1ZVKA 1XVTA 2X8JA 4J03A 2XNDA 2G40A 3A3NA 3V1NA 2PXCA 4GMHA 4BNKA 3HXPA 3VGPA 1G16A 4Y2JA 4KPFC 1DAHA 1MB2A 1MENA 2JLAA 4G5SA 3TRDA 2HHLA 2WYUA 1XCMA 4MDHA 4QYXA 4LYHA 4FHDA 2ZBGA 3L7YA 2FWRA 4EMSA 5EQTA 2MR5A 3K0CA 4LE0A 4HX9A 1UOQA 1E2EA 1RWKA 1FP1D 4QWWA 3TXYA 3UBTA 2PNFA 3A3PA 4OAQA 4R41A 4TX1A 3BXOA 1X7XA 3CEPB 1U2QA 2I2FA 1OIVA 3JWGA 5NLLA 3SKYA 2BHTA 3DC7A 1TW2A 5DXJA 4YQFA 2I8AA 1QRUA 1B16A 3ESQA 4RL4A 4DM3A 2C82A 4ENUA 2V9PA 4BGDA 2Y1CA 4H4DA 2QZJA 3W9UA 2JAOA 3LKZA 3FA2A 4YPOA 3H3XA 2ODWA 2ODTX 2X3FA 2E48A 3R9XB 3QXCA 4BJHB 4AYTA 5IVHA 2DSTA 4G07A 4IINA 2VL7A 3PT5A 3QH4A 3VOTA 2GERA 5EG5A 1QFJA 3CW9A 3TM5A 4NYMR 5KX5A 3KX2A 3Q8XB 2YZGA 1ZOIA 4CMGA 4RULA 1LF5A 2NSLA 2CZQA 1EJBA 1ZOOA 2PCLA 1JNXX 3BDVA 1H9CA 1FMLA 5KS2A 1M7GA 1C8LA 5JCJD 1W2HA 2JAXA 4OXRA 4ZVNA 3WS7A 1MNQA 5DLYA 2X0IA 1SG0A 1EDOA 2Y1LA 3Q0TA 1Q77A 4R1SA 1UK8A 5J2UA 4TS4A 3SR4A 2VQEB 1BVHA 3GRCA 5DNUA 5DYIA 1V48A 1KDVA 4C1NA 4MAFA 4LJ9A 3AUSA 2P8JA 4XCVA 4F45A 1ZH4A 2O2YA 2Q7OE 3I01M 1XNRB 4KQFA 2BT4A 3OZXA 2D8AA 4R1PA 1OROA 1TUIA 3O4GA 4B3RB 2H06A 4NNPA 1KFJB 2VF5X 5D86A 4G9EA 3PT9A 1TCVA 4MRRA 3EA5A 1E2PA 1HT1E 4CHGA 4H7KA 4W9RA 5DM60 1SEPA 3PZBA 4X85A 2JAPA 2OCPA 3LP8A 3PQFA 3KTFA 1V37A 3OLYA 3PHCA 2HLDD 4KUGA 1P31A 4MQ6A 4PS1A 4NIMA 3OIGA 3PGXA 3U0VA 3UXYA 3ZU4A 4AC9A 1V8DA 2WWYA 2YN2A 4KOEC 3R3YA 5GZ6A 1H5QA 4HO1X 5KVAA 2HMUA 4B6PA 5K3OA 5EMMA 2W0MA 3ZXYA 4DV3B 3SBXA 4Y9UA 4HJXA 5BN1A 3PCRB 4R6WA 1T6XA 4OGLA 4N7JA 3WX0A 4B3SB 1E6EA 4QO7A 2X13A 3KJGA 4QTXA 3COWA 5HUHA 5IJ0A 3PJRA 3QXJA 4YJ3B 3WK6A 1FNNA 3SN6A 3AO0B 3GVPA 4RKEA 3CPHA 2FN3A 621PA 1HDZA 3P9QA 4QRIA 1XJ0A 4BLWA 2ZU6A 1PVDA 2WMDA 4TN5A 3CHYA 2FP4A 5GM1A 5KDLA 1GEGA 2EIXA 1N5KA 1KY3A 5LD2C 2CC2A 4E5NA 1FMCA 2ODNA 4G0XA 2G1JA 4X65B 4D9IA 2HQ1A 1IH8A 1USUA 2XDYA 3QU2A 5FRDA 4YMTA 2JLSA 4K9LA 5AM3A 2AFIB 2YY7A 1ACJA 4YO7A 3B89A 3UUWA 2V7VA 3PF8A 3L8GA 4RVGA 1SHLA 3L9WA 5JEDA 2WA2A 2N0SA 3CFYA 1I10A 4U7PB 4FE3A 4JJ7A 4IJWA 4AF7A 