4P32A

Crystal structure of e. coli lptb in complex with adp-magnesium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
234
structure length
234
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p32A00
4KITB 4L9SA 3MMPA 3P1JA 1P2TA 4DUGD 1ONBA 5KYKA 3GPLA 4FCWA 1N6OA 3SJAA 2ZI6A 1RZ3A 3LW8A 2IYWA 1D2EA 3RRZA 3ZS9A 2RB4A 3GP8A 3GJXC 4EPTA 1I4TD 1G7TA 4HSEA 1UEJA 2OT3B 4KFRA 4XIGS 3QKSB 5FL7A 4AKHA 2QM8A 2ZU0C 4WAUA 1HE8B 1OHHA 3Q5EA 5JSZB 4M21A 5FUYA 1Z2AA 5AUOB 3EZ6A 2ECKA 4MUAA 3EWSA 3IILA 4NCHA 4KSCA 2YVUA 4FCTA 1E1RD 5E7IA 1E9BA 2OCBA 3P26A 1Q21A 5FUXA 4DZZA 3BJIC 4QNRA 3MG9A 2F3TA 2YWEA 1E0SA 1Q44A 3A37A 2C77A 3Q9LA 4PXAA 1AN0A 1G5PA 3AF1A 3IPYA 1YU9A 4XVRA 1WBBA 2GDJA 4MGYR 1W49A 4LYHA 2IWRA 3CH5A 3GLGE 1FNNA 1FQKA 3MWLA 1TQ2A 5LD2C 2ZJYA 1QHHA 4D25A 5FL7D 2OLKA 5EQTA 3EPLA 4B48A 4LJYA 1G64A 3NEJA 4JVMA 3UK6A 3OIWA 2XAUA 1N6NA 2ZM5A 4UNRA 3KQLA 1JAHA 1J7KA 1ZM4A 4FINA 1XZPA 4LV8B 4JBXA 2VSOA 2IUTA 1VIAA 3AQ4A 4JS0A 4PHFA 4PPNA 4C0KA 1KZ7B 4UKDA 1OIXA 1DAIA 3R9XA 4P4UA 2OG2A 1DARA 2FSIA 4X8MA 1LTQA 1JPJA 1VCOA 4YQFA 2C9OA 3GLHE 1RRPA 2MSDB 3NDBB 4MYUA 3K9HA 2W6IA 4Q9JA 2CJWA 4MITA 1TADA 4K8OA 4TLAA 1TUEA 2GXAA 1VYUA 3BS4A 3RRMA 4L16A 4HZIA 3THXB 4HYYA 4LBZA 3T61A 3CPHA 4GOKA 4DLZA 1U2RA 2FGJA 1FMLA 5KTYA 1XDBA 5EE3A 4YDHB 1RRFA 5JJKA 1IM2A 3KFVA 3D3QA 2J7KA 1Z07A 3KXIA 2GJSA 5IDVA 1KI4A 4ITRC 4TMXA 3DHWC 3RABA 5KNBA 4MUBA 4DCVA 2Z6VA 2GF9A 4US2R 4PQYA 3EZ2A 3CRW1 1IN8A 2CVHA 3UANA 2W0MA 1W44A 2QT0A 5KSYA 1VHTA 4XSGA 3MWKA 2AHOA 3X1XA 5A4JA 3T1QA 4NU0A 2Q21A 1CR1A 5KSOA 3ZJYA 1LS6A 5CB8A 2O0HA 5AJWA 2WWIA 2AWNA 2FX3A 2ZJ2A 1JAIA 4JL5A 4R2HA 2XGJA 4QFMA 2QQEA 5BN4A 2EW1A 4CGZA 1Z3IX 3K0EA 3SR0A 4BFWA 3IIMA 1V43A 3AKYA 3TLXA 1PJRA 5B58C 3M0EA 5EXSA 1BKDR 1CJMA 3S1AA 3ECCA 1E79A 2EQBA 3GLHB 3I8XA 4URYR 3F3YA 3MSXA 4OHVA 1NRJB 2JJ1D 2KI5A 4OJQA 3AP1A 1DAKA 4NCIA 3WMGA 3BBPA 4KI0A 4TT3A 5FR2A 4A8JC 3OZXA 2NOAA 2ZREA 3TVDA 4HAZA 1KI9A 4L4UA 3OIVA 2F43B 2GRJA 3VHLB 4M1YA 5JS7A 2DY1A 3Q7PA 2MSCB 3B13B 4LYFA 2Q9AA 821PA 2EFDB 2IYZA 2VA8A 3LNCA 1ELOA 3RS4A 3UMRA 1G21E 1VG1A 2ODNA 4V0ME 1NVVR 1Z2CA 4RVCA 4IJMA 1DG3A 2CL6X 3AVWA 3RS2A 2WWYA 3OEED 5FTMA 2AXPA 5EJEA 1Z8FA 1AM4D 1Q1ZA 1NBMA 3AV0B 1ZCBA 3BFVA 3SDZA 4P32A 5SZHB 1W0KA 2IS4A 2CBZA 1LVGA 3QOFA 4DLXA 3LFUA 3RWOA 1RE0A 5DI3B 1K5GA 1T6NA 4R9UC 4UNSA 2ZE6A 3GCGA 1G8HA 521PA 2EVWX 4I1UA 4YMTA 2ODBA 4NTZA 3SYKA 4TLCA 4V03A 5FPHA 2ZSDA 1TU3A 1HTWA 1JQJC 1KOFA 2NG1A 2AD1A 6Q21A 1R5NA 1MRSA 3C5HA 5KOYA 1F2TA 3HJNA 4TL6A 4EJSA 2B21A 3KKPA 1OFUX 4C0BA 1KJWA 5G40A 1VMAA 3HYRA 4ZDJA 3U61B 2ZVPX 1KI1A 3MFYA 1GKYA 1XTIA 4RFSA 3NC0C 3ZZUA 1G7CA 1W4CA 1NBMD 3VQTA 1S3SA 3KZ1E 4EJSB 3SQWA 1X86B 4A36A 1KDRA 2WJIA 4IOLA 1HQYE 1E2PA 1ZUNB 2PBRA 4PO8A 1BYIA 4C0LA 2AX4A 3IHWA 5J5CA 2D06A 3QIAA 4OQNA 4B3GA 4ZCMA 1Y3AA 4CEHB 4NZYA 1XPUA 2EFCB 5FBVB 1ZM7A 1NF3A 2FNAA 3CNLA 3PENA 1Q0UA 4LV6A 1E9AA 4US1R 4CRWB 1F3OA 2O8CB 1U99A 4DCTA 1FW6A 3KJGA 1H65A 1JJ7A 4I81A 1T91A 4IOMA 4HDCA 4KFSA 4BZXA 1FZQA 4U00A 4QKQA 1A2KC 1P7CA 2WKQA 2HF8A 3CWZA 3K0AA 2Z4SA 4ZCLA 4J0QA 1P3JA 2RGBA 4JLNA 1D5CA 3CIOA 1E0AA 1FX0B 4LJ9A 3HU1A 3SHWA 2GNOA 1YQTA 3AVVA 4HAVA 2HUPA 4BEBA 2ZAOA 3RWMB 1Q1QA 5HCIA 4MRRA 5TVKA 4P4SA 4DT1A 4TQUS 3A4LA 1CJKC 3Q85A 1VPLA 5D3MA 1J8YF 2VBCA 2W0SA 3FVQA 3U44A 4TSFA 2D62A 4Q7KA 1OW3B 2RMKA 1OFHA 4PC7A 3EZ9A 4EPRA 5EE0A 4LJ7A 1TPZA 1TUIA 1J90A 2XB4A 4HB2A 4MKFA 1KZGB 5L3RA 2FH5B 3C7KA 4MDFA 4Q4HA 4QRHA 1VKJA 2ODEA 4PZYA 3A4NA 2RHDA 5CLQA 2CHVA 4M1WA 4N0DA 4X8LA 3I3SR 4B73A 4RZXA 3VNVA 1G5TA 4JJZA 1DG1G 5DN6D 4BLQA 4URWR 3IO3A 1UPTA 3LX5A 5JEDA 3TGPA 1FMJA 1OF1A 5JEEA 4HZUA 1DO2A 3Q8XB 5GJWC 5JI3E 3WRXC 1G17A 1A5TA 1M2OB 4B3CA 1OT3A 4ZI3A 1G19A 1E2LA 2YINC 3LBNA 4DCUA 1VCMA 3SBDA 2YWGA 1KO7A 4I99A 2GESA 3QENA 2XNDA 4LBYA 2IX3A 2NTYC 1GAJA 3KKNA 3K0FB 5IF9A 3LW7A 2IYUA 3HPQA 1J99A 4RCZA 3BC1A 5AJVB 3QXCA 4IVRA 2AXNA 4F93B 1JI0A 1OV4A 3DMDA 3GLIA 1Q3HA 1YVDA 4PAOA 1G3IA 4QJ3A 2D7DA 1P61B 4XH9B 5EE1A 2VHTA 4LPSA 4NYJR 4B34A 1CU1A 3QG1A 1UBCA 4DVGA 2RGAA 1JR3D 2VTKA 4BLTA 1KKMA 4XJXA 2OEPA 3CB4A 1QG2A 1ANKA 3K09A 1KGDA 1SVLA 3W5JA 1E2IA 1XTKA 1E0JA 3AGPA 4WBSA 3EWAA 4Q1AA 1XPOA 5JCZA 1FUUA 5BN5A 4LDJA 2CJWB 2B92A 4P31A 1VCNA 4KVGA 4W5HA 8OHMA 3K0CA 3FFAA 3AH8A 3ZIAD 5TDHA 3TUIC 2H7VA 1E2DA 1KI8A 3B1ZA 4M22A 3IQWA 4PANA 1L7VC 1NMYA 1ZIOA 2QMUA 3B85A 2BMFA 2FSFA 5EE5B 4D0NA 1KNQA 1KI2A 5M04A 1X8LA 2V7QA 4IEEA 5LB2A 4IKEA 2NMVA 4GSYA 1W36B 3B5JA 1ZC4A 4CYMA 3KTAB 3QPUA 1GP2A 2GK7A 5JCPA 1T0JB 2QORA 2J7PA 2FMXA 2OXRA 4R2IA 4PX9A 3EIEA 5DYGA 1XJ0A 4PZZA 2BIFA 4PPGA 2QPAA 5FPTA 1VYTA 2QAGA 3TUJC 3AUYA 4MRPA 1M7GA 1SXJE 2MSEB 2EWWA 1T8UA 3K53A 3RC3A 2A5JA 1G20E 4KAXA 3OFND 5BYJA 2A3RA 1P62B 3K8YA 5CDFE 3GLGB 4NH0A 1MO5A 4DSTA 3KQNA 2WKRA 2ZRFA 5JWRA 1FTSA 1HYQA 2IBMA 2VP2A 1PVOA 1TQ4A 1I2MA 4ZDIA 2VP9A 2FEOA 5TXGA 3LH5A 2VHCA 4NYMQ 4PSKA 2C5LA 5FPYA 2D74A 2NPIA 4Q1CA 4Q4AB 1CRPA 3U3MA 4BLSA 1P75A 3BE4A 4V02A 4DC9A 3SJZA 4HLCA 3UATA 3TK1A 4H1UA 2IHYA 2ZI5A 4C4PA 