4P84A

Structure of engineered pyrr protein (violet pyrr)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
GSNEKAVILDEQAIRRALTRIAHEIIERNKGVDNCVLVGIKTRGIYLAKRLAERIEQIEGKPVPVGEIDITLYRDDLSVTSNDEPLVKGTDIPVDITDKKVILVDDVLYTGRTVRAGMDALMDLGRPSQIQLAVLVDRGHRELPIRADYVGKNVPTSKSERIVVQLDEVDQNDRVSIYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein PyrR
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transferase
total genus 53
structure length 180
sequence length 180
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p84A00
1R3UA 3ACDA 4RHUA 2JKYA 5HIAA 3OHPA 5KAMA 4FYMA 1A97A 3DEZA 1XZNA 1I0IA 4KN6A 5ESXA 4LZOA 1VDMA 4WMLA 1NULA 1A96A 1HGXA 5BSKA 1ZN8A 5JV5A 1GRVA 1VSTA 1A98A 1L1QA 4P3KA 1A3CA 1O5OA 1ZN7A 5JSQA 2PRYA 4RAOA 4X45A 1ECGA 4P82A 1DQPA 3M3HA 1JLSA 1G9TA 1W30A 3OZGA 4P83A 1DBRA 1V9SA 1BD3A 3KB8A 1DKRA 4OHCA 4P86A 1O57A 3LPNA 1YFZA 2H07A 1U9YA 1QCDA 2HCRA 4P80A 1A4XA 1ECJA 1G2QA 1UPFA 2WNSA 2C4KA 1CJBA 1P18A 4QYIA 3O7MA 1QB8A 1QK3A 2AEEA 3N2LA 5ESWA 3OZFA 1I0LA 3EFHA 2JKZA 5HKLA 4F8EA 1D6NA 1QCCA 1G2PA 1P19A 1P17A 4IJQA 1P4AA 3GEPA 2H08A 3ACCA 1FSGA 2GEBA 4QRIA 4X44A 3LRTA 3MJDA 3DAHA 1TC1A 3GGCA 4P84A 3GGJA 4RAQA 4LYYA 1ZN9A 4RHYA 1DKUA 1IBSA 2E55A 2H06A 4WN3A 4JLSA 1L1RA 1ECCA 1WD5A 5EUCA 4LYGA 3S5JA 1Y0BA 1VCHA 2XBUA 3ACBA 2PRZA 4PFQA 3G6WA 4QYIB 4RQBA 4TWBA 3HVUA 3H83A 4PAWA 2DY0A 5K51A 1QK5A 1UFRA 2IGBA 4JITA 2JI4A 5E38A 5IAOA 1ECBA 3NAGA 1I5EA 2PS1A 4LZNA 4RACA 4RHXA 1AO0A 1QK4A 1XTVA 2FXVA 4RANA 4RHTA 1GPH1 1XTUA 2YZKA 3MBIA 4RQAA 4M0PA 4M0KA 2JBHA 1MZVA 1G9SA 1OROA 4RADA 1HMPA 1TC2A 4P81A 1I14A 5KAPA 1I13A 1BD4A 2VFAA 3QW4B 4LZAA 4RABA 1ECFA 4RV4A 5BRNA 4ZFNA 4S2UA 2EHJA 1UPUA 1DQNA 1A95A 4M0UA 1U9ZA 1XTTA 1XZ8A 1LH0A 1OREA 1BZYA 1NONA 2P1ZA 1OPRA 5BQPA 5BQOA 1J7JA 3DMPA 5IPFA 1PZMA 1Z7GA 1JLRA 4MB6A 1QB7A 4Z1OA 1STOA
chains in the Genus database with same CATH superfamily
4EOGA 5B4VA 2AN9A 1Q0LA 3ORFA 4WK0B 3VR5A 1U3DA 1UINA 3NALA 1CDEA 1NI3A 4V2IA 2QJTA 1WKBA 1GTSA 1L4MA 2YV5A 4MYHA 1W36D 4R1MA 3VDXA 2J6CA 3CKYA 3QJYA 1F8GA 2AIRA 3AOEA 3O0DA 1E3JA 4P38A 4YWHA 3SR3A 4B79A 3H7IA 5BY2A 4RC9A 4HNSA 4M7WA 1KHTA 3V8PA 2FMKA 2NVUB 2JANA 1QMPA 3L5OA 1UK6A 3IKLA 1C30A 3GRUA 4M21A 5JD5A 4Z4EA 1QHXA 4TS1A 3J81k 3CW9A 3UJCA 1P2DA 2ADMA 2LE0A 5GM2A 4H7FA 1U99A 1V9CA 1Q12A 2UZ1A 3STXA 4ZC8A 3EOAI 2BBWA 1P0PA 3FGOA 4JYMA 5SYAA 2VF4X 2FH5B 4EGSA 5CA0B 4HMOA 3WY9A 3ENWA 1C3OB 1NBAA 5EMJA 1N2CE 3FDIA 1Z0FA 5AUNB 1CEXA 4B3FX 4UBKA 5AOVA 1AQNA 1LFDB 4IX1A 4LJ6A 1VCNA 2HCBA 3MS7A 1N3YA 3UGJA 1LFAA 1K2WA 2C4WA 1T8RA 4IQ4A 4FZJA 3ZI4A 1GDHA 2I7VA 3GDGA 1MT3A 1XZMA 2V55B 3F1LA 3H5OA 1LUAA 3LCUA 5A6SB 2NO1A 1QGUA 2OEPA 3THRA 2W42A 3KKNA 4MS1B 1Y1LA 1S0UA 3NWBA 4KNYA 1GGJA 3G23A 4G4SP 4MUEA 1J2YA 4RWEA 3MLEA 4U2CA 4G07A 3V8BA 4N4AA 3LGSA 4DQVA 2C7GA 3HZRA 3HS3A 3AUFA 3W3AA 1IJFA 2FMTA 4CUJA 5K09A 3R7DA 2FSUA 2OWDA 1JYEA 3NHUA 4Q9LA 3T1OA 1YA6A 5DBOA 1Y81A 4RO0A 4B40A 3LC2O 4NWIA 4KV7A 1ZEJA 2FGJA 2IZ7A 1ZIXA 2E5FA 2NNLD 2R6AA 2VSXA 1VPEA 1NW6A 3EVNA 3LA8A 4TS3A 1MQAA 3W1VA 2D4HA 3JQAA 3T9DA 3P52A 5JV5A 2VDWB 1C4OA 1P73A 4UCQA 2HHAA 2MCFA 1NL3A 1SQSA 2ICAA 2YN0A 3I6MA 4XWWA 1K7YA 4S0ZA 4XVQA 1ONOA 3IR6A 3SJZA 5CITA 2JAOA 4FDAA 4WZBE 2GVNA 3TW0A 4BFSA 5HRAA 3IUYA 4CM9A 5JJLA 3FGNA 1EFUA 4IDCA 4L3WA 2ZRAA 2O6LA 1Q0HA 2JCXA 1MIOB 5REQB 3WKCA 3TO5A 4EL0A 5IJ9B 1XF9A 3R6TA 5JJCA 4NCJA 4FQ7A 1ETUA 2ZJAA 4KH0A 1FRNA 4V39A 2VEOA 4NHEA 3K2IA 4RVCA 1N6NA 1PQWA 1QUFA 2NSLA 4PSCA 1WB9A 1AS2A 2QR2A 1P5ZB 2ODNA 2VIIA 3R5HA 4G0XA 3SEFA 2WOJA 5KNCH 4F3NA 4TGLA 2ZS9A 4GXQA 3L01A 2EGHA 1SCUA 3G7NA 3V4RA 5IT4A 2GZ2A 1X7WB 4JOCA 2FPKA 3Q11A 5CB4A 1GPUA 3I6BA 3K9HA 4CL2A 1GZ6A 2NXJA 1YB4A 4WASA 1UMKA 4MEBA 1U5BA 5FFMA 2Q9UA 5E6UA 3P9KA 4RK6A 4EHKA 3WKEA 2HSJA 2YXNA 4NFSA 4RD6A 4IWNA 1SZPA 1PFQA 2AVNA 1L4FA 4NCBA 2C9ZA 4QUAA 2QVYX 1KIMA 2X15A 3KOXA 3J81A 3FOEC 1BDIA 2IYEA 3BSFA 1ZXLA 2OCIA 3NZEA 5FOXA 3ESCA 3A70A 4DLYA 2XIQA 2D59A 1ZIPA 1Z5UA 3F3KA 1AURA 4Z86A 1F6WA 3CMMA 5JSQA 1FRFS 1WR8A 5KYTA 1DEKA 4WNAB 1HE4A 1E0KA 1RLJA 2RJNA 2Z83A 2PZEA 2CUNA 4XPIB 2ZI9A 1TYEB 2C9YA 1UM9A 3W6UA 4TRRA 3WHKA 3ZGVA 4KQ9A 6CHYA 3UPUA 3HKEA 4HGRA 4QWWA 3VKHA 4OGKA 4C20A 3MYRA 3AK4A 3SFTA 4C03A 5AVVA 3H9CA 1XZBA 2KJQA 2ZJ8A 3KZ1E 