3IPCA 2Z57A 1RRPA 2ZKIA 4A0RA 4C5CA 4YAUA 4OGKA 1U1FA 3SXUA 1SC4A 1TT5A 3MGAA 3HZZA 1C2YA 4PWZA 1VRWA 4LHWA 1EVLA 3VDRA 4BO0A 5IDXA 3QYFA 3OQIB 3FDXA 3EIWA 2XT9A 1Z2NX 4JVMA 5E2BA 3R6GA 1U0NA 2ZS9A 4REQB 1ZJJA 3ROPA 3N2GB 1MH9A 1EB8A 2R2AA 4D92A 2WG1A 2C3PA 2P2NA 1ID8A 3RC9A 1PR4A 3KLPX 4H31A 4WE3A 2VKQA 3WQSB 3RTAA 1OAAA 4CN8A 2WF6A 4JLPA 2OK8A 4PLTA 2XH8A 4DSZA 3AERA 3RSZA 5IKMA 1TUEA 1SVKA 3PD1A 4DTCA 3RUCA 2FG5A 4OJMX 3KEOA 2PS0A 3DHVA 4DJEC 3ENZA 3IQHX 3N8DA 3WFJA 1B23P 4OHRA 4ROTA 1KH3A 2OWDA 3EX7C 2M9MA 1U0TA 2ZT7A 2D1QA 1BDHA 3AH8A 1C5KA 1WE2A 2HC9A 3DVSX 3HCOA 3KPJA 1P45A 3VPFA 4HAXA 3UVEA 4WK6A 4RKQA 4HGQA 4AZVA 2WIFA 3L6OO 5JPDA 2HXSA 3PGJA 4BNXA 2YS6A 2IYNA 5G4LA 1NXOA 3JSAA 4Q4AA 3WMXA 5ALIA 2VLIA 3W7VA 4IHJB 4CKBA 1YNSA 3PC6A 4HSGA 4PIVA 1K5GA 1X70A 3VTZA 1NVUQ 5E3JA 1UQTA 1CEXA 4ND6A 2G5PA 3ADPA 3I6YA 4ZVRA 1GPKA 3RVMA 3NEPX 1XPRA 1L7XA 1T5SA 1VFNA 3IBSA 4QPNA 4R83A 4TMVA 4YJDA 5GPBA 1E0JA 1CRPA 2F90A 1IY1A 1UIRA 2VT7A 1PP4A 5KTMA 1USVA 1F48A 1US8B 2I91A 1KY5A 2VDLB 1V4VA 2CMHA 1M6NA 2QQ5A 3IC5A 5MN5A 3IT3A 1X7DA 4RYDA 5AOCA 2GN0A 3FMFA 3D7KA 3H4TA 5U4XA 2ZIFA 1X1QA 1QCZA 2Q49A 4DLTA 1JBKA 3LFUA 4QVKA 5BNTA 1Z5PA 1A4XA 1JPNA 4L8WB 1Z0AA 1ZRMA 3FZGA 5T8KC 1ISFA 2J4DA 4D80A 5AP9A 3RVDA 4ISBA 1IN6A 1O08A 2GN1A 3BFJA 5B30A 1QIIA 2XE8A 5HDBB 1O95D 1NPDA 5EMHA 1GZ4A 1WUTA 4MI3A 2W2KA 3GNTA 2QTWB 2R8RA 4GYYA 3WRXC 4QQRA 4KWTA 4QJ4A 3N05A 2M2IA 5I9LA 3K71B 3E3LA 3VH3A 3PWTA 4JBHA 1Y9EA 3DE1X 4FYWA 3S29A 4JCOA 4B79A 1V43A 1XHEA 4EKEA 5B2EA 3D31A 1VHTA 3AEZA 1IWOA 4TS9A 2GHTA 1X7YA 1Q1AA 5D7NA 1EM8A 4C03A 4K40A 5E8JA 2C5EA 5JJCA 1SIUA 1PD1A 2PX3A 3AVPA 3ORHA 3JQ7A 2O2CA 4HYEA 3QVLA 3MXOA 1RC0A 1LSJA 3P0RA 3EBOA 4JBXA 3H5VA 4KXQA 4S1PA 1TUBA 2YR0A 1VLJA 4J29A 2VRCD 1PTKA 4UPEA 4C14A 2L42A 4DY6A 1P2UA 2VHCA 1CJCA 4Q39A 3K94A 1GU1A 3H1GA 2VP3A 4BAUA 4DW8A 3QWAA 5AJTA 2QIPA 2I66A 4X95A 1WPXA 4PYRA 3SVZA 1PEYA 4C6RA 5BUZA 2ZWOA 2GILA 3WTBA 1MNAA 2VPWA 4EYGA 4HDNA 