2FFBA 1ZJ6A 3TAUA 2NQ2C 3ZGXA 5AWFC 2HT1A 3I92A 1E1QA 1NN0A 1SKQA 2EFEB 2WWFA 1W4AA 1G3UA 3C5CA 5F9HA 1ZU5A 3NWJA 4NYIR 1DAHA 2GEUA 4TYQA 1MOZA 4Z51A 3B78A 2IF0A 4B44A 4QJ4A 3LVQE 1QHHB 5DN6A 2G1KA 2NGRA 2HT6A 3BOSA 4FMBB 3L2OB 1WF3A 3GJ6A 1DS6A 1YZQA 5KU1A 2QBYB 4E07A 4M9SA 2QM7A 3OAAD 1DBSA 3DPUA 3L0PA 4C9BA 5L8VA 621PA 1YR6A 3CONA 2DWQA 4Q9KA 2SHKA 4PZLA 2OM2A 5TB5A 4P4TA 2Y8EA 4D0GA 2XNDD 3ZS8A 4OK3A 4EKDA 1OXTA 4KLZA 3SQXA 1R4AA 2BMEA 3P20A 3SYNA 4KFTA 4TTPA 2J0UA 2OILA 1VTKA 1NG9A 4C0HA 3K70C 4OQFA 1LY1A 1BIFA 2G83A 4CEIB 5LDDC 4I1VA 1VDZA 4QXAA 5IHPA 1KNXA 3B9PA 4QGAA 4D4LA 2DFNA 1HQCA 2DPXA 4V0MA 2QE7A 2QRNA 2P2LA 4OL0A 4RD4A 4CT5A 1HT1E 2H17A 2O52A 2XNSA 5SZIA 2ZS9A 4F4JA 1NBME 3TQFA 1U81A 4PQRA 4N0EA 1DADA 1OXUA 4O2LA 5AR1A 1F48A 2ORWA 2ZTSA 1VECA 2Q0HA 3DEFA 1OJLA 1S9HA 3U4QA 3X1YA 1EESA 2PMDA 2VIIA 5EZ6B 4MYCA 2JAQA 2GZDA 1NG1A 4OQXA 2CMKA 4PC2A 3X1WA 1YHNA 5HZHA 4A2PA 5EP1A 1CKEA 4FMCB 3I5YA 3LQQA 1G8PA 2GILA 1Z6XA 2XXAB 4ZIRB 2RGNC 1IY2A 2VH5R 2C04A 2J7PD 1EFUA 2GXUA 4O0MA 3A1TA 4DLWA 4M1OA 2BWJA 2I1VB 1XEXA 3FTQA 2WMOB 2KB0A 4DDTA 1HE1C 1Z0IA 4ESHA 4Z8YA 4B43A 1IJEA 3L8ZA 3H1TA 3LA6A 4BFUA 4F7WA 3OFNA 4RD2A 3LX8A 2FPLA 4XD7D 3Q5DA 2DCUA 4DWJA 4NE2A 4Z8XA 2GJ8A 2G3YA 3CM0A 4IDOA 1XX6A 4DEYA 2H8KA 4M1MA 2XTMA 3BFKA 2NO9A 4HLDA 1IONA 4DLTA 2VP5A 2QQ0A 4B2LA 1G4AE 1Z08A 4K81B 4A1FA 1OH7A 3AUXA 4PSAA 2WWXA 4B3BA 2G0TA 2ZUBA 2WAXA 4B32A 1G8GA 2WICA 1JEEA 2ZJAA 2WV9A 1MABA 1B0UA 1SGWA 3SBEA 5IRCD 2O8BA 1N5JA 5E95A 4YXWD 5CIWA 2BBWA 4MDEA 3ND9A 3SI7A 2P6NA 2RCNA 3BH6A 3FPAA 1S1MA 1YZNA 3BAFA 2ZRDA 3MWYW 2V6JA 1DAGA 3W6NA 4XD7A 3SFVA 3L82B 1F60A 2BMDA 3EW9A 3TRFA 2JATA 4FW9A 3KKOA 1XXHB 1XEFA 4NCKA 2XZLA 1RVDA 2QAGC 3VU9A 5JJIA 4A8JA 2IK8A 1ZP6A 4GI7A 4YMWA 4W9MC 1ZRHA 1XB2A 1RRCA 1F2TB 4Q4JB 4TL9A 4ZDKA 4GP7A 1KI6B 3AF2A 3ETLA 2BC9A 3W3AA 3R7WA 3CRMA 2OHFA 3F0TA 3W90A 5B57C 3I62A 2QGZA 4QL3A 2D4HA 2JJ1A 4HLQB 1OFTA 5ANRB 2ERXA 3FKSA 3BORA 1YKSA 4W5WA 2WWHA 1HV8A 1G8YA 4OI2A 4B71A 2P5TB 1KK1A 3IPXA 2F6RA 2BBSA 5AJZA 5JI2E 1HA3A 2CE7A 2QEQA 1E2QA 1CJUC 2ZRLA 3IDQA 1UKEA 2HYIC 5SZKB 2JLWA 1SZPA 4MGIR 2REBA 1S9DA 3CLVA 4BEJA 4LHXA 5KHOC 1SQ5A 2FEMA 2ZRMA 4ON9A 2FFHA 1ZW6A 4ARZA 1TEVA 2BHRA 1EK0A 1XTSA 1SKYE 1XD2B 3BWDD 4FI3C 4X8OA 5C46F 2AFIE 3IQXA 2GTPA 1G16A 2ATVA 3K9LA 3AVOA 1GG2A 3OEEA 3G0HA 2FFAA 4US0R 2GCOB 2PX3A 2QE7D 1CXZA 4L8GA 1P9NA 4GDFA 3N70A 4HAXA 4GL2A 1ETUA 1YJ5A 4CW7A 3TJZA 4BUJA 2W2TA 4JLPA 4D4MA 5FFMA 5DNYB 1RIFA 2YV5A 2R6DA 1IBRA 5GVRA 2G88A 1WE2A 3THWB 3LD9A 5EZ5A 1OH5A 5J4VA 5AJXA 1XTRA 4TYYA 2O0KA 3QBVA 1QHSA 3PEYA 2ZSFA 1EFTA 2PT7A 3GMTA 2CE2X 1GL7A 2R2AA 3BH7A 3HR7A 3PQCA 4JZKA 2AL7A 4U02A 4JLKA 1JJVA 1A7JA 4L9WA 2VHUA 2GHIA 1BMFA 3GFTA 1PV4A 3PEVA 2V8OA 3JVVA 1YR7A 1C4OA 1S2MA 2XITA 3NXSA 1HUQA 2CHGA 3EC1A 5FI0B 4BLOA 2J45A 4QC2A 1U8YA 4EPWA 2ZXUA 4BFTA 1XEWX 3V4RA 1LNZA 2IT1A 1E1RA 1GRNA 2HYDA 3O8BA 2XB2A 1OKKD 3WHKA 2J46A 4M2LA 1NN5A 4AYWA 3ND8A 2QU8A 2I4IA 5DLQC 2G0NA 1FFHA 4RJLA 1U9IC 5BW8A 1ZD8A 2OCPA 2QZ4A 5DIFA 2IF2A 2BEKA 2IHBA 4FMDB 4DBLC 4BPBA 4FCVA 4IHQA 4OHZA 3WY9A 4R98A 2NZJA 4B74A 2X19A 2YKGA 3H2YA 2IYXA 2R8RA 3QPVA 1S3GA 2RGGA 4LGMA 5J4KA 1R0WA 4PC6A 4QBFA 3PR1A 4Q18A 2ZRPA 1W48A 4LPKA 4TMVA 3U3JA 2H18A 2J59A 3W8RA 1IXRC 2ZANA 1ZYUA 1KK3A 4EJSC 5KUTA 1E9CA 3PIRA 4Q4JA 2REXB 4YXWA 2Q3HA 1UBEA 2ATXA 2B8WA 3GLFA 2AK3A 3U3RA 1XXHA 3FDIA 4MGZR 4PHGA 2V4ZA 3EPKA 2PJRA 4JLJA 4MKGA 3MD0A 4RY2A 3U7HB 2G77B 2CK3A 4FN5A 1AZSC 2QTFA 4IDPA 2AWOA 3M1IA 3M4YA 3O8RA 2D7CA 4EUNA 4AD8A 2N42A 1ZNXA 3CH4B 3L0SA 2WWWA 3KQHA 4EFNA 3P27A 4W5JA 1ZIPA 2FN4A 4GOJA 3NC1C 2O8DA 1GTVA 1OXVA 4QHYA 5FPKA 1E2MA 1QVRA 4AKGA 2IYYA 4CDGA 1UF9A 2KSQA 3FKSD 3SJCA 2WSMA 1AQUA 1KY2A 1F2UA 3WNDA 4GMXA 2W2XA 3Q3JB 3TSWA 4PO1A 1P2SA 1II0A 1OIVA 2BJWA 3C4JA 5J4HA 2PEYA 2NO0A 1SVOA 2JJ2A 3H84A 2FWRA 2ZETA 2E1RA 3DZDA 3T1VA 3QF7A 3BERA 3ASYA 5G3ZA 2GZHA 5FTNA 1ESNA 5KDDA 3ASZA 4BFZA 1RPZA 2OO7A 1OIWA 4D4KA 1QHNA 3U2QA 2C2HA 3BIFA 4LUCA 4RZUA 1CR4A 4N3NA 5HCNA 2BEJA 3C14C 1NVUQ 1UJ2A 1EFRA 4PC1A 4TT3D 2XXAA 3AP3A 5JRZA 1DTSA 2CHQA 2L0XA 1S96A 4GOXA 1RJ9A 4ACBA 2DR3A 3N2EA 3KQUA 5D3QA 4Q9LA 4TQ9A 2BMJA 2RAPA 3VR1A 4Q48A 5BQ5A 4V0OA 4LC1A 1MT0A 2C98A 4HATA 2GEDA 2ZJBA 4BE7B 3KDSE 4UJ5A 1KDOA 4OHYA 5B64A 4GZMA 1E4YA 1XEXB 5KSPA 2VSFA 3LXRA 2Q3FA 4ABYA 3GLGA 1OXXK 1YE8A 2FF7A 3L8YA 3MJHA 2J0QA 2H5EA 2A30A 1NLFA 5FH9A 3K0FA 2FU5C 2B8TA 2J41A 1OKKA 4JKIA 4LRWA 1EGAA 1FPMA 3KFXA 1CBUA 4V0NA 3LVRE 3A1VA 3U4QB 1G7RA 3QI2A 4IEIA 2F1JA 2ZPTX 4B35A 3QEJA 2OFWA 2YC2C 3IBGA 3IUYA 3SYLA 5TMPA 4B47A 2D2FA 1TF2A 4XVUA 4XWOA 3H4MA 1XPRA 1GOTA 3HU2A 3HWSA 3K09C 2BM0A 3P32A 2IXFA 3RRYA 4LYAA 1IOZA 1JB1A 2FZ4A 4WZAE 2ZR7A 3LLMA 2ASEA 1P72A 2ZJOA 3DO6A 5JWOA 5HE9A 2ORVA 1NVWQ 3F5FA 1SULA 3FMOB 2JLYA 4KODA 4CEIA 4RSGA 2OSBA 1HURA 3GQBA 4NPHA 4OKSA 3TH5A 2J9RA 4QNMA 1X8JA 3A1WA 1IJFA 1XWIA 1R5OA 1XCMA 1Z06A 3TUZC 1LW7A 3HP1A 5E3HA 5FUVA 2A5GA 1P60A 5EP3A 2V9PA 1R0YA 2CK3D 1ZNYA 2W83A 4TWZA 1KI7A 5FTLA 2GJAA 