3N7AA 3I6QA 1ORRA 2OK7A 1V45E 4EZIA 3AUJB 3HBAA 2DLNA 2IHTA 4O4IA 2XXBA 4MULA 5J63A 4E4RA 5JC1A 2OBXA 3IUPA 1RZRA 3RGGA 4U8HA 3WGYA 3O3MB 1U4NA 2JFXA 4ES6A 1NI4B 1S2NA 4WKOA 5LP6F 2V3VA 1PR5A 1QWOA 1XU4A 2YFKA 4NYMQ 1U2SA 2ZDHA 4GQBA 3UV6A 1JG3A 3EGDA 3LA6A 1ZVMA 3FY4A 3I53A 3ML1A 4MGKR 3X1MA 5FNZA 3PDHA 3MJDA 1VA5A 4DCOA 3ECCA 2Y8EA 4E4TA 2ON6A 2AGVA 2VKQA 3DDZX 2QQ5A 4WFKA 5DNEA 4H6XA 4XPZA 4XUGB 4FR2A 3VXKA 3KO8A 1OH8A 2HXYA 1TMYA 2Z9CA 2B78A 4F11A 1RKUA 2PMEA 2OD7A 4BCDA 4TT3A 5DIZA 4KQ6A 2ZYAA 4QT0A 4B80A 2CLMB 5FTMA 3ZHYA 5B1HA 1CUVA 5J2TA 4LSZA 2CY0A 1JQKA 1XWWA 2HF9A 4IEIA 1GQOA 1UJNA 4KXWA 4MWEA 2XMPA 4O5AA 2DE0X 4XSGA 3AKYA 5I8WA 5B55A 1OQAA 2P2NA 3I30X 3IEXA 2G80A 4B4DA 1M2HA 3GOHA 1CF4A 2D06A 1L7XA 1ULSA 4FONA 3GIDA 3TR6A 2WUDA 3OHMA 4O3FA 3SJAA 1XQXA 3FAKA 4S3MA 4GBGA 2OGZA 3PENA 1IM2A 2N46A 2J9FB 5L4NA 3VZRA 4GICA 4RYLA 4NZZA 1AUQA 4LOIA 1XA3A 3G5UA 3OJOA 4OQDA 4QOHA 4RKYA 4COKA 4UPEA 4M55A 4UUNA 2M1ZA 1BE1A 3HDYA 5AXCA 3VYVA 5JVDA 4S2UA 2QE7A 3KZXA 2RH5A 1V8OA 3IIKA 2G67A 5ERXA 3U80A 3ZDYB 1UK9A 2PBLA 3V97A 4EA6A 4NF2A 4GPZA 1KMNA 1N2CA 1VLQA 3JQEA 1R74A 2VF7A 2GZ3A 2UXDB 3EXFA 3WLPA 4Z3KA 1XHEA 4LWPA 3C8ZA 1XEXA 4HL6A 3RGWS 4DLRA 2BFFB 1BOOA 2WIAA 2PVPA 3Q12A 1KGSA 1U1FA 2OV1A 4UNPA 5ICGA 3FFWA 5DX8A 1ACMA 2JJMA 5JARA 1ES9A 4NDNE 2QN7A 5JIBA 821PA 1WV0A 3EC1A 3F6BX 4U2FA 3SHOA 4M1TA 1MVLA 1XEFA 5COBA 5KI6A 4EENA 2XUHA 1CRPA 3R0JA 4KFSA 4DARA 2I62A 3IAEA 1VOTA 1FP1D 1NMSA 3Q6NA 1W19A 1D3AA 3LGAA 4J0FA 2ZYGA 1W2GA 3WA7A 5LUBA 5KQPA 3W6OA 2Q8PA 4KK4A 2XTJA 4L5AA 3IE1A 1Y63A 3N6XA 3AWIA 2QHXA 1ORIA 3NRCA 5CLGA 3JYOA 4LOKA 2BE7A 3LZ6A 4G8CA 2B3DA 2XRMA 3U9TA 2JJ2D 1BEEA 4OQNA 3VR0A 2VHTA 3FPLA 3F5FA 1K66A 3C1UA 3D4LA 3QBDA 4XAQA 1PQYA 2P75A 3CG0A 3CWQA 3SSNA 8AT1A 3IEPA 3UT5B 1QZXA 2V3CC 3IELA 4EL5A 1L1EA 1PT8A 4XGRA 5IKOA 3LXUX 4ZHQB 3P2EA 2EZ9A 4YUWA 1FMLA 3ZVRA 2DH5A 3ZLUA 3ZNQA 4FBMA 5EHIA 2I4MA 1YCGA 2O1SA 3GLFE 1G0NA 5EZ6B 4LE1A 5T41A 2WB2A 5LZ4A 4MW0A 5MFPA 3L7JA 3PGKA 3THYB 3F97A 3QXSA 1BMTA 4R51A 3TZBA 1G17A 1R6XA 4LJ7A 4NZYA 2G1PA 3NGLA 4DLUA 4DR2B 1SCQA 1KR2A 4L5YA 3I01A 3NBYC 4KR0A 2P8JA 1VGQA 1E9DA 3KPVA 4QXPA 5ESRA 4XD7D 2OCLA 4AXBA 3KQUA 3DF9A 3DUFA 2F8MA 4IJVA 4EVRA 1UZUA 4NPHA 3W5IA 4MI3A 4BQRA 2AXPA 1F9EA 1UXKA 1XZQA 2FQWA 4AG3A 3UKOA 1E1CA 1E7RA 3WLSA 3IODA 1HQYE 2QJWA 1OB5A 2QX6A 3FETA 3PB3A 1RXCA 4ENTA 5KX5A 1Y6JA 3DFMA 1RMQA 4YCCA 4CFYA 3VC3A 3VHRA 4Z4IA 2FMUA 1MOPA 5E9AA 1GRNA 1HX7A 4C4AA 4EW3A 3TPZA 3ZDXB 1B26A 1ZONA 3T7SA 1PVOA 1VSBA 3DTVB 4DQKA 2D1RA 5C5IA 3KT0A 3QE0A 3RSFA 2WZQA 4JJ6A 2VJMA 3MB8A 4L8WB 4OIMA 4R1UA 3H1PA 3TRKA 4DPLA 4YQFA 1H22A 4PE5B 4DBLE 2R7AA 4IGFA 2ERXA 3QPCA 1KOGA 1SBHA 2XOXA 1FQKA 1PZHA 4QXMA 3ZJTA 1FBNA 4CFZA 3LY9A 3ZE2B 1HORA 3BIJA 1CUYA 3ANTA 5E9WA 1Q0RA 3HB0A 2BM9A 2I3DA 1TE2A 1CRWG 3FZEA 4RCVA 5A0VA 3NUQA 1MNAA 4NXMB 2HSGA 4C2AA 3HHEA 4L0MA 2IEAA 4NPCA 5TQVA 1I3LA 2BH9A 2A9QA 4OG2A 3I04M 1W0CA 1A2QA 1LRJA 4QXAA 1Y3CE 4Y9SA 4D56A 1VKRA 2BN4A 4D57A 5BV0A 4LE0A 1HRKA 4KQXA 3NUZA 1JI3A 1OZ0A 2O2HA 3HVHA 3NHBA 1WCIB 2OAEA 4FDTA 4G89A 5BUSA 5CR9A 1L4HA 2DT8A 3VKGA 4U9UA 3M2TA 1KI4A 1DOAA 4DDHA 3GLGB 3G2MA 2X2PA 2ZTVA 4OI4A 3CNNA 4WNYA 4X85A 3PR3A 1ZM7A 2DUJA 3B2NA 4HS4A 4Q3CA 2VSFA 4QJIA 3VYTB 3VAZA 1JB1A 2P11A 4MQ5A 3DFKA 1O3YA 1NR1A 5THQA 3T0GA 3V7NA 2ZFUA 3QWBA 2GYWA 2L69A 5CHEA 4YRFA 5CLLA 1N9GB 4KIFA 3SKYA 2TRSB 5BN4B 4YAGA 1PR4A 4FGZA 4D3FA 4HGQA 5IC6A 3ZXIA 4J4HA 1ULUA 3C2QA 4RWZA 4IBOA 3EDMA 5DEOA 5G1NA 4BLOA 3P9SA 5IJ0A 4LRUA 5J5CA 3I2KA 3S5UA 2ZUBA 3ZHTA 4DQDA 4ZHSA 2ZIGA 3GNSA 4FNGA 5KIAA 4GDFA 3A31A 2AR9A 2JH9A 2BRUC 1YUNA 4PG5A 1J1IA 1FLVA 4NV0A 5DRYA 3V3TA 2VYCA 2C9OA 2GJKA 5HJEA 4BEJA 1RWPA 4B3TB 1FFEA 2J5BA 1YI0A 2X2FA 4LNAA 4G01B 4RGQA 1VCOA 3Q0TA 4CM4B 4OL9A 5AHXA 4IMRA 4L57A 2HT1A 1Q1BA 1FLNA 3LIIA 1EFPB 3ND8A 1IZ7A 2YUIA 2YY6A 4QVGA 4L95C 1QZTA 3ASVA 3GUHA 1OGJA 1EUCA 1W6RA 1ZESA 2FJ0A 3NBKA 4DCUA 5HYVA 2ETXA 3RS5A 3VJKA 2X6TA 5DHSA 3MYYA 4WAUA 2NV0A 3KL2A 2ZAYA 5EIBC 3C7CB 2AOVA 1NOKA 3PUHA 3TUZC 3BJRA 4K03A 2P2YA 2HWWA 3K5HA 4YDHB 3OCWA 1YZVA 3RJTA 3Q40A 1YJ8A 5EXDA 3M1AA 1X7YA 4MUIA 1I1HA 1TQ4A 3GB9A 3RSLA 4DBVO 3IAS6 5TQ0B 4BQFA 1AO3A 3MQ4A 1JXAA 2WJGA 2JW5A 3EZ7A 1CJMA 4DSNA 3P96A 4S12A 1KHHA 1RYEA 5CT8A 