3LQ1A 5ELLA 2XRFA 4BPRA 4MEJA 3ZYCA 2DPMA 1MDBA 1EGQA 1ZIPA 1ZOPA 3GVIA 3OH8A 1GY8A 1FBNA 2CSUA 3EYWA 3PL1A 4FYHA 3VJLA 2QAIA 1S2OA 3LK7A 2ZSEA 3PE6A 1VCNA 3ND5A 3Q72A 1U0OC 2Q5HA 5EEGA 3W8EA 4Y1GA 1D4OA 3GEDA 3HCPA 5FUVA 5DWDA 4CT4B 2BEWA 4WY8A 1ISRA 4XWTA 3W2TA 5IBCA 2YRWA 5CM2Z 3UJPA 1LLFA 5HZHA 3JD4A 3I1JA 3QA9A 1R8JA 1K1EA 2J48A 3FD8A 4OI2A 4G3XA 1TK9A 4OI1A 3MT7A 2GPTA 4OOEA 4DUGD 4EW3A 2C4HA 1K6JA 1ICIA 2CFCA 5DE3A 3VH4A 3KNZA 2PFSA 1PN3A 1SB9A 4D56A 1K7SN 4G5OA 1RHQA 4X20B 5IAGA 3UMBA 1QAMA 2V8BA 5MGNA 4NZ9A 5C5CA 5EKTA 1JB1A 2DY1A 3WADA 3ZHTA 4Y7DA 5HRCA 5G0UA 2ORIA 3ZD8A 4YN3A 1DBRA 3H16A 4UE6A 4ZPXA 3L7CA 4X1OA 3TCNA 3AVVA 2R5FA 3RWMB 4YPVA 1F2UA 1MT3A 3EQ2A 3VNRA 4DLVA 4BWFB 5EL0A 1SM4A 5FH9A 1KI8A 1U4SA 3KEGA 3HP4A 3SF8A 4PN7A 5BR8B 3I6BA 2PXXA 2YQ4A 1RQNA 1OA1A 3H8SA 3AI7A 3O2QB 4MRPA 4TV9F 5ADHA 2Q0QA 2R8BA 2Q8QA 4D2IA 2VT2A 5I7AA 2AZMA 4L0CA 1OCEA 4JB2A 2CHGA 4WMLA 1LV8A 1STOA 4BE4A 4D9FA 3LCUA 1KYTA 1TJNA 1P2BA 4MIKA 2KE5A 1HDOA 2YV3A 3DMHA 2QT1A 4ZRMA 1V96A 2HCFA 3PFFA 3HY3A 2IHKA 4KIFA 3FFAA 1P3Y1 3TAHA 4ZDKA 2IZ0A 1ZY2A 3MJCA 1X1TA 3HACA 1OBOA 4PCVA 4QD3A 2ZUEA 1A96A 1DBIA 2O5VA 3KJQA 1GCOA 3S7TA 3EVAA 1DJMA 1F2TB 3HVKA 2EHDA 2KSQA 1TC1A 3NWJA 3P45A 3EFEA 3IALA 3OBBA 1I3KA 4N6OA 3O8QB 3ZJVA 4CEIA 3GCZA 3OFJA 2IIVA 1U9YA 3EZLA 2L19A 3CRW1 4HNAA 1RRGA 3X1MA 4F56A 4PINA 5EMJA 2JZOA 3OT1B 1RI3A 2BDUA 5E3HA 6ADHA 3FPAA 3IJEB 4IFEA 3KU1A 4DTIA 5J4KA 4UUMA 2B9VA 4ARZA 1JFFA 3V4VB 1NRWA 3GDGA 1W47A 1XD2A 3B7WA 3OOJA 4WFKA 3ABSB 4NULA 5DISB 3WYFA 3FDJA 4HBZA 3I09A 3DKIA 3I5UA 3IAHA 3GROA 3GXBA 3PJFA 4EITA 3R9WA 5F3RA 3O3CA 1WCV1 2ET6A 3D6VA 3JZAA 3R2JA 4YRMA 1YK0A 2B1QA 5PNTA 3D3WB 4EO4A 4DB4A 2G8NA 2VDQB 2XE6A 3VVCA 2WM8A 1KH1A 3DAPA 4J0CA 1L5NA 3WMEA 2WTMA 3EA0A 1G41A 2VUIB 3EDOA 5SYAA 3CF0A 1DNPA 3V4SA 1RAFA 4PO8A 2X4DA 1S4MA 1T5HX 1W52X 4QUAA 1GQFA 2IPNA 1FLNA 4IFIA 4ZAGA 4B4UA 5LZ9A 4CM6A 1FSPA 4RU1A 5THQA 3VVBA 3AETA 4HAYA 4QOHA 4NSNA 4Z3DA 3ZI0A 