3CRVA 4G5OA 3JVUA 4Q1DA 1NIJA 2KBEA 3AVQA 4QBIA 3R9IA 1GL9B 1IAQA 5DSZA 1P2UA 3PUYA 2CLSA 2IS6A 1EX6A 4Q03A 4MKIA 3AF4A 2DHRA 2NO1A 2RKOA 3AVPA 4RD6A 1E6CA 3MWJA 4ASUD 3A1SA 4TLDA 4YMUA 1JR3E 1T4GA 1WXQA 2B7CA 5CYPA 4C7OA 4Q5IA 1IXSB 2NPFA 3PV0A 4B2IA 2P3SA 1OB5A 1S4QA 2ZRKA 2WSSD 3OF5A 3OIYA 2K5UA 4LOAA 4NCJA 3THXA 4TZ0A 2BV3A 4C2TA 2JJ2D 3CX7A 721PA 1GITA 1FTNA 5DHAA 3E1SA 1KI6A 3CPEA 5TY0A 4Q1EA 1N0WA 1GNRA 1QHXA 2W58A 4NMMA 4DDWA 5KPDA 3SFZA 1W47A 2EYQA 1TMKA 5AK0A 5CB6A 4RFSB 5DHFA 2VQSA 3WP1B 5EXTA 2VRWA 3FE2A 4ZCIA 4BGDA 4JLVA 3NG1A 2E87A 5HZKA 1Z0JA 1UKYA 4QBHA 4C7OB 2OAP1 3ADKA 1EG7A 3DOFA 1CS4C 3TNFA 3PEUA 5CK4A 5H68A 5D3MB 2O5VA 1G3QA 2JLVA 1KAOA 1G7SA 3E70C 3BD9A 5FOUA 4Z1MA 1LF0A 1NN3A 5HTKA 2LKDA 2ZUCA 3LWNA 2BJVA 5AJYA 5DYIA 3D7MA 3SS8A 3UXMA 1XD9A 2GEVA 4NONA 5EP2A 1Z6YA 5CJ2A 2ODWA 1U94A 2QAGB 2ERYA 5FBWB 1CR0A 4HDOB 2ZRHA 2DFLA 1E99A 1DAFA 2ZUDA 3TR0A 4IXNA 4HI0E 2OFOA 2GBLA 4H1VA 2RGEA 4WOPA 3U60B 1UKVY 1RYHA 3BB1A 1ZU4A 4HLUA 4TN1A 1NMZA 4Q1FA 3ZD6A 1XJQA 5KPJA 4RCYA 2R44A 2ZRCA 2AD5A 1XU4A 1Z0FA 4M9ZA 5CM8B 4C30A 2F7SA 2BOVA 4LCBA 4Z1MD 4OJKA 3EZ7A 2EYUA 3SN6A 1HH4A 4R71A 1ZUHA 3FFBA 5CM9C 2GCNA 4M1SA 3FOZA 2A78A 1PLLA 4UNQA 1W46A 4PSVA 3OESA 5TV2A 1U8AA 2WAYA 3AGQA 4BZQA 3FGNA 4TTRA 3KJEA 4QGGA 1MO4A 2C96A 4MA4A 2LWIA 2ZU6A 2O8EA 3O8CA 2CNWD 1N25A 1O3YA 3MLEA 3Q7QA 3VX3A 4O3MA 1YZUA 3X2SA 4Q7LA 2HLDD 4MRSA 1D6JA 2WWGA 3FKQA 3HDTA 1R2QA 5E7JA 1YZLA 2PL3A 2A2ZA 4HB0A 4XSHA 1JECA 2WPDA 1DO0A 4EPXA 4KYIB 4RD0A 4S35A 4BQSA 2OLJA 2ZYVX 5JHHB 3GEEA 3SHFA 3DM5A 3VMFA 1W2HA 2DB3A 1E2EA 2AKAB 2CDNA 3MGCA 3B6EA 1NJGA 2FSHA 2QP4A 2WZQA 3EIHA 3RSOA 2HEIA 3KB1A 4Q4AA 2AKYA 1W0JD 1E2JA 1CEEA 4MH0R 2CNWA 3CW2A 2ZRIA 4JBWA 3ONWA 4PFSA 2DFKB 4RD3A 1T5IA 5FPSA 2YOFA 1QHIA 4EFLA 221PA 2ZSAA 4F92B 4OQMA 3TR5A 3UIEA 2QSZA 3RDPA 2FDCA 1NL3A 4LJ8A 3TSZA 1M6NA 3GJ0A 4KBFA 4PHHA 2WPDD 2PJZA 3THYB 4B3FX 1M8PA 4QJ5A 3VU9B 3CUEF 1JALA 3KX2A 3VFDA 3ZZTA 2ZVQX 3RS3A 1G18A 1EFCA 4K46A 4U7DA 1C1YA 2IYTA 1W1WA 1US8B 3FWYA 2J5XA 1QRAA 3SZRA 1X1RA 3OE7D 1HT2E 1GUAA 2IEZA 1NVVQ 3K9GA 4A0HA 1W0JA 4GNKA 2QNRA 4C3ZA 4DLSA 2WMNB 2ZI7A 3NKVA 4R7ZA 3W34A 2JLUA 3KL4A 5BWMA 3B9QA 4CEHA 1TAGA 4URXR 1PLJA 3VX4A 4JLOA 1JXOA 1NVXQ 1L4UA 1FP7A 2PH1A 3QF4A 4NBSA 1YZTA 3B60A 3GLIE 5UKDA 1IHUA 3WNBA 1XCPA 2WOOA 2DBYA 3OAAA 3J81k 1AS2A 1G291 1BOFA 2PLRA 2KBFA 3KJHA 4JT2A 2HCJB 1GRQA 3CPJB 2HF9A 3PITA 4DCSA 1KMHA 4XTCS 3QKUA 3REFA 4IOKA 1G6OA 2HXSA 3FMFA 1O87A 4P0TA 3UMFA 1KO8A 2GETA 2J0UB 2Q9BA 1W4RA 1FP6A 4OHXA 1GM5A 2J3EA 2IXEA 3I73A 3GFOA 2PZEA 3G5UA 4Z54A 2UZ3A 2VO1A 5E4FA 3W6OA 4Q00A 4OQLA 1OSNA 1WMSA 1ZUIA 1MV5A 3WXMA 1Q22A 3FMPB 4ZV4A 2BBTA 3TSOA 2ZSEA 2IWHA 1BMFD 1N6PA 4F4CA 4M9XA 2W6JD 4C0JA 3RRNA 4F38A 3NBXX 4Q19A 1SKYB 3SEAA 1WRBA 3ZDQA 2J0VA 5H70A 4UXIA 2XZOA 3CNOA 2ANCA 2A5DA 1DEKA 3ZH9B 1NY6A 2VPPA 4DRZA 1NSTA 1T9HA 3W6PA 3C41J 1RC8A 4Y0AA 3WYFA 2AR7A 4DLVA 121PA 2GBLC 4A0FA 4HB3A 3QXSA 4DDUA 2ZI3A 1AJEA 3D8BA 1AGRA 1CP2A 4DSNA 1ZINA 4JIMA 2C03A 3ICEA 3AM1A 1SXJA 2YOGA 1ZC3A 3HPRA 1U8ZA 5C4MA 2JLXA 1AGPA 3GLFB 1V5WA 4TYPA 3NBZC 1R5BA 1DAMA 1B23P 4TLBA 1M7BA 5EUQB 3DM9B 3BFXA 2C99A 4D2IA 1D2NA 1FNMA 2GVDC 4DSUA 2JASA 1XMVA 1E9EA 2WIAA 1C9KA 2ZJ8A 3WYGA 1RRGA 1K5DA 5IK2A 3B1YA 4TZ6A 3ADBA 1Z63A 1W36C 1XF9A 4B2PA 1II8B 4P4SB 1KDPA 2CCJA 2F1RA 3RVBA 2F55A 1G6HA 4GPTA 4GP6A 5JSZA 4MKHA 4S2EA 2OUKA 2REOA 4IRUB 4DCNA 4DXAA 1QG4A 4I1SA 3RS5A 4DDVA 4B33A 4YLGA 3ZD7A 5FOXA 4RKFA 3A6PC 1E9FA 1F5NA 5BN3A 1A82A 4A92A 4DSOA 4FD2A 3KXKA 1XRJA 1IN6A 1CRQA 1XFAA 3R8CA 4HUQB 4QGHA 2X1VA 1MKYA 1KO1A 1E94E 1Z0AA 2YC4C 1X6VA 2MMCA 5K8LA 2DWPA 5J4LA 4JLMA 5IT5A 3LBHA 2RGCA 3AP2A 1YRAA 3EG5A 5KDOA 3ZVLA 2OESA 3EC2A 4CF7A 1K8RA 2X8AA 3UG6A 1NY5A 3B2EA 4ZI2A 2B6HA 3TE6A 1UBGA 1JR6A 2IS2A 2X77A 1R7RA 4KJZA 5EE9A 3RAPR 1OH6A 2R62A 4D82A 4DIEA 4LZZA 4PO9A 4JVNA 2J87A 2AK2A 1KI3A 2ZRGA 1KO4A 3RANA 1GIAA 1LF5A 4AG5A 4LYJA 5HR5A 5KNCA 3K70B 5KNDA 1ZD9A 3VHXA 3OEHD 1UADA 1NSFA 1A2BA 1L2TA 4Q1BA 2KWIA 2FFQA 1XMJA 1R10A 4A0RA 3RS7A 4AURA 1P5ZB 2F9LA 3DZ8A 2VHJA 3BXZA 1JEDA 3SE0A 1FL9A 4PR0A 1Z6GA 2UVQA 5JRJA 3HU3A 4QM6A 2GWHA 2BM1A 2ZYWX 1GZSA 5ELXA 2YYZA 2F1IA 4TMWA 1IY1A 2IYVA 4A6XA 4OK6A 2XZPA 3R9WA 1N3BA 3QJYA 5DO9A 4RKEA 1N6IA 3KJIA 2E9SA 2A5YB 4AKEA 4AYTA 3KUCA 4PPFA 1OFIA 1YR9A 2CCGA 3K0SA 2YNMA 2UZIR 2PT5A 4V0LA 4CEJB 1S1CA 2VHQA 3BK7A 4RZ3A 1OB2A 1D9XA 5KDLA 1MH1A 1T5LA 1MABB 2JEOA 3ZLJA 1P9RA 5EXPA 1G1MA 4LHZA 2R6AA 5GJCA 4BFSA 4URVR 1W2GA 2IUSA 5FBLB 4MYHA 4KSBA 1P4SA 4DJTA 4C0AC 4PQFA 2IS1A 2YWFA 3AB3A 3HR8A 1II8A 2HXYA 1UM8A 2CCKA 3GLHA 5BXQC 5JS8A 2AN9A 3P4YA 2OV2A 1PUIA 2VEDA 2PCLA 5FL3A 2WHXA 3H86A 5HKKD 4JSYA 4IXMA 2QPTA 4BFYA 2JLZA 4URZR 5F3WB 1KMHB 1T3HA 4NHOA 1D9ZA 2FV8A 2JLSA 5FTJA 1J8MF 4QHTA 1QDEA 4QM7A 2F9MA 4D0LB 4JVSB 1A4RA 2VSXA 3QF4B 4OYHA 1RW4A 5SZJA 4B6FA 1TQDA 3PUWA 4L15A 1EWQA 3KQKA 5J4YA 3E2IA 3IBYA 4ACAA 3VNUA 1VHLA 3FHTA 4D6PA 3EARA 2W2VA 1DPFA 2PEZA 2ZIAA 3U3KA 4HUTA 5L3VA 1N6KA 4BLRA 4KFUA 1NI3A 3A8TA 