3BJIC 4H0NA 1YB5A 3TLGB 5AKIA 4F1KA 1K63A 4LJYA 2BMVA 2HA5A 3RABA 1F1BA 2DG2A 4HDNB 4HZGA 4EYKA 2Z2YA 1QZUA 1ONNA 2QYTA 1FP2A 1NXVA 2XNHA 3D7SA 1CP2A 2SCUB 2BP7A 3QEKA 3SC2A 4AN4A 4CKBB 1EFVA 1W4AA 1Z5VA 1ESNA 2XYRA 4N8SA 3MW8A 4OHBA 4OM7A 5ETJA 5JDCA 2XNCA 3K71B 2Z6UA 3QKIA 1JFSA 5DOZA 5TNXA 1U90A 4LOJA 5TQ2A 4FNMA 4PLYA 1Z38A 2XYQA 4G5QA 4XVCA 3MGBA 2AUNA 3OCZA 3AUXA 1I2CA 3I2FA 4N7MA 2QNBA 4YK7A 2JZCA 4X3CA 5EWLB 1OGIA 3VR6D 1XX6A 4BKQA 4CT0A 4D5EA 3V2GA 4MW4A 5J2TB 1USVA 3OHSX 3L7NA 4C6TA 1RQXA 4C21A 2NPOA 3NO4A 3GWGA 1ULZA 3GZTB 4G1VA 1MJHA 1X8LA 3V00A 1JH9A 1JZQA 2FHPA 2B92A 4HUTA 5JNTA 1T10A 3CF2A 4N5DA 4BN5A 3NEJA 2CZCA 2JDIA 1K7XB 2CE7A 3EEYA 2I33A 2LXNA 4LY9A 4J0KA 1RXIA 1SXGA 4PGFA 2RHDA 2WPNA 4TMTA 2V03A 3I2JA 1G7CA 3QXCA 1U0LA 3DB1A 2CBXA 3CGWA 2EG9A 2AMVA 3OQIA 2JVJA 5IUNC 5EY5B 2X0RA 3L7YA 4YRNA 2ZXFA 2X2EA 1QHHA 5JAOA 1NY6A 4GKJB 4HC4A 1M5RA 4AZTA 1N6HA 3C8DA 3KEGA 3ZCTA 2R6FA 3TTXA 1YZGA 3PYMA 2VWHA 1EGMB 2BJVA 4XTCS 4BRZA 5AICA 1M2FA 1R1DA 4RKEA 2IW1A 5K0TA 4R71A 2WJ4A 3T1YB 1E5LA 4OBBA 5TXGA 1P5JA 4X45A 4UVEA 2C4TA 3OU2A 4HADA 2JLQA 2NTNA 1Z7YA 3OX1A 3VH2A 3WL5A 1JPUA 2CVZA 2QQFA 4EJ6A 2B25A 3EG9A 1L3BA 4Y2VA 2IU4A 3D7LA 4B31A 2CFRA 4YBZA 3VJRA 2YFYA 1L4BA 2XCTB 3M83A 1ISHA 3NKVA 2OE2A 3R8XA 1T0PA 4L8FA 3IUEA 4NG5A 1PWHA 3BL8A 3VPFA 4MUHA 1YZQA 3VVCA 3MILA 1ZSYA 1BWRA 4K6HA 2ZYVX 2H5LA 2G76A 3UMBA 4DNXA 4CM9D 1YJBA 4C2UA 5CT5A 3Q8WA 3WLJA 1ZGCA 2YNMA 3ENKA 4RS3A 4YAOA 3WP1B 1LCIA 3BCUA 3FFTA 3QFRA 4BX9A 2PMBA 4HAWA 5DGIA 3UW1A 3GNTA 1L7PA 4RFLA 2YV4A 3COWA 4F6LA 1YB7A 2WLSA 3I64A 4JYCA 4BE4A 4EZEA 4FGUA 3TVDA 1I4WA 5I7VA 1JLLB 1L7MA 1BXKA 1ZNWA 2ZETA 3ANMA 1TA0A 4OH7A 1SBIA 4PPFA 4YJ2B 3NTQA 1KJWA 1USWA 2D1YA 3ESQA 4MYTA 1JKIA 3EISA 4LYGA 3KKMA 4ECEA 5AFSA 4MEAA 4KYTA 4M54A 3MERA 1KBQA 4B46A 3W2TA 2PU5A 4E1BA 4EITA 5TQ2B 4KOAA 3EQ2A 2R0QC 3BICA 5JCPA 2F3QA 3NB0A 4PWZA 2ZT7A 4FXPA 5LIPA 3PPIA 3AESB 5E6RA 2P7IA 4Z2YA 1M8JA 2Y66A 5IC4A 2HF8A 1T4MA 2GTIA 3COPA 2JFOA 3JD2A 4FW8A 1MIOA 1JHQA 1UKEA 1U2GC 1XJ5A 2BEWB 2C61A 2DTEA 3QELA 5J4HA 1PS0A 2J9ZB 4U7DA 1D2EA 1YCHA 4RGBA 1MUUA 4RJKA 4UE6A 4P6VF 1U7WA 1IUOA 4P81A 4ZOAA 4K6FA 4B43A 3N6VA 3ZW7A 3A6EA 4J9VA 3HU5A 4QULA 2IU6A 3NIWA 4RLQA 4Q24A 4C6TB 5L3QB 3P2MA 4NCNA 3T94A 3O82A 5D86A 2P6OA 1ISFA 3VDNB 4BJ1A 4DJAA 4CODB 4DMRA 4J6FA 1A95A 1QO9A 3BHNA 4DR7B 1OMOA 1GG8A 4B3XA 1QTRA 1YJXA 2AEJA 4I14A 4ND8A 4YXWD 5JBNA 3SE0A 1LDEA 2XWJI 2WF8A 5DI9A 5JANA 2ZRQA 4QOIA 2DFTA 2IPOA 4TX1A 2KQUA 3DAFA 4D7AA 1S9HA 2YVLA 4O02B 4BQNA 3EPLA 2CMFA 3KEQA 3ZD9A 1I32A 3L0SA 1Y42X 2D5IA 1RHUA 1UCFA 2ZI7A 3ETGA 1A4UA 4U1RA 5CFOA 2AFIE 1ZHOA 3ND9A 2ERCA 3OD1A 4L8YA 2XTZA 1YQQA 2GH1A 3SBOA 2OV6A 2FUKA 4LCBA 5CA1A 1E1LA 2W2OA 2BT4A 1LXCA 5J5AA 4Q5IA 5K3DA 1JKFA 4NRDA 4XX0B 4JU9A 4EA9A 4K9LA 3HXOA 3E35A 2I6TA 5EJ6A 3EIFA 3DEIA 4DDMA 2F62A 3D8TA 3WE7A 3O6VA 1EAMA 4EI7A 1RJGA 3KEOA 1L4YA 1OWPA 4KXUA 4LFBB 3RRFA 3FUVA 5HDQA 4FFMA 2A7XA 2OL4A 2A5DA 2C31A 2PSJA 1L9KA 4PN7A 2D3WA 2AOUA 1GL6A 2DPLA 1YQEA 3GDOA 3GGSA 3ZHUA 1CF2O 3QTTA 3T7IA 2JIZD 3CS3A 4QIHA 1C80A 3KYBA 4ILKA 2GJAA 2XCUA 2ZB2A 4JXJA 5KWIA 3BFXA 3W90A 2HV9A 1GPBA 1JMVA 1FDWA 3DKRA 3JAKA 5U1PA 3RS0A 3C1AA 1BW9A 1W25A 5KYWB 2FEOA 3MSXA 5HILA 3WYNA 1RYHA 2QRKA 1NLMA 4K6GA 5DXAA 1RCUA 4Y6QA 3BMOA 5G53C 5D6OA 4F7WA 1K6JA 1NJ1A 4B09A 4LHWA 1VCMA 3QWIA 3HYLA 4G85A 4IRUB 2FX5A 5DMXA 2BHRA 2QP9X 4WZAE 2KBEA 2H06A 3AEYA 3ED1A 4UDXX 5ICFA 2R97A 2PSDA 5EQTA 1JU9A 5EJFA 1H2EA 2ZG6A 5HIIA 3ZWWA 1JFFA 3TZ6A 1L4NA 1GEGA 3K4QA 3LVFO 4A8HA 2CNKA 1C4KA 4LVCA 5H5JA 2PQMA 3D59A 2OHJA 5AHKA 2ZKIA 4O8CA 3A6KA 1IAQA 3ZW8A 4S05A 2MSDB 3K32A 5DLQC 1J07A 4DCMA 4H4CA 2R84A 4O25A 4PSVA 2I6QA 3FYTA 2R8XA 3G0OA 1AKUA 1C0EA 2WD8A 4MAAA 4UJ5A 1RRVA 3RU7A 1SUWA 4W9NC 2C1EA 1K6MA 3DZFA 1CU1A 3QEMB 3LKBA 3O03A 3FOZA 4K28A 2VTBA 2O8BB 1MBZA 3OWXA 1SVLA 4M8KA 2TECE 4OHKA 3RU2A 2YIJA 3AVUA 1II9A 1USKA 3DOJA 4PONA 5DBHX 4CDRA 1JV2B 1BFKA 1F20A 2QSJA 2R6R1 2FYTA 5BOSA 1Z3IX 3HQ4O 1HDYA 2JHFA 2P68A 2Q7OE 3V4SA 2OBMA 3ZUGA 4Y2RA 2OXRA 1ECLA 1HYQA 2HA0A 4QNNA 4K9SA 1JIJA 1QP4A 1CSEE 1FP4B 1ZC3A 3DAOA 3ESXA 3OZIA 3WJ7A 1GG9A 4BE7B 1JYSA 1CB7A 1PZMA 2HK9A 1F8YA 2QLBA 3GT3A 3U19A 4IIUA 2CL0X 4KQ1A 1TW2A 1NV9A 1Y6QA 1UPAA 4JA0A 3N0VA 2FSVA 3RNOA 