4AMYA 4CR6A 2FKAA 1HE8B 4XKJA 1YASA 3DOOA 4Z0PA 4UNRA 3V8NA 2D1YA 2DY0A 4H7DA 1DG3A 1NQXA 1ZN7A 3DE0X 3DL7A 1WAMA 3LZCA 5EFOA 3WYAA 2CB0A 3RGWS 3SVLA 3LUGA 3VYTB 2O8CB 1VJDA 3KKNA 1N6RA 3D7MA 3IP3A 1G8YA 1OAOA 3BCUA 4ZZ0A 5BURA 1YVDA 5HW0A 1WDTA 4DIOA 3IEKA 4CFZA 2Q4BA 3THWB 1I6WA 1E58A 3N2YA 4WZBB 1ODTC 4A5SA 3CTMA 4EI8A 5JZBA 1RFGE 5JDCA 1SXPA 5JZ9A 5B3KA 4HGRA 2CFTA 3DAGA 5T57A 2JAHA 5HE9A 3OZEA 3NH9A 4KUHA 2HK6A 3II6X 3NATA 4OI4A 2OA0A 4ZYVA 1F0KA 5BSVA 4U63A 3QPWA 4CCWA 2FP3A 1FJGB 2H1IA 3EB9A 1KDRA 3O8NA 4UTXA 4EY4A 4DZRA 4KPGA 1XJ5A 2JH8A 4K6OA 4KJXA 3S1LA 4A82A 3R1IA 5IUKC 3MJFA 2GAFA 3H5TA 1JECA 1Y4UA 4XA8A 3HCEA 2SKEA 4ENVA 1BGXT 2XYHA 1GLGA 3PUIA 4DBZA 4NV3A 3RC2A 4NV1A 4QBIA 1YIAA 2OCDA 2I1WA 3KJHA 2YZ7A 2DGDA 5LB4A 5JSHA 2VO1A 3ZWXA 2AN9A 4ZQCB 1YZFA 2D0PB 3L05A 1ANKA 1XKQA 2FW8A 2O0KA 4NARA 4FB5A 4H1WA 4X44A 4AO6A 5G53C 1WHSA 2WKQA 3DT8A 3KTAB 1LNQA 4JP2A 5DWQA 1NSYA 2QGFA 3WL6A 4NR0A 1A95A 4Y1EA 2VCEA 1HM5A 5MN4A 4NCHA 5HJEA 1UDBA 4XW2A 1XDBA 1SKAA 2C4MA 2ID8A 1GPMA 3GLQA 1O9HA 1H9AA 3QITA 4FHZA 4O4HB 5BQ5A 1H4SA 2FPPA 3C48A 3REFA 4IFTA 5AHOA 1H0KA 3FZYA 3JQGA 5T4EA 2ONZA 1DAPA 3ML1A 5C7OO 1PEAA 1ZK3A 2KYRA 2EERA 2Q07A 4PRKA 4DIMA 4E4TA 4MWSA 5A2QA 5DNWA 4M9UA 2IOFA 1DWQA 3U4CA 5LU9A 2VQSA 1VL6A 3EWAA 3TIIA 4F21A 3ZU3A 5I7RA 2UXCB 2Q50A 4BKMA 4WERA 2VJAA 5EFZA 5FWYA 4EW2A 2AHRA 4WADA 1KJWA 3E9ZA 2C4TA 2GJ9A 4ZI2A 1O0CA 2GAJA 1BHO1 2YMPA 3EISA 4IJUA 5IU6A 3A2KA 1Z82A 1OZFA 4CM4B 2O8BB 4R9RA 2FPLA 4ZQGA 4ER6A 3VR6A 5I9MA 4WQMA 3MJ4A 2OZEA 2XD4A 1YKFA 1X9IA 5LOVF 2EZ9A 3TGPA 4JLUA 1Z17A 1Z7EA 4L5JA 5CVDA 2NU8B 2IZZA 4HCJA 1R88A 1VP9A 2PZAA 4F5WA 3ZDXB 1X7WB 5JXGA 2YV1A 1CD5A 1P44A 1XWIA 3G2MA 3L46A 3JWEA 1KS2A 3GGSA 3SXJA 4LJ8A 5LLSA 2V7BA 4XRRA 1KZ7B 2FGJA 3EDCA 5KYKA 1D09A 3T3GA 3KPUA 2OAP1 4MRNA 4YAOA 2VJMA 3H19A 2CHEA 2RAVA 4KQCA 1H4VB 4QQNA 2E4YA 2VNIA 2VXYA 4GOKA 1JBEA 1VSUA 1YIOA 2VZ0A 4PZZA 3NM4A 1MAWA 2RAUA 2GJKA 2UZIR 4R6XA 1Z4PX 4TMYA 