5EXXA 4HB4A 1KJZA 4QG7A 3QXHA 4CEJA 4FMCF 3LLUA 5HPYB 4ESVA 1UFQA 3NIBA 4JSTA 3U7EB 1JNYA 3ZQ6A 1NMXA 4JL8A 3EXAA 2O0JA 4PPQA 2J0SA 1KY3A 4PAMA 3VKHA 3P4XA 1Y63A 4M53A 4UQOA 1GRRA 1OYYA 2GXQA 4MRVA 1AS3A 2XTNA 4ASUA 1QF9A 2XTZA 1N6HA 4IW3B 1AK2A 5FUWA 3CF0A 4D4JA 2O8DB 2GKSA 3THWA 4G0NA 2C9YA 3CZQA 4D81A 3UPUA 4TL7A 1G3MA 4DHEA 2WSSA 3VR5A 5K8TA 1DELA 1SVMA 1UAAA 5H8WA 1P6XA 2VF7A 4LI0A 4FWIB 4EPYA 4Q9IA 2KE5A 3U6KA 2I3BA 4RZ2A 2ZR9A 3VKGA 4OBEA 1UBFA 5C18A 2PX0A 4AG6A 1X8KA 2VL7A 5AUQA 3CBQA 3LRPA 2OCYC 5F98A 3K9NA 4B3XA 5BYKA 4AY2A 4CZ2A 3NVAA 3WHLA 1E98A 2JDID 3I32A 2I1QA 1XTJA 3L43A 3AEZA 4JYBA 1OLOA 1E2NA 2A7QA 3E5HA 4AK9A 3VR4A 1XBTA 2Z0MA 3BH0A 3IEUA 3KB2A 3T1OA 1OH8A 4PTLA 1KSHA 3NEYA 2VF8A 4KLNA 2BKEA 1MRNA 1Z29A 2GJ9A 2QG6A 2EFGA 3IKJA 5JZVA 2DYKA 2VP6A 3X1DA 1Z6TA 3MUFA 4KCGA 3IEVA 3PUZA 1GDDA 2RH5A 3TW8B 2XEXA 4M4SA 1S8FA 2XX3A 1MR3F 3UWKA 2QL6A 1OYWA 1NN1A 1XEWY 3A1UA 3TMKA 3R20A 2R6CA 4BFVA 2QA5A 2C8VA 1G4UR 1MO3A 3W3ZB 1G3RA 1NKSA 3GFPA 3SOPA 2N46A 2F43A 3O8DA 1OE0A 1GNPA 2IYSA 3G82C 2JDIA 3ZVNA 1W36D 1QZXA 1ZBDA 4YC7A 5FBRB 3T1TA 4PC3A 1AA9A 2QSYA 2A9KA 3CWQA 1KO5A 1XJCA 1EFRD 3NTUA 2WJHA 4LJ6A 4DLRA 4BASA 2CVFA 3S1AB 3AVTA 4Q7JB 3WMFA 2QRZA 2LKCA 2XJ4A 4DT1B 3GEHA 2C95A 1ZAKA 2BCJQ 2DWOA 4FIDA 4A9AA 3QE0A 1JBKA 2OAQ1 1WQ1R 1NJFA 3I72A 4IOJA 3HYTA 2D2EA 1EFHA 2P6RA 1PZNA 1NIPA 3U3OA 4X8HA 3ADCA 5EUMA 4TMKA 5HKKA 4V0KA 5KSZA 1UDWA 2CL0X 1UDXA 2CLCX 2ZITA 1XP8A 5F2EA 1SHKA 1RFLA 1N0UA 1KAGA 2HLDA 2QGNA 4JL6A 4E03A 5G53C 4DKXA 4ZPXA 2IC5A 4TL8A 2QUZA 3DDCA 4KVAA 3T12A 1VG0B 3T34A 1LS1A 1XTQA 3MAAC 2O8FA 5L3QA 2H16A 2QTVB 4TMZA 1E4VA 2XSZA 1IN4A 4ZO4A 3IGFA 1EX7A 2OFXA 3PUVA 2XOKA 4M0LA 1JPNA 1PLKA 3IHLA 2R6FA 3VTKA 1Q57A 3TBKA 1NLYA 3RLFA 3PEWA 3A58B 4DIDA 2OZEA 2PZGA 3QKTA 4P3YA 2W00A 2GJKA 2FG5A 5CIQA 4FWTA 3GJ7A 2FA9A 2ZE7A 3X1ZA 4LBVA 3SJBA 4BFXA 3PJRA 4Q02A 3T5DA 1U98A 4MQBA 3ZQJA 2H92A 4KO8A 1F6BA 3RHFA 4LSGA 4A6PA 5J40A 3LBIA 1P2VA 1UEIA 5JMTA 4EIWA 2QT1A 1W5SA 2X2FA 2H1LA 4BWYA 4EAQA 3TW4A 4A0GA 3DVLA 2OBLA 2C9CA 2IYLD 5J47A 2XSZD 3QKSA 2HV8A 1G41A 1RKBA 2GCOA 1WBDA 3B7GA 5LBIA 2WJYA 5DISB 1E2FA 1W0KD 5CK5A 3GJ8A 2ZRAA 4Q21A 3B1XA 2QAJA 4IFBA 2N1BA 5CYOA 4DUGA 2O8EB 2WJGA 4XWKA 1Z6AA 3QVUA 1CLUA 5K8IA 2V3CC 3DL0A 1GL6A 1GWNA 5B2ZA 1E2KA 1GNQA 1ZMXA 5FOVA 1OXSC 4WZ6A 4BRWA 2V55B 3M6AA 2GZAA 2QPOA 5CLLA 5CITA 3CKLA 3CX6A 5GADl 2WIBA 1WA5A 2TMKA 2ZEJA 1E9SA 1H8ED 3I8SA 4UXHA 2IUUA 1Z5ZA 2WJVA 3A4MA 3EPJA 3CR8A 1HEIA 1NNEA 3QEOA 4G01B 4O25A 1XMSA 3QXXA 3JZAA 5JJLA 3QVVA 3TQCA 3D31A 2ZAMA 4XTRA 5G41A 2YJTD 2QY9A 4Y0VA 3QKRB 4ERNA 1MO6A 2PZFA 1E2GA 3N5CA 3EAQA 4NL4H 2MMGA 4JLAA 1J70A 4O2RA 4A8JB 4N1AA 4ILEA 5GVSA 1G5RA 3SU8A 3ZVRA 3C15C 1M7HA 1W4BA 4UNPA 2OBNA 2HJVA 2Z43A 4MRNA 2G9NA 3WYAA 3A36A 5FOWA 2JCSA 1KYIA 4LV5B 4JLBA 2KJQA 2O8FB 4WXPA 3WBKA 2ZJZA 2FPMA 2IYQA 2Q3MA 4A2QA 3RC8A 1TNDA 1UKZA 1BO6A 1J2JA 2EWVA 2DFTA 2OBMA 2GAAA 2ZSBA 1N6RA 2PCJA 1TF7A 2QN6A 4HUQA 1E9RA 2QROA 1N2CE 4DB4A 2CXXA 1IN7A 4HEJA 2V6IA 2D3WA 1N5LA 5DGXA 4YONB 1U0JA 2YOHA 4TTQA 3NHAA 4LBWA 2VYFA 3K0CC 4E5UA 1G9XA 4TSFD 4M8NE 5CDFA 2X2EA 5JECA 4TYNA 1U90A 4GMDA 3NH6A 3U7FB 1N5KA 1SXJD 3V00A 2W6ID 3PG5A 3T35A 2RGDA 1AQYA 2P0EA 2VP4A 3GJ3A 5K8UA 3QG5A 3PXGA 1WDTA 1IQPA 1KSGA 4G5SA 4GFDA 2ZS8A 3WMEA 1AKYA 2FJUA 5GJBA 3AVXA 5IK2D 1QVAA 1S0UA 3I61A 5JLJA 1FUKA 4OI4A 1QHYA 1QHGA 4JVLA 4YMSA 3V9PA 4ZIRA 4AKIA 4NYIQ 3GD7A 3TKLA 3W9YA 4DLYA 4OK5A 2EFHB 2JLQA 3WNCA 2ZE5A 3KTAA 2EU8A 2A5FA 1Z28A 2NO7A 1R6BX 3NBFA 2WKPA 4G5RA 3ZZ0A 4QGFA 4TQAA 2GXSA 4XWAA 2HDNB 3D6TB 1TTTA 5JFGA 1KTVA 3DKVA 1K6MA 1BH2A 1D8TA 5L3SB 4A4DA 2VLIA 3IIKA 2FSGA 2HCBA 3R8FA 5LD2B 4W7SA 4A15A 3AF0A 1R8QA 3TVTA 1ZM3A 3Q72A 3VAAA 1F2UB 4ZKDA 5DI9A 1JR3A 4LHVA 3UMSA 4URUR 3LV8A 3BB3A 3W5IA 1RYFA 1VCIA 4CVNA 4NYJQ 5GJVC 3U6BA 3MCAA 4WXRA 5C4GB 3QUSA 2Z83A 4KXFB 1US8A 4EQ6A 3I5XA 4UJ3A 4NDZA 1XZQA 3EA5A 4Q7MB 1L4YA 2QENA 3PVSA 2QP9X 3QBTA 1KJYA 3CF6R 1TEXA 4KU4A 2YZ2A 4LJAA 2ZRNA 2Q6TA 2GK6A 4WW0A 1AKEA 4A2WA 2BKUA 3ZIAA 2OE2A 3C8UA 1ZCAA 4BLPA 3DOEA 2GF0A 4OHWA 2R65A 1Z22A 1H8EA 2WBLC 1GILA 2YWHA 4JBYA 4RFVA 2JA1A 3OEHA 3EPHA 2P5SA 3N2IA 3B8HA 3W8NA 1E9DA 2CL7X 2ZYUX 3AF3A 3K70D 5FTKA 1FQJA 2ZRBA 1Z83A 3OE7A 4HZUB 5DI3A 4GRAA 1GKUB 4NCNA 5F9FA 4JLDA 4AC9A 1E2HA 2G1JA 4LX0A 4XVQA 1I4LD 4IDNA 3BRWD 4AYXA 1KKLA 2WOJA 3VR3A 1KDTA 3VR2A 1M74A 3EASA 5C2JB 3IO5A 3RS0A 4BRUA 2C78A 4NKRA 3EA0A 2BDTA 2H57A 3VR6A 3WRYC 4UXJA 3UWOA 1SVKA 2R9VA 2CEAA 2ZJ5A 4WVFA 4TYWA 1T8TA 2Q9CA 2WM9B 3CRRA 3KUDA 1WCV1 2ANBA 3FYHA 4DEXA 1Q1BA 2ZI4A 5A5GA 1SVWA 2P67A 1EWRA 3B1WA 1E69A 3I4LA 2ZS7A 1HY3A 4I1OA 1XD8A 4I4LA 421PA 1VIYA 2IW3A 4HAWA 4EFMA 1ZNZA 1T0HB 2J1LA 3CZPA 1GFIA 4C0SA 3F8TA 1VYVA 1WP9A 2QP3A 1LB1B 2NZ8A 2Z5FA 1Z0DA 4NYMR 3WBJA 1YR8A 1XNJA 4PHTA 4WA7A 1Q20A 3LAWA 1R8SA 4B75A 4DB2A 1COWA 2JIZD 2QTHA 5G3YA 4POAA 5AUPB 5L3SA 1CTQA 2FGKA 4H9GA 1KHTA 1VG9B 3QXJA 3UKDA 4QBGB 1AZTA 1X1SA 3CNNA 3FHCB 2W6JA 2F1HA 3AKEA 3L0OA 4E22A 4A82A 1SVIA 3NBYC 1LV7A 