4C0QC 1X80A 1YI8A 2QX7A 3EZ6A 4HCJA 2XLBA 1TTQB 2FUEA 1NY5A 3B1WA 3QKSB 4P31A 1HH4A 4FOLA 5LB2A 5FWYB 3SR4A 3WGMA 5C3MA 5HKKA 1CDDA 1U2QA 2X86A 3EVFA 3OZAA 4UUPA 3DE0X 4Y7CA 1J2JA 4FKBA 2L19A 2AHOA 1NQWA 1GKLA 2NUTB 2V0NA 1E59A 4FMDF 4S1PA 3LFTA 4QYSA 4M1MA 1A7AA 2GMWA 3G88A 3IEVA 2CXSA 1ECGA 2QTHA 2WPDA 1Y3FE 3GFBA 5H16A 3TBHA 1RTTA 4RTRA 3RWBA 1ND5A 3L4JA 5I4IA 1P8JA 3ZTYA 4BNHA 2YJ6A 5EJGA 4BIIA 1B42A 1PEYA 3LKDA 4LXQA 5CDFA 3R3WA 3UWSA 2Q0HA 4C22A 5ALMA 3TTUA 4HBGA 1SRQA 3FOAA 2PV0A 3HUDA 3ZH2A 1NYLA 1PUXA 3M1IA 2UVPA 1JR3A 1NX6A 4IIBA 4KTVE 4RIIA 2FEWB 2YYZA 1EGQA 2MT9A 4ZC1A 3VR1A 4BMNA 4RXMA 4DUGA 1OX4A 4RKQA 5C80A 1JA9A 3SCZA 2ALJA 4JI5B 4FCVA 3GJ0A 1TPZA 1ZIYA 1P4AA 4GC9A 4DLVA 2FZCA 5BW5A 2A4MA 5DHFA 4ZAXA 3L4BA 3CNHA 5M7EA 2ONJA 4D8TA 4H77A 4ZJUA 1HDGO 3U3ZA 3R77A 3H4VA 1G8MA 2IYAA 2ZRHA 2WSSD 5AK6A 1I7PA 5DE3A 3ZQJA 2V58A 4JP5A 3U3MA 2RGYA 1GA6A 4RDXA 5BVGA 3VOAA 3RV4A 1DE0A 2A86A 1HURA 5K0NA 4ETNA 3PNMA 4GZMA 4RVOA 4AUNA 2I2BA 5TLSA 3L1UA 4G0WA 4W5NA 3VZCA 1J20A 4DY4A 1RJ9B 3VYUB 3I5AA 4EHBA 3JVIA 2G08A 4EG5A 1T26A 5B58C 1ISPA 1II8A 2SKEA 3I58A 4F4DA 3DDNA 1RXWA 4K2HA 2XMDA 3GOQA 3KD3A 5A9SB 3I9V1 1XZGA 2IGBA 4L73A 3A4VA 5ELMA 4Y0VA 1SGWA 1H5NA 4OFXA 1TUBA 2ZJ7A 4UOZA 4DEVA 1YIDA 3DZCA 4O4HB 3DA8A 2OQIA 4IYRA 3GARA 3S99A 1NXPA 3E8MA 3L93A 5IMSA 1TD9A 2PUTA 4HLCA 4ALJA 4EY3A 2CHEA 4CGYA 2NVWA 1PW7A 2FPMA 5EQFA 1FS5A 2PL1A 1OHHD 1TB4A 4TTTS 5KDLA 1IHUA 3UWOA 3CLTD 1H8ED 1Y7LA 2JPDA 5IAKA 4DADA 5F76A 1NVVQ 2VP4A 3RF6A 1EMDA 1TLFA 3QELB 4IXNA 2V59A 3GRVA 1WHTA 3UUGA 1QCZA 1YMVA 3ELBA 3MA0A 2BUBA 1DLIA 1MKYA 1YSCA 2XKJE 4BIMA 3OU6A 3RUIA 5BN1A 1VJ1A 2FDXA 4FC6A 1R8XA 2LDXA 3KKLA 2L42A 3NBQA 1OE0A 1FU8A 2J32A 4I55A 4BNIA 3FKQA 1WDKA 2XUDA 3FHLA 4LF4B 3W6NA 2V7GA 1XZAA 3H13A 1YL7A 4UAVA 4B8WA 3RCBA 2A9OA 4ARVA 2C59A 1PL6A 2G63A 1N1DA 4QASA 3REOA 1NXOA 4N6OA 4KLAA 2PY6A 2YN2A 5A62A 1J2RA 5LWHA 2LRHA 4FN4A 4MPJA 1YU6A 2IYOA 4MW2A 3SF8B 4HMPA 3SYTA 4K5QA 4GOOD 3PI7A 4E32A 1KIAA 4KSYA 1TIBA 3P2JA 1SQ6A 1MB2A 1SK9A 2V5AA 2CVHA 3MUEA 3NC1C 2WIDA 4MW5A 2CCKA 5JS2A 3WGNA 1XXLA 2GKGA 4FSXA 5ELXA 1NW7A 1TRHA 3D3EA 1Z4PX 1U8AA 1SC6A 4OPMA 4IP0A 2BGNA 1J90A 1RAEA 1P0IA 2WFLB 4OM8A 4BV2A 3IO5A 4RMNA 5T4BA 1ZHHA 3EWAA 5H80A 4ZEXA 1FFAA 1WM1A 1W5AA 1WZNA 1V16B 5D1NA 1C9MA 4RTQA 1DAOA 3H3FA 3F49S 2BZ0A 3BKWA 2ENWA 3OJFA 2VNSA 4FMPA 5KYGA 3DOOA 1N6RA 3CX4A 5CH5A 1RC8A 1SHUX 1P0MA 2F9LA 1YHYA 1F5SA 3KQTA 4TQGA 5FUBA 4CCAA 3HGTA 3RSQA 3L8MA 3D4OA 4N6NA 1JSZA 3OZCA 1W4CA 3BF7A 1U5AA 1V4VA 4ZTUB 1PJBA 5DW3A 2NUAB 3UG7A 4KE6A 2WU4A 1P2TA 1P2UA 1H2XA 1K9SA 3HCEA 1CJSA 2WWFA 4FEAA 2I9KA 1VCIA 2W6CX 4IOKA 4EJ2A 4U7WA 1ZMXA 2FR8C 2GFIA 1M6NA 1WNTA 2FPIB 2R1VB 4UD2A 4QUEA 4DLNA 2NU6B 3PPYA 1WD7A 2PZJA 2X8JA 3K9WA 1SY7A 4HRVA 4PSAA 5HKAA 2PXCA 2XDQB 3H6KA 1EM6A 5M34A 3LC7O 4MVJM 5IZCA 5D5QA 4Y1RB 2BW0A 3QLEA 3TLKA 3D2LA 3I42A 1WHSB 4HXGA 2HZBA 4J4TA 3V4PB 1SCBA 1N4AA 2GO1A 3J80A 2H5JA 1IB0A 1J2TA 4URHA 4GF5A 2DR2A 2OHVA 1ETHA 3DQZA 4EPVA 4CM4A 5F1PA 3AB8A 4HLNA 4PLWA 5KNBA 3AM1A 2TS1A 5A7FA 4KDCA 5F3RA 1KGDA 1KMHB 1OYVA 2GRAA 3ZS8A 1W5SA 3B6ZA 5B7PA 1DBIA 3X1YA 1X7DA 4DJDC 2R8OA 2XGMA 1YACA 3L0CA 3VO8A 3G2JA 4PW0A 2SCUA 1VI2A 1WDLA 5CFQA 1CERA 4HATA 5HCNA 1MA3A 2E4WA 1VE5A 1FDIA 1REQB 3AR7A 3IV7A 4LNUB 3K9LA 3GFQA 3ZK7A 1XBTA 4UCFA 3UJHA 1NQOA 4DNQA 5DT2A 4DEYA 1ZH4A 2ZK7A 4E5DA 1RHRA 3R6DA 3A11A 1NFFA 2Q4TA 1UPUA 2AQIA 1JR4A 2NTJA 3BHIA 5K3AA 3L8YA 1VYVA 4Q3NA 3LUFA 2NZ2A 5FTJA 3GFRA 3IBYA 3RH0A 4CRWB 5EJEA 3BT7A 3BDVA 5C8XA 4OQLA 1J00A 1BZYA 2RH4A 2PMCA 3GPCA 2SICE 2FP4B 1OPRA 1ZLYA 4OREX 3OIWA 1RJDA 2ZJOA 3L46A 3ZTWA 1JT9A 1COWA 1UKBA 1E8DA 2BL4A 4DCJA 4HP8A 2QVZX 4AIRA 3I5MA 5TDHA 1SKYE 2FTKE 4M46A 3C3WA 3JPYA 1KZ4A 2HNAA 3D4BA 1OH7A 1FSSA 3OPXA 4HR7A 3HXPA 1D2HA 4CGZA 4G0MA 3UPDA 9LDBA 1H1DA 1J22A 2W90A 3KKEA 3MMZA 4UZFA 4CTNA 4FEYA 2HAEA 3QLVA 4MWGA 2DHRA 1QZZA 2B1RA 5FPHA 5EZYB 4E46A 4JL8A 3CRW1 5ALEA 4Q3BA 4IUDS 3WSWA 5B1YA 3OA2A 2RARA 4LRYA 3TXYA 4DIUA 1MC4A 5K2MA 2FX2A 4US1R 5KVVA 4OQFA 1O5OA 1OFUX 2CD9A 3N9IA 4ILEA 3CVYA 2VPPA 2O8EB 1V39A 1A2BA 2R7MA 1H6DA 3X2EA 1BMFD 4LEIA 3BD9A 3HEBA 3VR6A 1CB0A 1N4DA 3RWOA 1A1VA 4HXYA 4DV7B 3R41A 2G88A 3A05A 3D3WA 3NWEA 2AG8A 2C2HA 3ESAA 2IIPA 3AR6A 1INLA 2G7MC 