3ZE6A 2CNBA 4KB5A 4U7GA 3UWDA 3D4IA 3HB7A 3R5JA 3VYWA 3ZZUA 5JCXA 3KPVA 3WNZA 5JCPA 1ORVA 2BWJA 2ZWIA 4YIKA 2WNSA 2ZRFA 3HB4X 3ZGNA 4B6FA 5L3VA 3B1JA 2G0TA 1PQPA 3JRXA 2R62A 4JHXA 1XRQA 1XC7A 2ZRKA 3RK1A 5JANA 3OQMA 4QREA 2W2TA 4FMPA 3AR7A 2VYVD 3NCHA 4G6ZA 3S7ZA 4TXNA 4EW6A 3LWNA 5CW2A 1TPYA 2O0MA 3L41A 3PF9A 2OAQ1 4ALLA 1XOIA 3A7DA 4GX1A 4KTVE 1FXUA 1BXRA 2ECKA 3EPRA 4P3OA 2E89A 4LJYA 3LYUA 4K28A 5EE0A 3OE5A 5AOBA 5I3CA 1H2ZA 3IILA 3WB0A 1A9XA 1AHHA 3RFCA 3K0AB 3U40A 3OTGA 3NR2A 5J47A 2X7JA 2FA9A 4MWGA 1I6KA 5EUQB 3O0DA 4LF6B 2W8ZA 3U3MA 2BCJQ 1G66A 4HJRA 3MK31 3RI3A 3W5IA 3UW3A 1ZK0A 2I62A 3W5CA 5K05A 2ZI4A 1CJVC 2C7BA 2ENUA 1CRWG 1QNFA 1UAGA 5F78A 3P9RA 5CVCA 1IMJA 3CX7A 1GUBA 2OV1A 2ODBA 3H05A 4ZOLA 1HDXA 4RHCA 4M46A 4ONEA 2W6IA 3V9PA 4MLZA 1IN7A 2I7VA 2NQ2C 5CT5A 3WWEA 1Z16A 1O6GA 5IVDA 1MQSA 2AXQA 2CJXA 3P9YA 2ACEA 2CCGA 1BNCA 3EQ9A 4MINA 1V1MB 3NKLA 1ZD4A 2NT4A 2FWJA 4AVYA 3IO3A 1K8YB 1MVNA 4ZAVA 1SHZA 2VSYA 2YHIA 1C50A 1JAIA 4RVFA 3ZIDA 5DX1A 1VHWA 1C1DB 2FSFA 1M75A 1QQTA 2ADOA 1GD1O 1BW9A 1RPNA 2R3SA 3CY6A 3NGXA 4G4SO 4ZCLA 4TWAA 3WL8A 1IK6A 1QB7A 1RAAA 2OB2A 4B46A 1LCIA 4WJLA 4DV1B 3FNQA 3FCYA 4WCVA 1WVGA 3DVAB 3QTBA 3JQAB 5AI6A 3ENKA 3RF6A 3T9AA 2HRRA 5EYPB 5CFNA 5CNJA 1S3IA 4F4CA 5L53A 4KWEA 3QRWA 2CMFA 4IJMA 4J49A 4TWRA 3LSYA 1FDVA 1MO2A 2AR0A 5EJ6A 1NQUA 5IVIA 3MMPA 3SQMA 3JQAD 1I24A 4FHFA 4RQAA 4D82A 3QY9A 1AHPA 2NN3C 4RTRA 2HRZA 2AFVA 2H54A 2JFQA 1GSOA 1EAMA 4XOIA 3M4ZA 4H15A 4ZICA 5AW6A 1JKJB 2IXTA 3MUEA 4LRTB 1PFVA 4MW1A 1UPTA 4AMZA 2Z6VA 2F1JA 4N5HX 4MYUA 3D1JA 2J0QA 1NVVR 2FR0A 5ER9A 1WBDA 2ZZMA 1JXAA 4OKSA 1J8VA 2A0WA 4OIMA 3ZWAA 5CA1F 4W6QA 3LX8A 1YS4A 3MQ4A 2EX1A 4ZOCA 4CBVA 1I4LD 5B4TA 2Q3MA 1FS5A 3DULA 4YR9A 1EHCA 3AYXB 3T3DA 4ENPA 2ONKA 2ZIWB 4K87A 4LTMA 3K2IA 5EPUA 3BILA 5AKGA 2DPXA 1KHHA 2O4UX 1M2EA 2GPYA 4ARZB 2VUHB 4WUVA 2DAPA 3VHRA 4O4IA 1RYEA 3WMRA 4CEHB 3N2GA 2XAUA 3HLKA 2E6KA 1IN8A 3FI0A 2F59A 1TO6A 3LYAA 4MPRA 4PV7A 5ALJA 3TFWA 