4PAQA 3CX8A 2FZLA 2ONJA 1FOEB 3DMNA 2ZR0A 1CULC 3NHBA 2WJJA 1CJTC 1G8FA 3KKQA 4AIIA 3KXLA 4XOIA 2ZRJA 4CT4B 4AWXA 3FHOA 4Q01A 5FI1B 2UKDA 3LQRA 3RSLA 1COWD 2JIZA 3K1JA 3SC3A 5CJPA 4P33A 5AUNB 1N6LA 4NP6A 1I2DA 2VP0A 4JMPA 4Q9HA 2JJ8A 4JKYA 4B3DA 4B6EA 4EQ6B 4M1KA 3C16C 4LJ5A 5JBQA 3LDAA 5FOTA 1I4DD 4ZKEA 4GT1A 2NO6A 3CF2A 1DAEA 1XCGB 1A1VA 3AKDA 3REGA 1N5IA 2ZQ5A 3LXXA 2P6UA 1SVSA 3UG7A 3T06B 4LK2A 1KSFX 1RJ9B 4TLEA 1ZNWA 3R7WB 2AFHE 4WZBE 4G1UC 1TX4B 4JYCA 3MJRA 2FPKA 3BB4A 1YRBA 4IVPA 3QSYA 1W7AA 2OCAA 1ZVQA 1DOAA 2GA8A 3EX7C 1CIPA 1Q1EA 4G3XA 1AS0A 2BCGY 2NIPA 3U44B 3GJ4A 4LY6A 1SXJB 2V1UA 1E0KA 3QY0A 4Q66C 4IVQA 2O8BB 5A0FA 2WVJA 4OI1A 3ZYCA 4EDHA 3PUXA 3BGWA 3U5ZB 4IDQA 1LFDB 3B1VA 1L8QA 1ZD1A 5L3QB 1T3LA 1JXMA 1VG8A 5DE3A 4KBGA 1Q3TA 4HAYA 1TL7C 1FX0A 4G5GA 1CR2A 1WB9A 3CRQA 4M9QA 1P9WA 1U0HC 5HE8A 1OHHD 3ADDA 3LO5A 5FR1A 2FE4A 1E3MA 5H1YA 2RGNA 5KO2A 5EP4A 4JT4A 1SXJC 4KYUA 3T5GA 3WP0A 3B82A 3U7GA 1D2MA 3AVUA 1XMIA 4LJ4A 5E7MA 2O8CA 3EIQA 3SNHA 2B7BA 3RYTC 2P65A 1KMQA 4LC0A 1U9IA 1AIPA 3L0IB 4MYTA 4FXPA 3TIFA 2IEYA 1GSIA 2RGXA 3CO5A 4TMTA 5JHGB 3AVYA 4HAUA 3LY5A 5TARA 4QOSA 3JZMA 4JJKA 4KHZA 3TAHA 1Z0KA 5LB4A 1GKIA 3MRSA 2ONKA 3ICQB 4M1TA 2HJGA 1E32A 3QPWA 3GLIB 2V7QD 1H8HA 4WIAA 1IXZA 2IXGA 4HDQB 4OI0A 2R6GA 1ESMA 2RHMA 1QBKC 1GVNB 2ZI9A 4L5BA 1KK2A 3NH9A 1TU4A 4C0QC 2QMHA 1XD2A 4AI6A 4FMDF 1R0XA 2BVNA 4ARZB 5B30A 2JLRA 2G6BA 2LCFA 1IY0A 3IIJA 1P73A 1YZGA 1U0LA 3DKPA 4HLUC 3K0AB 1DVRA 1Z47A 2ORIA 3I1FA 2OXCA 2QMEA 5DH9A 4F91B 3VKWA 1SHZA 4F4IA 2FOLA 1YZKA 3THOA 1M34E 2F3RA 5LPNA 1E96A 3QQ5A 4BECA 5C1BA 1KK0A 1ZM2A 4LWZA 1TQ6A 2V54A 4GZLA 3GEIA 1H8HD 1ODFA 1ZM9A 2QI9C 4G5QA 4UNNA 4C2UA 4LHYA 4YMVA 1R0ZA 5P21A 4Q4LA 1PUJA 3QKRA 3T15A 3V4FA 1X3SA 4DLUA 3QNUA 1DE0A 1M1YE 1NLZA 2V1XA 2ZROA 4II7A 3THYA 3EZFA 3RNLA 1NKTA 1II9A 4GBMA 4Q4HB 1BYUA 4MGKR 3GLFE 1XXHE 2XOKD 2Z4RA 2ZYTX 4B76A 1TF5A 2QMOA 5JWHA 4EPVA 3OHMA 3PFIA 1T3SA 2IA5A 3OIUA 3FMIA 1W5TA 4D80A 4D26A 1EXMA 3FB4A 4KV9A 2CLDX 1E1QD 4U5XA 4LHWA 5FOSA 4ZDWA 2PLFA 2BBOA 1BS1A 2IYRA 4IFEA 2WTUA 1KIMA 4RD1A 2GCPA 4CIDA 3NDPA 4Q47A 4IDHA 2QBYA 1IN5A 2GVZC 1NP6A 5FBQB 3GJ5A 2IL1A 2JGNA 3KKMA 1KSJA 4E09A 3CR7A 3AKCA 1OPXA 1JQLB 2XJ9A 4YDSA 2ZE8A 1CF4A 1E79D 1Q12A 3H0KA 3O47A 3ZVMA 3PCRB 4BZPA 2PMKA 4QHSA 1N0VC 1CJVC 2YHSA 2GAOA
chains in the Genus database with same CATH superfamily
2WFLA 1XHFA 4L9SA 5AHWA 3P1JA 5HFJA 2OHIA 3EFHA 3ZDZB 4CQLA 5EJ6A 4FCWA 2HQRA 1I1QB 2PG3A 4TXNA 5AKZA 1M6EX 4KTVE 1D2EA 2AOTB 2PJDA 4HXYA 4EGCB 3VZQA 2EGGA 3BN3A 4RL6A 1I4TD 4OREX 5EMKA 4BMOB 4BQFA 4EPTA 3LE8A 2TS1A 2J3JA 3M4NA 4HSEA 4KFRA 2O1SA 4YALA 4R1LA 1A72A 1FU7A 1OHHA 4BQPA 2AOTA 4MHTA 5JSZB 3PZRA 3LQKA 1FXWF 3QVGA 2XXJA 1DBRA 3TB6A 1R4MA 3IILA 4KSCA 3WLEA 4JYPA 2YVUA 5J3JA 4FCTA 3HJUA 1LRKA 4GOND 4Z9BA 2OCBA 5K8JB 3IP6A 4CCSA 3E0XA 5F52A 2VTBB 1P0QA 1M6HA 3VGJA 2P9GA 2F3TA 3P9RA 1Q44A 3A37A 2VYND 3ZWKA 3ZWWA 1G5PA 2NLOA 3IPYA 3R0ZA 4M0EA 3VNSA 5JD5A 1F20A 3PNQA 3IL2A 2GDJA 1WBBA 1T2CA 2WG1A 1PR6A 1PJ8A 3W04A 3NP7A 3IDAA 4LYHA 2VAWA 2W4QA 1FMCA 1SXIA 4DCJA 4QDTA 3OQ1A 1FQKA 3MWLA 1TQ2A 5LD2C 1RHMA 1Z2PX 4WNIA 4LOKA 4QODA 2ZJYA 1E4OA 5B37A 4ZYZA 3ND7A 2OLKA 1BMQA 2P40A 2Z57A 4HBZA 1AOXA 3TQIA 3YASA 5B7NA 1MP0A 4JVMA 4FX2A 3F7NA 4QUIA 3CVVA 2Q8NA 1BQ4A 3B70A 3M82A 4RX1A 4D3XA 1VHQA 1A9QA 1W6RA 2IJGX 1P0MA 3BWYA 3N86A 4PZPA 3VC3A 1XZPA 4JBXA 5EJ2A 1M0SA 1EBUA 2XCUA 3P71T 3AQ4A 4IUCS 5BVGA 4YBZA 1P1FA 3ZU2A 4PPNA 4Z4IA 1A95A 4KQ6A 4ZOCA 5LXTF 3EIFA 2XMQA 4JR2A 4K40A 4JX8A 1R88A 1U28C 1WTAA 5LA6F 2XCSB 3GJSA 4P4UA 2OG2A 2FSIA 1WXWA 3I4CA 3HI6A 4D57A 4PG8A 3LUDA 1RZRA 1J6UA 1ZESA 1RRPA 1O0SA 2VHVA 3JQ8B 1FQWA 3IQHX 2IYPA 2BW0A 3D5EA 3E6AA 4MYUA 2W6IA 3RPEA 2FPGB 1EE2A 4LOIA 2I3AA 1U3DA 4TLAA 2BGLA 4HNRA 3WIDA 4PQEA 4HZIA 4LZWA 4RDHA 3THXB 3GFFA 1T1EA 3T61A 1XLWA 5EN4A 1X7GA 3M4ZA 3E4CA 3UV7A 1P4AA 1USIA 2VDWA 2FGJA 5EZYF 3HN7A 3WIUA 1XDBA 1FLNA 1C3XA 4KAFA 4XR4A 4JOQA 5I6DA 4RTKA 3IODA 2ZWPA 1IM2A 2BONA 2J7KA 1Z07A 2JI7A 3BCUA 4YI5A 1KI4A 2HPAA 2N3ZA 5TF4A 4CKXA 3PLAE 4NK4A 4UHEA 5KNBA 1VE7A 4MUBA 4YRCA 3BSWA 1I7LA 5TMEA 1IN8A 1T5DX 2CVHA 1JHRA 3HB5X 1EA7A 3AW9A 3W3AH 1W44A 4YRGA 5LZ5A 1VHTA 2Q27A 1VKZA 3X1XA 4ZI7B 4FHGA 1AB6A 2Q21A 1K4MA 3T1QA 5A4JA 5ITVA 1WLYA 4HVAA 3WGUA 3P9CA 2O0HA 4PM4A 3H5WA 2AWNA 2EX1A 1JDBB 2YRFA 4QOHA 4QFMA 1E9VA 3KLMX 2QQEA 3WZMA 2EW1A 5BN4A 3TSYA 2X5KO 3K0EA 2JFPA 4FPXA 4IHJA 4BFWA 3AKYA 1DRKA 1PJRA 4P54A 3JW8A 1P4GA 1KQPA 3GH3A 5BSKA 5HWSA 5IBPA 3ECCA 1E79A 1SQ6A 3HFJA 3F3YA 2IPXA 1V35A 3QJGA 1NRJB 3L5OA 3D64A 2XEDA 3GVIA 1YL7A 1XR3A 1D6NA 4RTOA 5FR2A 1FDTA 4O4LF 5H16A 5IT0A 2ZREA 4TV9B 1KI9A 1PJLA 3IAFA 2GRJA 4N7BA 4YT2A 2P2GA 5TJHA 1DBQA 1JQKA 2NZWA 1HK7A 2C92A 2VP3A 2VYCA 5B58T 1JDUA 4OD0A 1NI5A 2Z2JA 3B13B 1K89A 3BA1A 1GG5A 4OMCA 3EGDA 4TVKA 3T8YA 1RAHA 1ZOIA 3WIEA 3LPDA 3LPLA 1IBMB 1EMDA 3ANNA 4OHCA 2TSYB 1I80A 2GOYA 2W6OA 3FYUA 1DG3A 2BEWA 2HXGA 2XWQA 2EC5A 3LX4A 3AVWA 2WWYA 4KPFC 4K88A 4IMJB 2HU2A 5L7YA 5EJEA 1M0EA 