2GAIA 1OXXK 4ESVA 2X13A 3VZQA 2WA1A 5B3JC 5AW1A 2GBLA 3GJRA 4FD2A 2FGKA 4FQ5A 4MWOA 5JG7A 4ZDIA 3L1IA 1W93A 4YRRA 2NAFA 3UN1A 3FGPA 4Y2XA 3IV9A 3RVPA 3EVZA 3EXAA 2QM7A 4JGBA 1AGXA 4BPBA 3IQFA 4FMDB 2X1VA 3M6VA 1PT7A 3PPVA 1R18A 3FI0A 3GBVA 3DXXA 1XWIA 2NQ8A 3B38A 4QQ8A 3BORA 4TLDA 3P5BA 1N7IA 3IAHA 4UREA 2C4HA 3EDCA 4NU0A 5B37A 3JQFA 4ZRMA 1NURA 5HF6A 3V4VB 3WHLA 3ZBQA 1FLDA 1JMYA 4TMYA 2PUVA 2O06A 2D2IA 4UUMA 2R751 4G84A 3OPVA 1QIIA 4INZA 5D85A 3RSHA 5A6VA 2BCEA 2C0PA 2PNFA 2PX0A 4QHTA 3T6KA 2LCFA 2ID9A 2MIIA 2EIHA 2Q29A 2GO7A 3QBVA 4NOMA 4XLTA 5DM1A 2NP6A 2EFHB 4EP1A 1TFUA 4GBED 3UK0A 5CBKA 4G97A 3QMVA 4BVBA 2ZYSA 3BFJA 5P21A 3VGPA 1BXGA 2JIPA 4HI0E 5EIHA 4E09A 1G7SA 2C2MA 4LGCA 1XZCA 3COZA 3A7EA 4QDXA 2PZBA 3NOVA 3WNCA 2Q6LA 2Q5FA 3DGFC 3MEQA 3LBNA 4WCFC 1WW2A 3AEUA 3AEXA 2EW2A 2V8BA 4UPVA 3PUYA 3A6LA 4C5AA 5IJ0B 1T24A 1TEVA 3N59A 1IK6A 2OXCA 2ZJ3A 3UC5A 2XJ9A 1K75A 2DU8A 4JNCA 3TB4A 2FEKA 5E1BA 4DA9A 3D5QA 3VPSA 1BCRB 1R00A 2G1KA 1GR1A 1R8JA 1SG0A 1GADO 3C3PA 3L1KA 1BMQA 5KQGA 3U56A 3WAJA 3VOSA 4OXYA 4Y0AA 4UHDA 1Y8CA 221PA 1QMGA 2P3SA 5E7MA 5FFFA 5H70A 1FDUA 3K8ZA 4JX8A 1W581 1M6VB 4LWOA 2HA2A 2I55A 2QX9A 3ADKA 5KO2A 1T3SA 4Z4FA 3QHQA 5IEBA 3RG8A 3JARA 2ECQA 3BTUA 3D0OA 5T4FA 5FIUA 3WVNA 4EG6A 4AZ3A 3ZDDA 2OBNA 4I3FA 4M7OA 4NU6A 3SJUA 5C7OO 4WADA 3M7IA 1WS6A 2C5SA 2DECA 4IXWA 5KJ1A 1BC5A 1J2EA 1DIAA 3L6CA 4DCVA 3ASYA 4GXNA 1N5LA 4W8OA 2SHKA 1N7HA 2GSDA 2BOVA 2K5UA 2Y6UA 1PJLA 3JAKB 4OK3A 4P5PA 3CZCA 1VECA 4UFNA 1DEXA 1X77A 1E3DA 2TMGA 1QONA 1H5QA 1APBA 4O4LA 1JFTA 4ZVLA 4FVTA 5EYPA 4KIUA 4LC9A 2TYSB 1U2DC 4W8GA 4KLZA 3KQNA 4NECA 3ABRB 5TSDA 4IY1A 2WWVD 1QVWA 2YRWA 3UAXA 4K7JA 3HO1A 2CLIB 1TNDA 2ZLBA 3UJ9A 1G20B 1OAOC 4OFZA 4KVFA 5CA1B 5FBZA 1HETA 3LPCA 2OOSA 2PKQO 2ZKLA 5F23A 4JVOA 1DCTA 5BRJA 1J9EA 1NQVA 2ZIXA 3BGIA 4YMVA 3D2AA 1PJTA 1DAPA 2NUPA 3HBNA 3ZHCA 4PYJA 3CMCO 4OIFA 3HCNA 3IGFA 3N76A 3NCTA 1OSNA 1A1SA 4MV6A 4YRAA 4AWXA 2PYIA 4RZIA 1JEQA 1H2HA 2QJRA 4UUAA 3GJXC 4V0LA 4B9EA 1L9XA 1ZVKA 3UT5A 3PD7A 4P98A 3WQSB 3QYPA 5A5FA 1PQPA 5AT1A 5AWFC 1TZJA 4F2HA 3SJBA 3ZKWA 5M29A 3STUA 1U65A 1UJCA 1HK7A 3KJNA 2FA9A 2G70A 1E2QA 4QDTA 1V3UA 1CC1S 2YMLA 3EXG1 4R7ZA 4TTSA 2C84A 4ZRNA 3M3DA 3U39A 2DBVO 1GPKA 3ZWPA 1QOQB 3FYUB 2GAJA 1V35A 4QBHA 1UKVY 3ULKA 3MQFA 1Z4IA 2JGEA 1DC8A 3V2UA 3DVSX 1TC1A 1E2JA 2YWCA 4BFUA 3K1JA 5HTKA 4IILA 1AU9A 2HU2A 1CUCA 2WYWA 3ZHBA 5F3DA 2PJRA 4B71A 1EQUA 1LGYA 4OKIA 1G63A 4X8HA 2VHEA 4U7GA 3PDUA 4FFVA 5EE0A 2ZJ2A 2OZKA 3T5CA 2DH6A 2AQ8A 3B13B 3WKAA 3HA7A 3W5BA 4YV2A 4MA4A 1F0NA 3QVOA 4JITA 3ODPA 2HA4A 3ZGLA 3FNHA 5EE1A 3LX5A 4BNVA 1CNFA 3HFSA 4CQNA 2P2SA 1L5KA 3R3VA 2VUUA 3BYZA 3C6YA 5EXPA 4HJXA 2J59A 5F12A 5GY7A 3AZOA 2PLRA 3R7FA 5AI8A 2HLPA 2YXPX 1J99A 4ZO8A 2HWKA 2XTAA 3P20A 3QQ5A 4MA0A 1KEWA 4NNJA 1O6BA 4XIGS 4KQEA 3D4NA 2XI4A 2WF6A 1QE0A 3OTOB 3OZ7A 1HMPA 5HK8A 4B4OA 1I14A 1BCSB 2RGWA 5KHAA 4E88A 2W2TA 1A5BB 1T0IA 3B5IA 4I3HA 2KBFA 2YRXA 2Q2WA 1NKSA 3T34A 2HJVA 4MS3A 4MYCA 4Q48A 3X1DA 4DLAA 3KXLA 3IAM6 4LPSA 3RK4A 4CLEA 3KM0A 4H4EA 2CXNA 3ZIAA 3P2OA 3QKWA 1SUBA 4PO3X 1Y1TA 2PGNA 2Q4EA 3KYCA 4J16C 1LF5A 5IM4F 2IPXA 4Q4LA 4W1SA 4EO7A 1X1AA 4K3UA 4PZAA 5LQKA 3D3NA 4K9KA 3NM6B 4D6YA 1OHHA 1AS3A 4IRMA 3WK4A 2R66A 4F4UA 5EFZA 5TJ9A 5IK2D 1HZZA 4JBWA 2I0FA 4RHEA 5HJ7A 1CS0A 4JEUA 4PVCA 4UNQA 3TOSA 4K86A 1U2PA 3YASA 4R98A 4CL8A 5L8VA 3W6ZA 4RK7A 1VYHA 2QP4A 3P7MA 1F51E 1GU7A 1MC1A 1Z29A 2HTEA 1Z34A 1RZUA 2GRJA 2VDOB 4IHQA 2G5TA 2O0MA 4MRVA 5FHQA 721PA 4X6XA 1UKYA 4M1QA 2VDVE 4FYVA 3RAPR 3ZPXA 4COOA 4DIOA 3D43A 3VPGA 3CZ5A 3EIWA 3AJAA 1D7OA 1EFLA 2F3RA 4JKYA 4P82A 4M9ZA 3B8EA 5TJHA 3ZWCA 1E92A 1V5EA 3OF3A 3O4JA 1XQ6A 5FBVB 2ZVQX 4WFQA 4F60A 1KMHA 1S7CA 5FKJA 5CXQA 1NOJA 1NVWQ 3CEMA 1SURA 4E7PA 1CR1A 2ZBRA 2JFFA 3CJTA 3QE9Y 1ZMOA 3RT1A 1GU1A 4UVHA 1TMGE 1XQVA 3OIDA 3PJRA 1JQ5A 4HVAA 2F8LA 3FTEA 3P32A 3QBTA 3I9V6 4YJFB 4KGXA 3AEKA 4JIMA 4XWOA 4H9GA 2GPSA 1U2RA 1WF3A 2FUNB 2ILVA 3CCBA 4FNAA 4Q1FA 4J2TA 3N2LA 1NP7A 5CVVA 5C46F 5CYGA 1EX9A 2VP5A 1UDAA 4YAEA 4R2LA 1KO5A 2AX3A 2O9JA 3GEPA 1R4NA 2VDQB 5EXTA 2UYOA 1IEXA 3KUUA 4H7KA 3U5TA 1TQ2A 4KR7A 3GY0A 1I36A 1JKJB 5MN5A 4L2IB 1CJVC 2P4UA 1BCSA 2XT6A 3CLUC 5JNVA 2C9DA 2VJCA 4OKSA 1KSFX 1Q3HA 2AD5A 4EJFA 2FFAA 3D3KA 4S1OA 