4F8YA 2Q5QA 1YFLA 2ERYA 1I2BA 5KUTA 4G0MA 3DNMA 1HZJA 5ALPA 2I54A 3CEAA 1E79D 2DUJA 3A2NA 5KVVA 3NPAA 5ADVA 3TX2A 3FGNA 4AG5A 3IBFA 2AF3C 2NAPA 2QI9F 2K4MA 4MQMA 3VR5H 1CBUA 3CLSC 3WHIA 2J1LA 4F4IA 1QZXA 3CUYA 4C6SA 4P0QB 3DP9A 4M76B 1A8PA 4JBYA 2G08A 3UJ9A 2NGRA 2NZYA 1JDUA 2IP1A 1QRRA 1TM3E 2B1JA 2O2SA 5DK4A 5BN3A 5LVAA 2WJYA 1PFYA 3C3XA 2FMUA 4LHVA 3PYXA 2XDAA 2GN2A 4FOOA 1ZM4A 5JIBA 3WMFA 3SSMA 2W8BA 1WXHA 4HMQA 4X6LA 4LSMA 3ZWQA 2OLJA 3O1JC 2XA9A 1OV4A 3ASVA 3F8WA 3ROKA 2NO5A 2VHUA 2FMIA 2H11A 2PT7A 5FL7A 2HNKA 3T6KA 3WIEA 3TZKA 3INYA 1YONA 4MQBA 4RNCA 4O3FA 3ETLA 2CEAA 2H4YA 2DTEA 4HZGA 2J67A 3JQ6A 4TKVB 5H3CA 1AF4A 1SA0A 1ESCA 4ER7A 1CZOA 2PWYA 5AKLA 4P98A 4CL2A 1WUIS 1UK7A 1U6JA 2YMLA 2BEKA 3BOSA 3EEBA 3ZWWA 4ZI7F 2PSFA 5BRAA 1QQ6A 1A5TA 5EIXA 1Y37A 4X7PA 3KKLA 3K09C 5IN5A 3N0VA 3UYLA 2P78A 4RZUA 1PR6A 2OK7A 1JDTA 2PRIA 4FQ8A 4C7XA 4JGGA 4DHEA 2XB6A 3KL4A 2Q1WA 3T3MB 3OY7A 4B4KA 5DBGA 5DHAA 1RXIA 2IE0A 3EEYA 4F38A 2O8NA 1O87A 5LP6B 2JHGA 2P9HA 3JYLA 2BJWA 1T24A 2I29A 2P4HX 4WFIA 2HF9A 2EFJA 5E7MA 3WBBA 4C05A 1JSZA 1XRNA 1LEHA 1MT0A 2QUAA 1WV1A 3ORQA 5C1DA 1E9AA 4DV0B 2D4AA 3PSHA 1ENOA 3LUBA 4RTPA 2FKNA 3UY4A 4D4IA 5G4KA 4B71A 5K0CA 1EFVA 4PAWA 1YO6A 2W2KB 4G9BA 2NVWA 4YCAA 3IT0A 1SAYA 4YRNA 1AC5A 3ZDAA 2JIBA 2IXFA 3PFGA 2ZI6A 3GAAA 4H2DA 1XEXB 2CY0A 1V11B 3C6YA 3QQ5A 4V0LA 4MB2A 4D99A 5GMOA 4GKVA 2G0AA 2NVUA 4OYRA 1A4IA 5F2EA 3GPBA 3T0IA 2P6UA 1GL6A 3ZGLA 1RYDA 5LLDA 4EM6A 3ISTA 4R8LA 5KSPA 7MHTA 4QZVA 4Z4FA 5JBNA 2I03A 3LSTA 1RJGA 1BIFA 1IHPA 3IP5A 3KC2A 4U00A 4K0KB 5CDYA 1ABEA 4Y1RB 2VJKA 4JYBA 1VPEA 1D6NA 2HMSA 2ZJOA 4BQNA 1T0HB 1T91A 1ZA2A 2A58A 2YL2A 4IH1A 4J16A 4OJNA 5INTA 1K6EA 3QBTA 3FKJA 2AV6A 2OO5C 5HEKA 3F4BA 4BTVA 1H42A 1K08A 4Y6OA 1KJJA 3PUYA 3VHLB 1PEKE 1IPFA 1XA4A 3WRXA 1ZCBA 5LXTA 1OPRA 4U9UA 3B8HA 3RFVA 4J75A 3AOGA 3TCKA 2F4NA 2R96A 1ONPA 2KPOA 2ZRGA 2YQ5A 4I9HA 1S7CA 3F8SA 4FGUA 4QVGA 1CK4A 4RSMA 4YJ2F 1RKVA 3CEJA 4MRVA 4LQ4A 3LC7O 1QFYA 