4GYKA 3GP5A 1WHSA 4P7FA 1AM4D 1AT1A 3KM0A 3WMXA 3BIXA 4EI9A 3SDZA 3QV1A 2ZUUA 1Z4IA 1Z2DA 5JMOA 1Q0SA 4Q82A 1LVGA 2D0IA 4DA4A 1XIVA 2Q2NA 4UD2A 3PGA1 1DEXA 1ZVMA 1T6NA 4MAFA 3H65A 3I04M 4UNSA 4RHEA 3TJRA 4TLMB 4XPIA 3GCGA 1UDBA 4YJ3B 3UNXA 1ADBA 2CJPA 4J0HA 2GN6A 2XECA 3RAEC 2CMFA 1U2TA 2P68A 4HXEB 1CDDA 3Q1LA 1M6VA 5A05A 4WOCA 1IUKA 2UU9B 5AI0A 2DTEA 4X65B 2QW1A 4TL6A 4KKVA 2B21A 1D7OA 3KKPA 1OFUX 1RHQA 3PE3A 4TWIA 4LRSB 5D6OA 1AKTA 4H2DA 1VKRA 4RVUA 4MKXA 2C5AA 2VZEA 2ZVPX 4YCBA 5EL0A 3H5OA 4MVJF 4RFSA 4CI0B 3G8AA 1JVNA 1G7CA 3RJTA 4UU1A 1DXOA 1W4CA 3HDJA 3VQTA 2GN9A 3V48A 1SBCA 5AVQA 3FTEA 1P2DA 3RIYA 3NETA 3OQHA 4MCJA 4IOLA 4I9GA 1ZUNB 2PBRA 1P3Y1 3O4HA 3V7WA 4UU7A 1R0SA 4LJLA 3LQ4A 3RSFA 2J5BA 1NQTA 1OBCA 3IV7A 4NXMB 3GOHA 4AJOA 1XPUA 2EFCB 3IQZA 1ZGHA 1GQSA 5COQA 2J9XB 3PZBA 1GJRA 4O2AF 1TZJA 1IXKA 2NZVG 3G9UA 1WW8A 3O4GA 3PENA 3SZMA 3NNNA 1ADCA 3WXMA 4CRWB 3BE6A 2HA3A 1H9AA 1PYOA 1JJ7A 4DGQA 3LC2O 2P0AA 1C7ZA 4DLAA 1J06A 1T91A 3AXSA 4IOMA 1I6MA 2GK4A 2I8LA 3AI2A 1YU6A 1F8YA 1EP2B 1PAUA 1O58A 1VLQA 2HMUA 2PKCA 2WKQA 3CWZA 3E1GA 3JD3A 3K0AA 4NS4A 4RF2A 1EE9A 3V6MA 1HMPA 3UHJA 4RBNA 4ZCLA 1G5IA 4DIBA 2ZPUA 4JLNA 2O5EA 3CLTD 3WTBA 1E0AA 3R4VA 2C2XA 4Q9AA 4YT4A 5K7SA 4FBMA 3SHWA 4I4TA 4KRYA 2CJYA 2DBQA 3H18A 3PGJA 5IAKA 3WISA 3RYCA 3KHUA 2Q28A 3FYTA 1YC2A 3DF9A 4KZKA 2MYPA 3RWMB 1Q1QA 1RYNA 1OAOC 4MRRA 3BZBA 5HCIA 3SF0A 5JMWA 1UPUA 3ENNA 1YFLA 3V4OA 1L7RA 2W7TA 5I7AA 4TQUS 4EI2A 4BNJA 3PXUA 1GFWA 2XVAA 1VPLA 4X3PA 4BGEA 3FPBA 1U8TA 1E62A 2GCIA 3H5IA 2D62A 3R0JA 4Z4FA 3OTQA 2I91A 4PY2A 5EE0A 1TPZA 1GA1A 1TUIA 3K94A 3BQ9A 5D8DA 4UDYX 2Q50A 4M8LA 3HTXA 3HA7A 3P45A 1KZGB 4R16A 1EXVA 1E59A 1K75A 1ZRNA 1EP3B 3IKTA 4EATA 2WU0A 2ODEA 2V3WA 2HA0A 1ZL2A 2RAUA 2RHDA 2DJ5A 3ACBA 4PZYA 4X8LA 1PG2A 2X0EA 4MUMA 4DMKA 4B73A 2Q7OE 3H7IA 1GN9A 4JJZA 2PS9A 2WJ6A 4DXDA 5HIMA 4E2XA 4RZIA 3ELWA 4URWR 1IYZA 3IO3A 1U4SA 5KNDA 5H59A 1E6KA 5JEDA 5JANA 1GZHB 2WHRA 3CV3A 3DAPA 3VH1A 1OF1A 2C4WA 1DO2A 2H00A 1KFCB 3HCRA 4NV1A 1CUWA 3QWHA 3OTIA 2IOFK 1YHZA 1VGQA 3ZGZA 1G19A 4BNZA 5EJ9A 1XHEA 3ZH2A 4I99A 2GESA 3M5WA 4HNTA 2XNDA 3OSUA 5ILGA 3MTEA 5G4KA 3SLKA 4I9FA 1VRWA 2A1UB 2IYUA 3RJ9A 4UDOA 3TAXA 5KJFA 5F1OA 4EA6A 1JI0A 1RNLA 2PZKA 1YVDA 2ZIGA 2WT4A 4FS3A 3DE4X 1DT5A 3K9WA 4D9GA 4QJ3A 4Y2GA 1IQRA 4LPSA 3D1VA 1DX9A 1CU1A 3H3XA 3QG1A 4MPRA 4CL8A 4DVGA 1RHKA 2E4XA 2VTKA 3MSCA 5MDHA 1JIIA 4FQ7A 3OUUA 5BQFA 3DBRB 4OO3A 3DCJA 4IIHA 5JBNA 1TZBA 1QHEA 2J67A 3K09A 3QUAA 4PO3X 5MFPA 1KGDA 3W5JA 1JEYA 1E2IA 1ZS9A 1E0JA 1A8SA 5FDFA 4IYRA 3EEIA 4QDOA 3EWAA 4CR6A 4CR8A 4D8VA 3PWZA 4Q1AA 2WLSA 4D9EA 4HQ6A 1XJWA 4IHJF 3JYHA 5JCZA 3CE6A 2GD6A 3QMPA 2C3YA 4LDJA 2FPGA 3D43A 3FDXA 3DE5X 1NXPA 1IG0A 5F21A 1B1CA 4Q6WA 4GO1A 3ZWDA 3PI6A 3TUIC 3PYMA 1E2DA 1X1TA 3ZHSA 3IQWA 3GVHA 1L7VC 2CHUA 4RSHA 4G9EA 1CUGA 2QTVA 2V65A 3VHQA 1ZVKA 3Q87B 2RG7A 3L3BA 3TRJA 4C29A 5M7EA 3DVSX 4NMHA 1EG2A 2V6GA 4FNAA 5B6IA 2IZZA 1H2HA 2ID8A 4WCFB 4IDDA 3IX7A 5KOHB 2B78A 5L40A 1XVVA 3M9WA 3PXDA 4LOHA 2GK7A 1UJCA 4UUPA 4KUEA 2GZRA 2J7PA 4HXGA 2OXRA 4WOJA 3VO2A 4FP9A 1PEKE 2RHLA 2WDZA 1DGQA 5DYGA 6AT1A 3MHTA 4PZZA 3DTNA 4PPGA 4YHBA 5FPTA 1BWPA 1VYTA 2VDNB 3ACCA 3AUYA 4XCXA 4OIFA 4XFKA 2VDUE 3RVOA 4B7CA 4D97A 4MEJA 1SXJE 2BFWA 2FLWA 3PU6A 5CBKA 5CDSA 4CU2A 5IHXA 2OQVA 2JRCA 3RC3A 4ARSA 1Z33A 4QYSA 3OFND 4HO1X 4TQGA 5DJ5A 3G9TA 5BYJA 4QPJC 1U2PA 2AUMA 3K8YA 1NW6A 4HJRA 4I3GA 4W5TA 4B79A 3T9FA 1VPDA 2C4VA 4MB0A 4DSTA 3KQNA 1VKNA 2H1RA 3D4NA 3ELYA 1C3OB 2ZRFA 1OXKB 4HVTA 5JWRA 1FCJA 1FTSA 1EDBA 3FYDA 1PVOA 2VP2A 1I2MA 4D98A 2D54A 1ICIA 2FEOA 3OCXA 3MTJA 5TXGA 4RTLA 4C3UA 1O4WA 3ZWCA 2D74A 4NBNA 3KWLA 5DSTA 2L82A 4ZOLA 3RBAA 3PDIA 2AH5A 3L1JA 4UZSA 4FFOA 5LZ9A 2HTEA 1U80A 1MX9A 3BE4A 4V02A 2PAFA 2ZUVA 4LXIA 5FWDA 2PX6A 3UATA 2OMKA 3DXZA 4N54A 3TK1A 2ZI5A 2H1SA 4Z2AA 5D5PA 1NE7A 2IXBA 3ITKA 1ZJ6A 3KAPA 4CU5A 1RXUA 3CUSA 1V11B 2WINI 3L7IA 2H6EA 2PWPA 2VR1A 3QI7A 4GSLA 1O9GA 2EFEB 1NGSA 2WWFA 3WLNA 1DKRA 1PX2A 2ATEA 1ZU5A 4XDHA 5ALEA 2JHGA 5F7JA 3INGA 1MOZA 2JLYA 3H04A 4AFNA 5IG2A 3JD2A 3TM4A 2IF0A 4DY4A 1DCTA 3DFKA 1BQEA 2P9FA 3LVQE 3E9RA 3NONA 2OD2A 5K3EA 2QJWA 3NWBA 4YAGA 3N8IA 1WF3A 3WGHA 4UHCA 4YUZA 2HHAA 5KU1A 2QBYB 1IOLA 1A71A 1MAWA 3IAEA 4M9SA 4QLAA 3V5NA 3KR9A 4HNVA 3GUYA 5JXWA 2QD1A 1JV2B 2WJ3A 3DPUA 4BUCA 1QC5A 1PGOA 1USWA 621PA 2PFKA 2R48A 3I0ZA 1GPBA 2Y8EA 1KZHA 1L4NA 1RS0A 2Q2WA 4D0GA 1YQXA 4OK3A 1OXTA 3OPVA 4INOA 4F3TA 3P20A 1JN0A 4KWHA 4L7VA 4MWSA 1VL2A 4TTPA 1T1RA 3LDUA 4UEQA 4WWHA 5SYMA 3ORHA 2ZPAA 4RK4A 3LWZA 4AF6A 3HCEA 1PJ2A 1XKTA 2NXNA 3PD1A 5F1PA 2HIHA 1LLCA 4DR6B 1LJ8A 1ZICA 3CSSA 3U4AA 3UKOA 4EHNA 1WUJS 2PFGA 2XNCA 4MJ3A 2CXNA 5LDDC 4R8SA 3ZNPA 3KIPA 3FBTA 3TLEA 2EBHX 2G6TA 4R7GA 2J85A 2DFNA 3RV4A 3FLAA 1RBYA 5EWLB 1KDYA 1FQOA 1EFAA 5DLPA 1TAUA 3VR5H 3R3SA 4IG9A 2JF0A 1E3WA 4AWAA 1I3KA 4OL0A 2ISSD 3RUAA 4KNVA 5EOVA 2H17A 2O52A 4Z7QB 2XNSA 4LNUA 4FZ5A 1K3FA 5DX8A 1YNOA 5SZIA 2ZS9A 3PC7A 4F4JA 2RI0A 1ZWKA 4PQRA 1NE2A 5JLAA 4B3SB 1T2EA 4HGOA 2JJYA 