5DDIP 5KJFA 1SXJE 1S2LA 3IBFA 3ZZ0A 5IKXA 2RHOA 3E3AA 1Q83A 3C3EA 3KPJA 4KZPA 4PG6A 2RGBA 3MTAA 4MAFA 3OTQA 3NDIA 3OIUA 1E99A 1GFIA 3IMGA 1Y7IA 4EY6A 4BFZA 5B30A 3GRYA 1A9SA 1QHNA 4MOWA 5FLYA 2GM5A 5BR1A 1BYUA 1ZJ6A 1Z6QA 1AVTA 2BEUB 1IL0A 1DAIA 2PJZA 3ON5A 4OSEA 2FAXA 3OCXA 1H94A 4BMXA 4Y1EA 2F1OA 3L04A 1XDZA 4BO5A 5JFGA 2PUCA 2H5IA 2PUBA 1WLYA 3TAXA 1PLLA 1R0ZA 4YJHB 3OJLA 4RHTA 3RIHA 3VV3A 4E70A 1TK2A 5TGTA 1NZFA 1X6VA 3F6YA 3G8YA 1PEKE 2ZT8A 1V2GA 2ILTA 3KHTA 4M37A 3U6KA 3HXKA 3U49A 4JY7A 3OURA 3RG2A 2H2AA 2HBRA 3P9IA 3OQJA 2ESRA 4HWRA 4I4NA 1QV6A 1TKRA 3ECSA 5CA0A 1A9QA 3MTEA 1O6GA 3EOZA 1ZUNA 4P33A 4TLAA 4A6PA 1UWLA 1R16A 4A1OA 1QQAA 3RFUA 4OJNA 1F17A 2VDWA 4DCNA 3ABQB 1W1UA 4OMUA 3H2IA 4K3VA 1ABFA 2XDYA 4IW3B 3N3BC 3NDJA 1DC6A 2X0IA 2ZPTX 3LBIA 4N1AA 1N57A 4MR9B 5TVKA 2FZGA 1R6UA 2FQXA 3OM8A 3QKUA 2C54A 1ZEMA 1F8FA 4GFDA 1I2MA 4LHYA 4BLUA 1D4OA 5IKEA 4MRAA 3FPJA 4EY5A 2IYFA 3T3IA 1AN0A 3O21A 4UM5A 2CMGA 3V48A 1V96A 1L2TA 1LQ2A 4I0WB 4AVYA 3DBVO 3W05A 3PQFA 4FCTA 4IFTA 4QU9A 5FP0A 3GFPA 5JWOA 4QVIA 4I9FA 2Z2XA 3MMPA 3C24A 1UBFA 5LNK1 3KLOA 2QTVA 2QN6A 4QVKA 1PR6A 3BCHA 1M0WA 1MO3A 2DHQA 4JUCA 4G2NA 4FSDA 3H9UA 2PEYA 1OIXA 1AN9A 4LC1A 1XJQA 3E03A 1YS2X 2PJDA 2J08A 2N75A 1MR3F 2DPHA 3TTYA 3I1IA 4GT1A 4RSGA 4YXFA 2RK6A 5ALZA 3HN2A 3C5EA 4HZUA 3EDOA 5HJ5A 2P1DA 1DKLA 1O95A 1XCPA 3IAUA 2P41A 5J2UF 2DHEA 1DDGA 2H54A 3A6GA 4L5CA 5KYXA 3JWIA 1HQDA 1WEKA 2ATXA 3HYTA 2GARA 3TGLA 3TLXA 1B41A 1JI0A 3DXFA 4BP8A 3AZQA 4DC0A 3K92A 3B6EA 4RMHA 3TLYA 1IHXA 3BEOA 4TUYA 1IXKA 3OIVA 3AIIA 4CF3A 4YUVA 3O4FA 2R6GA 1IBKB 2C2KA 3FPGA 5D3MB 5AXAA 1ILWA 5JD6A 2XY4A 4HDKA 4EFLA 4GX2A 3N6RA 2LZ0A 1NGSA 2GCOA 2H29A 2WUEA 1UFOA 2B30A 1A76A 4XR9A 1NBME 2B37A 1TJNA 5FPYA 5ENZA 2R2GA 1DMSA 3L6UA 3CH6A 3WGHA 4NBVA 1L5VA 3JZDA 2QRQA 7MDHA 2BI7A 3FM9A 4NU5A 4KYUA 1Q0ZA 4E21A 2NUPB 4PFJA 1JUDA 3W9UA 1U2DA 4RF5A 3O83A 2JGMA 2QLNA 4NENA 1LBIA 4Z5XA 1PWYE 2C9BA 3HV0A 3OF5A 3QYFA 3JD1A 2I65A 2ZJZA 5F7JA 1LLFA 1W29A 2O5VA 5HR5A 3RROA 3SQOA 1AH2A 3M1YA 2R7NA 2FRVA 2RCYA 1Y4UA 1TCBA 2OECA 2Q1TA 4PC2A 4ZT3A 3R8CA 1DKQA 5EQDA 3IMEA 3QKSA 4CQLA 1FJXA 4G1UC 2AFHE 3LJKA 5KHOC 5EYPB 3HACA 4W4TA 3HVUA 1E2LA 3RVNA 2GBCA 2OCGA 3K8QA 1PD1A 5DNVA 1ZL2A 4F84A 2HL6A 1TCCA 4XD7A 4D3DA 4EB8A 2UUPA 3I34X 1H2BA 3R5SA 5K05A 4DV5B 3R9XB 3EULA 2Q4BA 2XPCA 1E1RA 3B89A 3NBMA 2A35A 1P1KA 1SN7A 2FG6C 4I4TF 4D99A 2WHRA 5CLFA 3PP8A 3LD9A 1BD4A 4PBTA 3A4MA 1F6DA 3SC6A 1U2TA 2OXEA 2HPAA 4RM3A 1HT0A 1QGAA 1O96B 3EFOB 4IIFA 2FN8A 4N18A 1KKLA 2D62A 3IP1A 1NPYA 3A06A 3OFSA 2NU9A 1EUYA 1G60A 2NV6A 1ZGAA 2M6SA 3F2IA 2PUFA 1WTAA 3VNQA 1UOEA 3TKYA 4BQQA 4F21A 1D07A 2JIMA 1NVUQ 2A3RA 2VCEA 2AOTB 3WZ2A 2EKZA 1WPGA 3DKKA 4AP9A 1Z74A 4LZJA 5AESA 2W2PA 1A82A 1B6TA 2C42A 3FBTA 4FILA 4DG9A 2Q3FA 2X0NA 1GV1A 3UMGA 2PL5A 1KJJA 2LPMA 1CUJA 5CYPA 4BMVA 3O7WA 2GQ0A 3NV7A 1EX1A 5CIWA 3KAQA 5HX7A 4LXIA 3E7FA 4WLVA 1KYTA 2Y1DA 3WIEA 1AZSC 1XMOB 2V7QA 3EW9A 2DQZA 2PKYX 4MR7B 4ZYVA 1Y9ZA 3GPBA 4B7UA 4MAMA 4BVJA 5A0FA 1H66A 1W87A 4HTAA 4CM5A 1Z2OX 1RWWA 4E7OA 3BIXA 2F43B 3RWMB 2A8YA 4NBNA 2YZMA 3CIOA 3HVJA 4DCCA 5HZMA 1WBDA 1NJ5A 1LS1A 1UM8A 1W44A 3Q3IA 1R0LA 4OHZA 3T7RA 3WNQA 1E2EA 3MRVA 2QN3A 2B69A 3F3MA 2REQA 1EK1A 1WRBA 5TS2A 3ER8A 4B33A 1JAHA 4UVDA 5LZ5A 1Z68A 1GL7A 4U0KA 4YT5A 1TF2A 2IUSA 3GVHA 3O7MA 4UM8B 4XYEA 2NSJA 4X91A 1IY9A 4H16A 4ZK6A 1Q1QA 2NZ8A 2ETVA 2JCGA 3PS9A 2FPGB 3B1JA 2BBOA 1BWSA 2PO5A 2H6EA 2P0EA 2OK8A 2FZKA 1ZKDA 4DMMA 5JECA 3H5AA 3OLQA 1Z2PX 4TSRA 3C3YA 3PQ3A 3NW9A 5K4AA 2Q3JA 4OHRA 5BW6B 4NOJA 3GAFA 1U0JA 1U31A 3QX9A 4NESA 2EFEB 1KS9A 1SBCA 1TEXA 3TKAA 4BYMA 4NMXB 4CIYA 4JXXA 3KDPA 4LMAA 1A8PA 1ISJA 5FL7D 1CYEA 4Y2TA 2APJA 3QJGA 4CIVA 5KSZA 2BDEA 2VUHB 1BW9B 2VPTA 3KHSA 4HQ0A 4JP1A 3STHA 1GSIA 1S01A 3OX4A 4KNVA 3EHEA 4HH1A 1Z7BA 3VM6A 3AXTA 2BC9A 3RO7A 1D9XA 1PHPA 2YJZA 3GHYA 1VGVA 2C7RA 1Z33A 2BUAA 4GR4A 2JASA 2I4IA 3NNDA 4LV5B 2C2XA 1QK5A 1M74A 1QIHA 4Z4CA 4XXHA 4N5LA 1MQSA 4WESB 1ECBA 4CUZA 3T52A 5IAOA 3IBGA 3B12A 4B6EA 1NXWA 1HSZA 4D2IA 2QU8A 4X1YA 3R2JA 3EZLA 1SVWA 3DZKA 3ORHA 5DLDA 3IXQA 4BX2A 1N5JA 3DSRA 3QWHA 4OOEA 4ND1A 4OF4A 4RA9B 3ZU2A 3BKXA 4IIJB 3FCOA 4KG7A 1PVDA 4MIKA 1FMFA 2QMEA 3ZE8A 1DO8A 1JFVA 3NC0C 1ZVJA 1D4FA 3ZDEA 1ZJ5A 1B43A 1EQ2A 