2Z83A 4E3ZA 1OI2A 2ECOA 1CRLA 2O0HA 1H8HA 5ECGC 5JW6A 4OREX 4YRJA 5TVKA 5IUJC 4G8CA 3ONFA 4WKNA 2WFZA 1GCGA 4LZLA 1Y7TA 3C43A 1HORA 4QPZA 5MFZA 3OFKA 2FR1A 4P83A 3QLUA 5HMMA 4GI1A 4G4IA 4S35A 3TXAA 3X1JA 2Q4TA 4LF9B 4FNAA 3U48A 4YQZA 4AJ9A 4FBMA 5JNVA 2RGRA 3E70C 2KI5A 3FDZA 5CLFA 1EUQA 1SU4A 3G23A 4JSRA 4JIMA 4KLNA 4ZEWA 2C07A 4ECAA 3ZEAA 8ATCA 2JEOA 4TZTA 5GGXA 4EPWA 1H3NA 3ME5A 1JW9B 1E5LA 1T9AA 2IF0A 5H0IA 1SXQA 1KYVA 1HDYA 3PNVA 2O0JA 1NVKA 2B21A 1X8KA 2GKOA 3OIUA 4NBTA 4TSKA 1I1QB 3CC8A 1T9GR 4OL0A 2R6AA 5HCNA 1AD2A 4C22A 1GCUA 3SZRA 1YB6A 2GTIA 2F3PA 4DCSA 3TW0A 2HX1A 2B1GA 2QQEA 1X7ZA 4PPYA 1AZTA 4NXMB 1DC5A 5BW5A 4HEA6 1M72A 2XF2A 3PXCX 1T2VA 3M4XA 4HWSA 2IV3A 5JYEA 4R5HA 3FVQA 1Z34A 3EZXA 3ZCUA 1EP3B 1QK3A 3MINB 4D3XA 1MTOA 1R3DA 4A4DA 1N2JA 1WKCA 2A9FA 2P69A 4MCJA 1O4VA 2Z3WA 3DTTA 3QE9Y 2G83A 1DEAA 3B1FA 4KAFA 4PYIA 4RV9A 3FBGA 3OX4A 2OXEA 4CPDA 5IP5A 2HDOA 3DV0A 3GOHA 3NTVA 1XDUA 4H35A 4GOOD 3QE0A 3IB3A 4YC7A 1HQDA 3HN6A 4TL7A 3WZLA 1XTSA 1Q17A 1DG1G 1VKOA 1Z15A 4KX5A 2OCAA 3FETA 3WVNA 5TT1A 3DEYX 4EFDA 2A2ZA 1BQ4A 5TE9A 1UBMS 3T9FA 3OZVA 1M2KA 3WK4A 5L4SA 3RYIB 3K4PA 3CZQA 2YJ3A 1LVUA 3DBLB 5CIQA 2J6HA 4MVJI 4FMDF 1RHRA 2WKPA 2CD9A 2NUPA 4B7XA 4IYJA 2QGNA 1FCJA 3NIFB 2VTEA 2I76A 3KQWA 2R87A 4EHFA 3IJPA 1MG5A 3UAYA 3LLUA 1E1LA 1UM9B 2WIKA 4H3KB 5U4QA 3AM4A 4FFVA 2XQVA 4OMCA 2OV3A 4D4JA 3CZCA 3I9KA 2DFLA 221PA 4L9RA 2OFXA 1PT5A 1KAEA 4RZHA 5LZ2A 2BBWA 4FYVA 3A6PC 2QIOA 2VPTA 3FSEA 3H6KA 3FMIA 3LRPA 2D6FA 2IT1A 3LIIA 3PPWA 5HUQA 1X7GA 1MIHA 3LRTA 2HDNB 2TS1A 3GARA 1E5VA 4EHDA 3NTUA 3HBAA 3AOEA 3M3HA 1Z83A 1I51A 1I13A 2DPLA 1L4KA 2FV8A 3DTVB 4ITRC 3UICA 4ZRDA 1OB5A 1ISMA 4D3DA 2GA8A 2ZDQA 4QUEA 1WQ1R 4HFMA 4OB8A 3WGTA 3KSUA 3S8EA 1GSHA 1JXOA 3PC8A 4RLHA 4EYEA 3AVUA 1N2BA 5GGYA 2J3QA 3LF2A 1RQLA 3TIGA 1CR4A 3EIXA 3H9CA 3OD5A 4LHYA 2B34A 2FZCA 3MB5A 4RY0A 3UMJA 2UVDA 1ULTA 4C43A 2O1EA 3OF3A 3ZBQA 4FR0A 1Y0BA 2FW9A 4H7HA 4MVJM 3TMKA 2EFCB 3QA3E 2BUCA 4IG9A 