2FZ5A 4O2LA 1F48A 1D0SA 1YRYE 2ZTSA 3FZNA 2G9ZA 3DEFA 4BO9A 1OJLA 3ID6C 4FYWA 1G55A 3X1YA 2PMDA 4UMEA 1EESA 2OV3A 3OU6A 1NG1A 4IMRA 2CMKA 3DT9A 1Q91A 4OQXA 4QVGA 5REQB 3V1TC 2I2BA 4YT8A 4HEA6 4IZIA 4KGDA 2NX2A 3C8MA 4FMCB 4ND8B 5EP1A 3RJMA 1O6ZA 1QFJA 1Z6XA 3AETB 3KE9A 3ON5A 2RG1A 1U63A 1HL7A 4ZIRB 1IY2A 4DGSA 2VH5R 1QJCA 3DO5A 1KARA 2J7PD 2XUGA 5K3SA 4OJTA 3A1TA 1D2GA 4G1VA 2PQ2A 3TOZA 4C1BA 4EHJA 2BWJA 1S7GA 1KZ4A 2JGEA 3N75A 2Q0QA 3N0RA 4L22A 4UE3S 3U09A 2WMOB 1JWBB 3EQZA 4I14A 4ESHA 3CLKA 1QAMA 1JL3A 2AX3A 4M1ZA 4AZTA 1ZI8A 2HRQA 3T3EA 3L8ZA 4F7WA 3QOYA 5TMDA 3Q3CA 4WY8A 4H4EA 4HN9A 3LX8A 3P97A 4XD7D 5AFSA 1K8YB 1XZAA 1XK6A 1PN3A 3D6MA 4NE2A 1CERA 1SBTA 2GJ8A 2J30A 2HIMA 1JILA 3CM0A 2C7PA 4GMGA 3ZCSA 4MR7B 3O3MB 1PD0A 1L3IA 3SXUB 3WL6A 3BFKA 3H7AA 4GXRA 4XX0A 5JH7B 2A8YA 2QQ0A 2J0EA 3A3NA 1P31A 2FVYA 4AO6A 4AY4A 4PYJA 1OH7A 3B6KA 4PSAA 1FYEA 4B3BA 3GIWA 1ORIA 3KTOA 1UOOA 1QK5A 1P4JA 4WLOA 1MABA 5ICEA 4MR8A 1XAIA 1O6FA 5CIWA 2BTQA 5FJIA 4MDEA 2ZYHA 1NRIA 4WLUA 3UJDA 1SCKA 2P6NA 1TGYA 1C7RA 3OCJA 1YZNA 3OOSA 4I19A 3QJ5A 1CUUA 1C9MA 1Z2OX 1TO6A 5BV1A 4V2UA 2AZDA 3NUZA 4HPXB 4NARA 4WOBA 5EJ7A 1F60A 3IUJA 4ND2A 1UDRA 5ADWA 3KKOA 2XZLA 3KEFA 1RVDA 2QAGC 5JJIA 1GTMA 4CIVA 4PZCA 4YMWA 1BRMA 4RIFA 4FGSA 3O4RA 5JISA 3D0KA 5FCDA 1XB2A 1BKSB 1URPA 2QJFA 4B4WA 1AE1A 2BC9A 3R7WA 1U6KA 4NPCA 3D4PA 3SZLA 5B57C 4QL3A 2PUCA 2JJ1A 1XU7A 3FKSA 2ICAA 4LWQA 2VN8A 2WWHA 2ZIUB 3GK3A 3SXJA 5ULLA 4EW3A 1XZEA 4B71A 5JZOA 4L51A 5LP1A 3QUCA 5C35A 3G13A 2EKDA 4JP8A 1H2YA 3VPFA 3L05A 4RK7A 4OV6B 2CUTA 2HYIC 2JLWA 4DJDC 4MGIR 1R6DA 1RADA 2GS9A 4M7WA 4F46A 5CAEB 3OTOB 1LU9A 3PQ4A 3ZE7A 3DCYA 1SD5A 1ULTA 4FT2A 4BX2A 1VMEA 1ZW6A 1TEVA 1DQNA 3G9QA 4CDRA 3D4IA 3QSGA 1XD2B 7AT1A 3BWDD 3U6BA 5C46F 2BMAA 1M2HA 3P2OA 4IIBA 3OZFA 4S1WA 1XEAA 3K9LA 5MFZA 4DR1B 4ZVTA 1USVA 2VK2A 1IDOA 1IZ7A 2ECFA 2WYWA 5CT4A 3EODA 4GL2A 1ETUA 1T0PA 3AUFA 3G0BA 1YJ5A 3HBLA 4KBYA 4NQRA 5T3UA 2RHTA 3ZXUB 3UZUA 2W8BB 2AQ8A 2WQZA 4ZAGA 5DNYB 1FF9A 2G88A 3HXLA 4HDMA 3H1AA 2Z3ZA 4BMCA 3WJAA 3U9LA 4JD5A 3X1KA 3AHCA 3S55A 1OH5A 3I5UA 2YZGA 5AJXA 1XTRA 4TYYA 2O0KA 1Q83A 1O4VA 3NLLA 1QHSA 4Y2RA 1C2YA 2ZSFA 3PEYA 4R0VA 1PL6A 4B3JA 3HR7A 3HJFA 3PQCA 1CUCA 2AXEA 4RPCA 5CVJA 4ZYTA 1NNLA 4U02A 5K3FA 4CMHA 2GHIA 4Z4CA 1KXZA 2PKRA 2O2ZA 4I4NA 3WDSA 1BMFA 3GFTA 4OXRA 3BE8A 2LCQA 2HZ7A 3T0GA 4B0OA 4Y7DA 2D0DA 2ZXUA 3SYMA 4QC2A 1U8YA 3OM0A 2WYVA 4YJGB 1Y33E 4Q6BA 4CM1A 1E1RA 3VYTB 3SDBA 3RK1A 3HVJA 4LRYA 3ORYA 5CD9A 2JS7A 4HWTA 4PYKA 3CLHA 3ND8A 4IP0A 1QFZA 5ALPA 4BL5A 2FCAA 3S2SA 1LSSA 2QU8A 2I4IA 2CV2A 2QS9A 3A6DA 4A23A 4AJEA 4EG5A 4X94A 1EWYA 1U9IC 2EWMA 3BF7A 4G4JA 5BW8A 1ZD8A 2VQ3A 2WAMA 4ZI7A 1I1OA 4OHOA 4DBLC 2IF2A 4FMDB 2RE8A 2GD0A 4R98A 3OZGA 1R5JA 4MLZA 1KQGA 2FB9A 2Y77A 3H2YA 3HKEA 1S3GA 4L5JA 5T4FA 2B61A 2PJUA 3AW8A 2NYUA 1N5RA 2O7NA 3WIBA 4LGMA 4RJIA 1WCIB 4YJ2F 3MJEA 5J4KA 2XWSA 1LX7A 2EAUA 1TZCA 2V45A 5EIFA 2QG4A 2QUIA 5ADHA 1YDFA 4LDPA 5K6TA 1W48A 4HS4A 4RXUA 4TMVA 1YS7A 3U3JA 2A0KA 4F21A 1IXRC 2WFAA 3GJZA 5CTJA 3AONB 1YAJA 1E9CA 4U39A 3N2NA 4GX0A 2REXB 5B7PA 2Q3HA 3KAJA 3SJUA 5T3YA 2I29A 1RP7A 3DPIA 2TECE 3JWHA 2B8WA 3MAGA 4HRAA 3MA0A 5JYCA 4AU1A 1GZ3A 1LPNA 1X70A 2ZATA 3FDIA 3KYIB 3EPKA 2SBTA 4K3VA 3STUA 1W9HA 5CB4A 4N3BA 3TCNA 2Y0EA 2QTFA 1ISPA 2R8YA 3BMOA 3MJFA 4LF5B 1GAWA 3M4YA 2B98A 3HKDB 1PWHA 2EDCA 1M1YB 1J1IA 2BTOA 3CH4B 4C78A 3KQHA 2YDXA 1C0LA 4EFNA 3P27A 3KPVA 3MOSA 4I7EA 1YF3A 3LZCA 2QOEA 1MIHA 1DINA 5CVVA 4LFBB 1Y6GA 4OGLA 3T4XA 1FJXA 4Q7EA 3A9CA 1DWOA 5B2FA 2DP4E 5ALHA 5IBRA 4CDGA 1UF9A 3FKSD 2C8JA 2R96A 3TINA 4BKOA 4DJAA 3ANSA 4TWJA 3WNDA 2QF7A 2CLFB 4XR9A 2Q5HA 3TD6A 1Y9JA 3TSWA 3U19A 1P2SA 5CFZA 4W8HA 1OIVA 2HNBA 4PYRA 5HYVA 1QP8A 2ZSUA 3WBFA 1Y3BE 5AICA 4FSHA 3H84A 2NU6A 2P2YA 1ADYA 1OQAA 2FWRA 2E4WA 2ZETA 3ITNA 2RH9B 2PHZA 3JVDA 1WX1A 1M66A 3BERA 3K4PA 3QYAA 4QX6A 4HCJA 5EIHA 2A9JA 3MINA 5K03A 1KYYA 1CQZA 4MINA 2A3NA 1Y37A 3AFMA 1U7ZA 1U3VA 1JMYA 3CISA 3G2JA 4LVUA 1F0PA 2JZCA 4NICA 4M37A 4NLLA 5WRFA 3TOSA 4BFZA 4JEIA 5ITZA 4DVJA 2Y1EA 1Z56C 4I66A 3L8CA 1PV2A 2Z6UA 2WTBA 1JAYA 3ZJVA 4HH1A 1N5MA 2XUAA 1CR4A 2Q2OA 4PGAA 3V8MA 4ESEA 5HCNA 3S44A 1CY7A 2R8BA 2HRRA 1RLJA 3DHEA 4ETIA 2XXAA 4WL0A 1DTSA 1XALA 1P19A 3NP9A 4GOXA 4UDNA 3W5BA 1FFSA 4ZXFA 5ECWA 1UK6A 2EP8A 2ZIVB 4YROA 1FJGB 5C51B 1HL3A 4AICA 5BQ5A 4R5MA 4UUMA 4JI4B 3LA8A 4FYPA 2XRZA 5I5EA 2P6OA 3EW7A 3AIKA 4GBGA 3F6BX 4KUHA 2AC2A 3DA8A 3I58A 4GZMA 1MU0A 2BFDA 3HRHA 3KQSA 5MF6A 1FRZA 1X9HA 3WWYA 2VHEA 4JJFA 4Y8VA 1HX7A 2Y2UA 1OXXK 3HNRA 5C5IA 3MJHA 3W5CA 2W22A 1F7UA 1WDWB 1NLFA 3ZNQA 2H5JA 1CZRA 4TM7A 2EP7A 5FULA 3WA6A 2AFIB 4AX4A 1OKKA 3B1JA 3B3FA 1EGAA 4MWCA 1FPMA 2HHLA 3PI7A 3WK9A 4EG8A 1CBUA 4LRUA 3JWEA 1QR2A 2Q4OA 3DFIA 3A1VA 3M70A 5M3BA 1S4MA 3QI2A 1HE3A 3HKBA 1RYMA 2IKQA 4OGGA 2YC2C 2WJPA 1Z7GA 4LNAA 4KVFA 5TMPA 4YX9A 4TOIA 5BNFA 1NONA 1FJHA 4F86A 2PKEA 2D2FA 2QRLA 1G9TA 2PUHA 3HO6A 1AH2A 1DUSA 1L1EA 2RJNA 3HU2A 4KXLA 4D8UA 3IOYA 2BM0A 1GADO 3T6KA 1IOZA 2FZ4A 2G5PA 