1SUCA 1Z82A 3A1SA 2BEUA 2I29A 3A37A 3P0JA 4Q3KA 4XQGA 4E5UA 5J4LA 1O03A 2PK3A 1CP3A 5TEWA 2P35A 3ORSA 2CD7A 4Y6PA 2E37A 5HKKD 4B6GA 3UK7A 3RR2A 2G9NA 1DVRA 2QUZA 3GN1A 4XGKA 3VR3D 5CJPA 1HDCA 1HRDA 5BQ5A 3WS7A 2W2XA 4H15A 2O14A 3KR2A 3OQIB 1QAMA 4HH4A 2BJWA 4WL0A 1Z06A 2FUG1 3N7TA 3V7UA 2HIHA 3O4GA 1NG9A 1ZA1A 1M1XB 1A9TA 4G2TA 4PO8A 4QDZA 2II6A 1YL6A 1O5TA 4GECA 1EVZA 3K5PA 3PXUA 3AGQA 5LMNB 5I45A 2VOEA 3PNYA 4IF4A 5DV9A 1IEVA 3D2CA 2ID7A 5M3BA 3Q8KA 3GXOA 2HDWA 3KR0A 3TW4A 3FBWA 4E0BA 1WF6A 3OD5A 1H85A 4W82A 1G3UA 1PFKA 1FLAA 1POXA 4LTDA 4Q01A 4CVNA 4CEHA 4L0QA 4O1MA 4FHEA 2E2WA 2AFHB 2BSXA 4N0PA 4B4WA 4DJFC 2R1ZA 2VPIA 1URPA 2ZE6A 3TXXA 2Q6OA 3B1FA 5FBLB 5IBCA 4V0SA 2HGSA 1PF7E 5L6LB 1P61B 2E87A 3GZNB 4HYEA 1OYWA 3V9AA 4FX2A 4YBRA 4B82A 2PUDA 5JCZA 1TK9A 3PI6A 9ABPA 4KGDA 5K0FA 3UB3A 1XCBA 5IDXA 5JSUA 1TDJA 3UWKA 1MGOA 1T5DX 3GLHE 4L0DA 1DJLA 3DLAA 2DBQA 2LD4A 3NOXA 2Y1XA 2FRXA 1CR4A 1KO1A 2JGLA 4UUOA 4X7BA 5BN5B 1P1HA 3KOOA 1UP6A 3ROKA 3GVIA 5CFPA 4AJIA 2YOGA 3BJMA 1YB2A 4N82A 4EB6A 2BI4A 4JP2A 5JAQA 3ETEA 3IHLA 5HZGA 3OA0A 4RSMA 2GT1A 2R9VA 5IWCA 3CXUA 2NTEA 1Z6YA 4B3CA 3LXXA 1KY2A 1WZ2A 3IT3A 3WK8A 1LVGA 1M5TA 2PL3A 5DYYA 3ZOKA 4UTRA 8ATCA 2YXBA 3FTFA 3DAHA 2OFFA 3OFND 4LIPD 1WZEA 2V5UA 4AK9A 3A6DA 3HPQA 4E2YA 3AMVA 1NN5A 1AUVA 4RKWA 1V8ZA 4IHJF 3V7WA 1R8YA 4OH1A 5IM4A 2H17A 4WK2B 4FWTA 1RYDA 5GGYA 3GFFA 3BXFA 4P5DA 1T3LA 3RVQA 3A28A 4KN8A 1SUIA 1VSQA 2QJOA 3G9TA 1ZK3A 3OETA 4Q1CA 2PT9A 4BKRA 2QJFA 3OE7A 4RHFA 3IA7A 1VBMA 2VATA 3IV6A 3U48A 2F90A 3DBOB 1RQGA 3EPHA 2G0NA 1N5OX 2EF0A 3NHLA 4FYHA 1ODLA 3CRVA 3FGZA 3WB2A 4EATA 1GYRA 5EE9A 1JEYB 3EBPA 3Q7EA 4PZUA 5IBPA 2P9JA 6YASA 1NN1A 1T9KA 4F9GA 1CIPA 1K8RA 4Q39A 3KZVA 2Y1GA 2P5TB 2VLIA 4ZGBA 4OATA 4C3OB 5ED0A 1QG2A 1QH0A 3DE4X 4XFJA 5K6AC 1U7ZA 3E05A 3AP2A 3IAM1 1IZ8A 3F6RA 2ZCVA 5BN4A 5T4HA 2ZR0A 3NGMA 5EJ7A 2QTTA 3X1KA 4D9NA 3EJWA 4ADSG 1PVVA 3PRJA 1CG6A 2JLBA 3G8CA 1VKZA 1VJGA 1SBTA 4MTLA 3NVKI 1H8HA 5DVZA 5FAKA 1Q3TA 5MF6A 1LW6E 2HRQA 1DADA 4QL3A 2ZTLA 1JR3E 3GCDA 1Y7HA 1VLJA 1ZIOA 2WF7A 2B21A 3GGGA 3C15C 3L5KA 4JHLA 4OHXA 5HMLA 2DPXA 4MWSA 3IJ5A 3VOBA 2ZYHA 4J2OA 2ZWIA 1T2NA 2OLEA 1VZ2A 2GVZC 3D7MA 2FOXA 1R9NA 1X3SA 1XL0A 5H3HA 5M5BA 1ID8A 4LY0A 4RIHA 1BXRB 3NJRA 5TMEA 1IE3A 4MDEA 1TUIA 1SHLA 4AKEA 3B51X 3MTDA 3ICOA 3I6YA 3BL5A 1QOPB 1O6ZA 5IBQA 4A0GA 2E89A 3ZD8A 3BH0A 4C0LA 5BNWA 3UAWA 5C5EA 2ONZA 4MTCA 3A3OA 3CIFA 3IILA 5CYOA 1V48A 2QWXA 2H4FA 3K0KA 4ED9A 2UKDA 3N39C 5F2EA 5G4KB 4OI0A 2D0OB 2PMDA 3OTWA 4Q7EA 5EZ5A 1DXOA 1WHTB 2J9YB 4IGEA 1FPMA 5KNDA 4BY9E 3DWEX 1P7VA 2HCTA 2WINI 3M5CA 2KMLA 3DAYA 3M6MD 3NCHA 5DM0A 1BCRA 4RUKA 1K3UB 4QAJA 5JATA 4ZAYA 4NBLA 1L8XA 4H3KB 5AW3A 5HIKA 4M8NE 5CU7A 2ZZMA 4L50A 1WW3A 2EZ8A 1TF7A 5KVCA 4OMFG 3OE4A 4GKKB 1Z0SA 2CHGA 3TGWA 3ANXA 3GROA 2JHCA 4N5IX 4RVSA 4S1TA 4H59A 4J76A 3TZEA 1E7YA 4AJKA 1VI5A 1VIMA 1V3TA 2QRVB 2RIPA 4KPGA 1KEEA 3HXMA 1SVOA 1Q21A 4JS0A 1TAUA 3T4XA 2EFYA 3O2NA 2NU7B 4X7PA 3EPKA 3LL7A 4HWGA 2A1IA 3A1FA 4FYWA 4OXIA 1N6OA 4O2AA 4TYPA 5LN1A 3FZGA 1Z6AA 3BMCB 3CWZA 1KH3A 1XTJA 4CI9A 4HVLA 1D2GA 3OEWA 4KWHA 3TR5A 4LVUA 4I36A 1VE6A 3AHHA 1IBSA 3Q6IA 1FK8A 10MHA 1KKMA 1OC2A 4CWAA 1G8YA 5FBHA 4KR9A 2X7JA 3S8EA 4YUAA 2IS4A 1TVMA 1Z4NA 2BTQA 5JS8A 1XN1A 3OBBA 4M36A 3C0KA 3HSSA 3K0AA 4L5BA 4D9IA 3EXG2 4QEKA 2QAGA 3GUUA 5CB8A 4MV3A 3AV3A 2BONA 3LYHA 5BNIA 4BGVA 2C5BA 2EP7A 3M6AA 4C0XA 4CKZA 1IBLB 5F35A 1QFXA 4Z7NB 2B5WA 1FRVA 2PX5A 3NT2A 3CGGA 4XDZA 2BMWA 5DWQA 1XC7A 2EOAA 3FWYA 1XALA 2C78A 1Z4MA 2RHCA 3ICQB 2OT3B 5LA6A 6REQB 4HDSA 4GD3Q 2AI1A 1RDFA 2H9YA 5H59A 3IMKA 1PG0A 3IEIA 1YZHA 2HMWA 2FCAA 2C4NA 5FRDA 2W4MA 1C3VA 2VSNA 1DJOA 4L8VA 2YZGA 1QJCA 2G07A 5K0JA 5KUTA 1WP4A 1KARA 3RKRA 1P74A 2D1FA 1VP3A 1E1KA 3IRVA 1MPTA 3KV3O 3OESA 3QNMA 4CETA 2JLXA 1CTQA 2FZWA 3IDQA 3GDWA 4A8JC 4MUXA 3VDRA 3JRNA 3KEFA 1GFSA 2BGTA 1FFBA 3GHHA 5LQSA 2OXFA 3CNEA 3GUYA 2EX0A 4JEIA 4GSYA 5CYFA 2VK1A 2ZANA 3WIDA 3KELA 5DBIA 2LCIA 4BVGA 2GD2A 4HB3A 4BNZA 1HYHA 1DKPA 2FWJA 3ILVA 2VS1A 3LQ2A 2K87A 3FVWA 1RI3A 3ND7A 4IXDA 1T8SA 1UT5A 1A97A 2CFIA 4WHMA 5JQGA 3L7MA 2A0WA 4UU0A 5JTUA 1BJKA 4OJQA 3X2SA 1HNZB 3RTEA 5E6SB 3RS7A 1YT5A 2VT3A 1R5BA 2W6QA 1DJMA 5AKGA 3TFOA 1JHDA 2VK2A 1T1SA 2H4HA 4LBVA 4N3AA 4TQAA 4GLBA 