1GPH1 1AKQA 4TYMA 3BIWA 5JNLA 4QXPA 5FNVB 1YTUA 4LG1A 1MHTA 1J4AA 3NBQA 1U2EA 3LKBA 3H04A 5HKKA 5ENDA 5HYVA 2I65A 2OILA 3H8WA 3MW8A 2QP9X 4M99A 3LPNA 1DIHA 1EPUA 4V3CA 1XMSA 2XKJE 5C2JB 3E9CA 2JGEA 3UHAA 1G9SA 3MIIA 1YBAA 2IHNA 3QVGB 4GRAA 2VWHA 3U3DA 2XZDA 1H65A 1GPNA 3MAJA 3BGSA 4R69A 1M67A 4U7DA 3AU8A 2IYTA 2J32A 4UU0A 1QGDA 3OTOB 2VDVE 3CF4A 3BFVA 4YACA 3IQWA 3STVA 4HFJA 1NVDA 5IKPA 4RCVA 2OV2A 5CD9A 4DADA 3ETCA 3USCS 3ICVA 4ID3A 2EDAA 5EJ4A 2HYDA 1XXHB 2NXJA 1TYAE 3W34A 1R9NA 4II2A 3SJBA 1HYHA 1NV9A 2QJFA 4AJOA 1PL7A 4RS4A 1NNUA 2PSHA 5JAZA 1ZJWA 1QG6A 4GR4A 2WIDA 3KKPA 2XB4A 3ABQB 2BN4A 4JELA 5E1BA 3HEBA 1DTSA 5KNDA 3NGLA 2I4IA 2AJBA 2IYUA 3FUUA 2A5YB 3HADA 2W6QA 3LVQE 2GTPA 1NOKA 4FDLA 3ID6C 1P5HA 4Q34A 1U3UA 3GLGE 5K09A 4OLJA 3JD1A 5I7UA 3Q7TA 2BISA 3UAZA 5G0TA 1AQLA 3S8MA 2HSWA 4Y0AA 2H51A 2CZGA 3B52X 4F5YA 4C0KA 1JJAA 1DZ3A 4L85A 5AVSA 4XAQA 3Q87B 3GLHB 4CU2A 3EGEA 3I9OA 4LPSA 1JKFA 3MM4A 5I9IA 2CLSA 5CA0A 3H99A 4CM5A 2MSCB 2QMQA 4GE3A 5KWJA 4JROA 3W5BA 3BWCA 2A5FA 3GJ0A 4W1RA 3CLRC 3F3SA 3WP1B 3RYIA 1GPLA 4MQEB 4Q3OA 4UVEA 4ZMRA 1S8FA 3OCWA 4Y2TA 4JXJA 1SO8A 2AUNA 2NUPB 2RHTA 5JS2A 1EEXB 1UMCA 2ZYWX 1KQ3A 4OL9A 3CCFA 4FZ3A 3RUIA 3RU2A 3TLGB 2X3UA 3DWIA 1F6BA 4HDSB 3TOXA 5FFFA 2X5OA 3C5WP 4I3FA 1TVMA 1E4EA 1ZHOA 4E2ZA 2L17A 1M1XB 2QRVB 2BMDA 4NFYA 1PR1A 1Q3HA 5BNWA 2ZIXA 1UH5A 4LF8B 1M6VB 1C41A 2DBZA 3UFXB 3BIJA 4DR3B 1G5FA 1EVIA 5L6LB 4DPLA 4FBLA 3PUKA 2RIPA 1YNOA 2NPFA 2Z5VA 1CJKC 4M1TA 1MX1A 3RBXA 4C4OA 1O95A 4YBZA 1ONBA 1SK9A 2FN8A 4CM4A 3FPEA 4KK4A 5DHPA 1F7UA 1HYEA 4XJVA 2C8LA 1JHUA 3OZWA 5FUXA 2CLOB 1MABA 3KVOA 5CR9A 2W6PA 1XDZA 2YJ5A 4L08A 2OB1A 2FN9A 2WIBA 5A62A 3CH4B 3MJSA 1VSVA 3BRWA 2ZAOA 2JAWA 2JCSA 3VDNB 1AIPA 4C2BA 1KTIA 1FOEB 2HI0A 2JHCA 4KBGA 2ZR8A 1U1IA 1IPEA 3BQNB 3ORSA 4NZOA 2H2DA 5EXTA 1YRBA 4EG3A 3C98A 4IVPA 4ZZ1A 2COEA 1A9QA 1R0XA 2X1LA 4I1RA 1RPJA 3K35A 4HQFA 5KMGB 2GVDC 2C1EA 2RGEA 3IUJA 4ND5A 2IPMA 3JV7A 4M3NA 1XQYA 2WWGA 5L9AA