3A2MA 4EELA 2C0PA 1U0NA 3BSSA 5HDQA 3CLRC 1FP2A 3DO6A 1ORWA 5IZCC 3PXCX 4JEHA 3IKMB 2ORVA 3F5FA 1W34A 2DQZA 1JKJA 3BGVA 1G60A 5FF9A 4AXBA 1PQWA 2BI4A 2MSNA 4PYOA 2OFFA 1Y8CA 2EBUA 5D01A 4OKSA 2JFQA 4ENTA 1MZPA 2J9RA 4BMDA 2WM8A 2Y1WA 4DCPA 4TUYB 1XZHA 1IJFA 4FQ5A 5AXBA 1PX0A 4K9RA 4KKXB 5JS1A 4JJEA 1SCBA 4MDYA 5FADA 4UMFA 1GLNA 1P60A 1RM3A 4TWZA 2W83A 2ATCA 1JU4A 3CWCA 3PVZA 4YAOA 5FTLA 3NEAA 3ND5A 4O4LA 3VA7A 1QH8A 2FN8A 3PQ7A 3Q7RA 3EVTA 4G5OA 3HJBA 4EB8A 3PJEA 1T2NA 3PGVA 4X7MA 1IOVA 1SMKA 4AMVA 3WYCA 1YXMA 5HM8A 5JARA 1XKXA 2II6A 1JIQA 1LK7A 3ELBA 3H83A 4OL9A 2JW5A 1EX6A 2VXOA 1F3LA 5DNAA 3RI3A 2IS6A 4BMNA 2XQKA 2P62A 5GY7A 4NEHB 3UMMA 2NZUG 1ADGA 3PDIB 4FM9A 2JGKA 4OB6A 3TQHA 1EEXB 2J9FA 2Y1GA 3SC6A 1GTZA 2IVZA 4GR4A 2IQIA 3DUFA 1PR1A 3A1SA 4TLDA 5TQ2A 4Z3KA 3CLTC 2VPIA 1WXQA 2B7CA 3GRAA 3IP9A 4MNTA 2WSBA 3L92A 1Q7EA 2P3SA 1UPFA 1P80A 1WUKS 2ZKIA 2ZRKA 1C7IA 4JVOA 4FXOA 1QFXA 4FLMA 5T4HA 3TZLA 2K5UA 3CH7A 3MTBA 5E9JA 4M55A 2FEPA 2JJ2D 3CX7A 1GA4A 1GITA 1FDWA 1CUFA 1HZZA 5HBGA 1UK8A 1ODSA 4Q1EA 3IERA 1IIRA 2H3EA 4J0KA 4L2IB 2W58A 4NMMA 4TKZA 4BMPB 4DDWA 3IE1A 3IOCA 1TMKA 5AW3A 2WVAA 4RTMA 3TTXA 2W4IA 3S2GA 2AZMA 3NANA 4WK2B 1Q0QA 4F85A 3GBSA 5IULC 4ZCPA 2H1CA 3N58A 3WK8A 2J6HA 2GAFA 1I0LA 1K8XB 3W8FA 1SU6A 4KWIA 5KYUB 5HZKA 2X6QA 2VJKA 3KHTA 2CDBA 5CEFA 5JVDF 5I9LA 1C30B 3C6BA 2W2QA 5HRAA 2HH9A 2B1QA 2SICE 3ADKA 3AX6A 3Q3VA 4DLNA 1U11A 5D3MB 2GB4A 1G3QA 2O5VA 1T29A 4XCVA 2IEGA 1KAOA 2AYYA 4QOIA 4J3FA 4BAZA 2F67A 1U7PA 5EIWA 5JCJD 3EFOB 3F3MA 3FVVA 5LQUA 4B74A 3VSEA 3SS8A 3GBPA 1XD9A 2GEVA 5JXGA 3H4VA 4JENA 4GM0A 5EP2A 3VXKA 5IUKC 2ODWA 1JEOA 2Q3JA 4JOCA 2ZBRA 3Q12A 3IUBA 3F71A 3IPCA 3AHDA 3C85A 1IVSA 4M0MA 1PJSA 2FUKA 1U0FA 4Y2XA 3RODA 4C43A 1J20A 1R0RE 2FP4A 4P4NA 3JSXA 3BB1A 1W93A 4HLUA 4IQFA 1WULS 2VHWA 1NMZA 2VNKA 3AEUB 3CT6A 4MIYA 4RCYA 1RWMA 1ILEA 2K2QB 2ZRCA 3UH1A 1AN9A 5HHTA 5EYPA 4C30A 2BJHA 4GICA 1QOPB 5CP8A 1PSZA 2C7GA 3MZ0A 4R71A 2B99A 3RUIA 3PQDA 2O6HA 3UJ8A 2AR0A 3HM2A 2GCNA 1MB0A 1L5NA 2C3PA 3AR9A 3DZJA 4I5DA 1W46A 1GGHA 2E6UX 3SVLA 4ZOBA 1PJAA 2BFEA 3ESYA 2FPIA 3O03A 4TTRA 4MQFB 2DERA 4G56A 3DTVA 2Z6AA 3M3PA 1ZONA 4MA4A 4LN1A 4KQIA 1JA0A 2O8EA 1NFQA 3CG4A 3D4LA 4FSDA 2K7FA 4MYDA 5MN6A 3MLEA 2Q45A 2A0WA 2P77A 4PBRA 1KVQA 3X2SA 4Q7LA 5KOIA 5K0ZA 1BA2A 1ZJYA 2A9VA 5BUCA 5LYJB 2HLDD 4ZV7A 3LCRA 1KAQA 3NTOA 1Y7IA 2FQYA 4CT0A 2JGDA 3GRVA 2Q3BA 1J0EA 3BM5A 2WWGA 4UMVA 4C7JA 3OD5A 1YZLA 3OJCA 1PZGA 5COBA 2C1EA 3O82A 4P53A 4XSHA 1JECA 2WPDA 4JSRA 1PK8A 4EPXA 4GYJA 4RD0A 3HB9A 1MRZA 2G1UA 2B36A 3GEEA 1UKCA 4RF5A 2PMFA 3ZCVA 4ZU3A 2AKAB 5IYZB 2QD5A 1NJGA 2R5FA 3PHLA 3FGZA 3GPIA 2WZQA 1ND5A 4H7DA 2I6TA 4LTMA 4AS1A 1BAPA 3KB1A 4Q4AA 2AG0A 3HB7A 5MN4A 3OIGA 1H4VB 2W9XA 3A4VA 1J8DA 2VK8A 1R8YA 2CNWA 2IPOA 4Z0PA 3QNMA 2WNSA 4JBWA 5B6PA 2DFKB 1K6XA 1WUTA 5FPSA 3MT9A 4JEUA 2YOFA 1OILA 5AHKA 4HVCA 4F92B 3QPAA 3IEIA 3E9ZA 1RJEA 3TR5A 4OATA 2FDCA 1UIRA 4YCAA 1NL3A 5H80A 4D7AA 1XTPA 4MWDA 1KQ3A 1INLA 4QU5A 5ALKA 2ZTLA 2PJZA 3KUXA 1BXKA 1M8PA 2HWUA 1TCCA 4HH4A 4QJ5A 5CVUA 5C81A 4I55A 1RJGA 3VFDA 2CWWA 1U5BB 2UYQA 1RSZA 3UXHA 2ZYGA 4DRYA 3LUCA 3RASA 3WGJA 4K46A 4NBVA 1C1YA 2X3YA 2CL5A 1E6WA 2W6ZA 3WZLA 1ZN8A 4UTXA 5T4EA 1CNMA 1WWKA 1LH0A 3GDFA 3A7EA 4G07A 4RYLA 1NTRA 4ZJZA 2ZAIA 1GUAA 2B8EA 2IEZA 3K9GA 5GONB 2LE0A 1KL7A 4GNKA 2WMNB 2JCYA 1MEOA 3NKVA 2PR7A 2MSKA 3TGLA 1JHZA 1I2CA 3GRPA 3B9QA 1PLJA 3EXIA 5CXXA 1JXOA 3SC4A 3SX4A 1NVXQ 2H06A 1FP7A 1YMUA 1ZK4A 1OGIA 2IPMA 1E5LA 3QF4A 4P0QB 5JOQA 5UKDA 2O3TA 4X85A 2RHJA 4Z3OA 5AO9A 1G291 1HFWA 1BOFA 1GRQA 3PITA 4GOOD 5E1MA 3K0KA 1U8UA 4Z99A 3PBKA 5AKIA 2HXSA 3P2EA 1O87A 3DW1X 3I9JA 5CFQA 5DNEA 4J0DA 2J0UB 4DR7B 4GRDA 1W4RA 1FP6A 4WBNB 1MA0A 4RY8A 3GHHA 1NNI1 5LLSA 1GM5A 2QTMA 3M6VA 4DR4B 2O23A 1W8DA 1XDZA 4GXQA 1N9ZA 1K7EB 2PZEA 3C8ZA 1CZLA 3MUNA 5E4FA 5A9RA 5GMOA 1Q22A 4ZV4A 3GU3A 4LTDA 4EYOA 3K8QA 1LDMA 3BRQA 3TSOA 2ZSEA 3DFFA 1BMFD 2W2OA 1TLTA 4F4CA 3B8EA 1ULBA 4G9GA 4M9XA 1BJRE 5FBHA 2XT0A 4JUAA 4U8GA 3V9AA 2Y6UA 3NHFA 3NBXX 4MVJI 1WRBA 2YASA 3HZZA 4UVHA 4L8VA 3OE1A 1ZHOA 1GN8A 1OA0A 2UUPA 3RD5A 2XODA 2A5DA 2QXUA 2VHYA 1DP4A 4H1HA 4C06A 1M5RA 1H0RA 3P9YA 1IL0A 4RULA 2V9ZA 5TMBA 1UMBA 5JADA 3L6EA 4Y0AA 3ZY2A 4G4SO 4D9NA 4DLVA 1XVTA 2EL7A 4A0FA 4KWTA 4JOSA 2BD0A 3QXSA 2I2FA 2XZTA 2RHHA 2ZI3A 3AOEC 4P3XA 1CP2A 3BMNB 3EDMA 3ICEA 3K5WA 2C97A 4EK9A 1P5FA 3FCYA 4AW9A 2BKXA 3OUZA 1A76A 4F3CA 2DTDA 2KYRA 3OFKA 4C76A 1QV7A 1NQXA 1UDCA 3NHKA 4QSMA 1ZH6A 3X1JA 3NBZC 1MOPA 4WDQA 1R5BA 1DAMA 1Z6ZA 2BFEB 4TLBA 3JPWA 2C9BA 4H35A 2BAGA 2Z98A 5JE8A 1HRDA 3OETA 4D2IA 4ZVMA 1RD4A 1C14A 4DSUA 1JDZA 2JASA 3DDUA 3VPGA 8GPBA 4WGGA 1RRGA 4YR7A 2PNFA 3ADBA 4AZVA 3VR1A 5HKAA 2BMWA 1Z63A 3VH3A 1C0IA 2HBQA 2ES4A 1BRTA 1QAQA 1TJ5A 4P4SB 4B9EA 2LXNA 1OD6A 3IUNA 5A1TA 5BUQA 2CCJA 3SNKA 4UBNA 1H3NA 2F55A 1X7YA 3IULA 3ME5A 3GPBA 1O8CA 3OKPA 3OM9A 4WKGA 1NJSA 2QI9F 2DKFA 4ZZ3A 5J43A 4P2BA 3Q0IA 4K9DA 4B33A 4YLGA 4GQAA 3HYLA 2FZKA 4Z0HO 4LE1A 3A6PC 4TS4A 4GKJB 1RMQA 1OGYA 4MJ