3KCNA 5LOVB 3LZCA 1VE9A 1OW3B 2XQKA 3UAZA 3UIEA 1ZD9A 2AKAB 1A9PA 3D6NB 4PO9A 3VR4H 4BL5A 1D1SA 3L9WA 2F9MA 1W2HA 2RCNA 4LTNA 4KODA 2PX6A 3BMXA 4TLMB 1ILEA 4TT3D 4FZVA 4DMHA 1JLSA 4AS2A 5IASA 3FOCA 4GXTA 1Y4SA 3RKSA 2CDNA 3WGQA 4WOJA 1VJ5A 4R8RA 2HDOA 3BWDD 4DIFA 3EGCA 1RKXA 1QGDA 2WAYA 1L7VC 3LECA 4KQ2A 3AV0B 5HUJA 2GX6A 5FOVA 1A4XA 5AK4A 1CQIB 1D8AA 3D8BA 2BTQB 4KX3A 2D5BA 2FSPA 2NG1A 3G1TA 3S7TA 4LQ4A 1VTKA 2H1SA 3C7AA 1VMKA 1SU6A 1LTKA 1V41E 2EC5A 1RAFA 1Z3CA 4F5ZA 1U4OA 5A5DA 2VO1A 3HCOA 4QXRA 4UEKA 1R8SA 4GYJA 1O8BA 1LF0A 2NU8A 2R6DA 2QW8A 4O4HF 5ALJA 1SCJA 5GZ6A 4OY3A 1RFLA 1BA2A 1RBYA 3DZJA 5JTTA 2GEFA 5AI4A 1EE9A 2PGDA 4ND4A 3VAYA 3Q8LA 1E94E 3GNLA 3IVMA 4KSBA 1GUYA 2IXGA 3ZLBA 2OBYA 3BWYA 3M4JA 4CPDA 4RAQA 4MVJD 4AF7A 3KSRA 3ZK9A 2YV2A 2GN8A 3FSEA 4BAUA 5K0ZA 5K8LA 3KTAB 3HCAA 1SR8A 2A57A 2P30A 4CCWA 1H0KA 4AKGA 2J7PA 1E9AA 4P5EA 2X4IA 2Q2QA 2ZRCA 3B3GA 1OT3A 4UQOA 3W9SA 4DM7A 4DDWA 5JJIA 4LW8A 5T5QA 1Y3IA 3EW7A 3S2SA 1JTFA 2VDNB 3IVAA 4FCCA 3LT4A 4XE5A 4ZI5A 5IT0A 2RD2A 2Q5OA 4AQ7A 1QRAA 3HMQA 3WIBA 4D3ZA 3D0QA 2VDPB 3VZPA 3TVYA 3N0XA 1ZGHA 2C95A 2OFPA 3AT1A 1JW9B 2JRLA 2PGIA 1B3RA 1GNQA 3MWDA 4GIBA 4L4SA 5JH7B 3FNQA 5LBTA 1PJ4A 5IULC 1HZJA 2Y71A 2P7HA 4MEJA 3MTBA 3JQQA 3T99A 2DYKA 2ZYTX 3QF4B 4L6IA 4YAIA 1NE7A 4RF3A 3FDZA 1OWLA 1R15A 3KXDA 3MBKA 4DIDA 2GJ8A 2RH9B 4C2BA 4MINA 3VU9B 4EB0A 3TFWA 5IXJA 1DP4A 1KRHA 1E6UA 3OE5A 1Y80A 3EE6A 3LCCA 3KB6A 4FGSA 4K81B 5E2IA 5JSYA 5IP5A 4BN0A 1T5BA 1G59A 4TTQA 3I62A 4A0HA 1GP2A 3UT0A 1AQLA 1HLFA 1U9ZA 3DD5A 4YV7A 3CZ9A 3TQFA 1JJVA 1NF3A 3F7NA 1BEZA 4INPA 3QPWA 4BFVA 3SP1A 4F4IA 1J7JA 3FMOB 1WUIS 4HFJA 1IWPB 1XL1A 1E4OA 1T29A 2CJFA 3BEDA 2OV3A 4GX1A 4P53A 3DZBA 2FU5C 4X3PA 3REGA 3ETJA 1JJIA 4NEQA 2CNOA 1F6BA 5JXJA 2ONYA 2R8EA 3A3NA 2G9RA 3DCIA 1RWKA 3EVDA 1X7XB 3A1VA 3DEKA 1CCWA 1EWVA 2IYTA 1Q20A 2E4UA 1SOUA 3EASA 4N39A 3WAGA 4Q00A 4AZWA 1YS7A 5J4KA 2DFDA 1XLTC 1KERA 2A78A 1MH1A 2AFVA 2G8LA 1IEQA 1X7WA 3D6MA 3FROA 2IEZA 4UTOA 4RJTA 1HT2E 1OC4A 2VAVA 1IH8A 1XA0A 4PYQA 4EO4A 2ECPA 1Z63A 2HJWA 4DA4A 2QRGA 2HW8A 5JC8A 4I50B 4P4SA 3UPTA 4DSOA 1R4AA 2R7LA 3TCNA 1G0OA 1JQBA 2I3AA 2HK7A 2QBYA 4B7ZA 4EHNA 4KDEA 2XSZA 3CWCA 2CNDA 1FNMA 2I8LA 1I0ZA 4A6DA 2HA3A 3GV0A 3ZCSA 4EG0A 1BWPA 1PK8A 4C06A 5K3OA 1XWFA 2FR0A 3GLSA 3KE8A 4ESOA 5JYEA 3K09A 5K9ZA 2W6PA 5ECDA 1CJBA 3ER6A 3Q7PA 2NVOA 3HEAA 2ORED 3BD8A 3AJ8A 1NDUA 1PT5A 1ZUNB 2CEKA 3QUBA 4KWCA 3DPSA 4L22A 3S3TA 1UMCB 3TW6A 5C37A 5J4YA 5KOHA 1KAOA 3EFHA 1E1DA 4GQIA 4I5FA 1G2PA 1W59A 2WFLA 1PE0A 1R12A 3QX7A 4D79A 2HFKA 1R4MA 2XUQA 3FXAA 1SUEA 5K0EA 5GONB 2JGDA 3D4PA 2FETA 2H11A 3BOSA 5ALSA 1P0CA 3ELUA 3V5NA 2WIFA 1Q6YA 4A03A 3ZYZA 4D96A 4F9TA 2J3LA 4ZT6A 4JBNA 1GUZA 3JQBC 4JBHA 3DTTA 4PZDA 4ZO4A 1UPTA 2G83A 1NUSA 1CD5A 2KS6A 1C29B 3I4LA 3GQBB 1J39A 3OLCX 2XE6A 3B60A 2A5JA 3DBLB 2F55A 2BHTA 2X0FA 1MB4A 1NUPA 1CUHA 2P2GA 2D2FA 4K9QA 1Y6RA 1YMUA 4JYZA 1U8YA 4US0R 1QIEA 3ED5A 2EW8A 4HGPA 1OBOA 2CWWA 4BO9A 3DE6X 4JNKA 3NOQA 1KI2A 5HRCA 4P7BA 1N8NA 2YOHA 3RVMA 3N2GA 1YZUA 3MT8A 3ESZA 5KTSA 3RVOA 2PS1A 3DE5X 4UAJA 4QTZA 3S1LA 4B2LA 5EUBA 4I4CA 2QRLA 2E4ZA 4IIJA 4MW6A 1T9DA 3E84A 4ZOEA 3ESRA 5EUQB 1R4MB 2J3HA 2CDCA 3O84A 4JSYA 4H7JA 4BBJA 2PKXA 4ME6A 1PX2A 3PRHA 5M2QA 2I66A 2AJBA 3G2NA 3ZWAA 4CXMA 1EWYA 3AH8A 4AZSA 1C8KA 1PJZA 3R5TA 4DDTA 4P7GA 3MINA 4AO8A 1CYDA 4BB9A 1WMFA 1BN6A 1DARA 1I7LA 3E27A 2A84A 4FJ0A 4JJFA 5CW1A 1D0VA 5IK2A 5A9SA 1FZTA 4OI1A 4BMSA 3ILSA 3QU7A 2QUAA 1R5NA 3F8SA 4F9FA 2XA1A 1V7PC 1G8GA 3BTVA 2QT1A 3HO6A 4NVRA 4O4HA 3RHFA 1XMQB 4J94A 3FDZB 5ECGC 4UNIA 5SYMA 1ZCAA 2P1RA 2RK3A 1RACA 4KO2S 1IZYA 4R1LA 1JEQB 2YMMA 1N92A 1JAIA 4GPEA 4MI9A 4JJ8A 5THXA 3R24A 4TTAA 5AIAA 3RYFB 2Q1YA 1BFUA 2W5UA 4NDAA 2YH2A 3WLKX 3EODA 1CUBA 4BRSA 5C4IA 2C0QA 2BHLA 3P0EA 1XNRB 1I10A 4MKFA 1SCDA 3RU3A 3KALA 2OGUA 2IE0A 5TGDA 1U0OC 1X7GA 2P8SA 3BE5A 3A8TA 4Q21A 1NASA 5GAJA 3HYNA 3A2MA 2JJ2A 4BNJA 1J24A 1Y1RA 1MENA 1BU5A 1H1TA 1WWKA 3LE8A 4L6AA 2R5NA 1TTPB 1FP7A 5K0LA 4DDUA 1OX4B 3AKDA 1XU9A 2LIPA 2V7BA 4FT4A 4QRDA 4D9FA 1PSZA 2O5CA 1GN8A 1QU2A 2QZZA 2O2YA 3VR5D 3ZVMA 1ENYA 1IYZA 1DXYA 1WVGA 4UQPA 1DOZA 3SHQA 3U4HA 1FNSA 1UC5B 1G5FA 1G3IA 1K8QA 1VRVA 2XGJA 2QT9A 1A4IA 1LBTA 2O8NA 4Y1GA 5HF9A 4EI2A 4CKWA 4IDEA 1O6CA 3MTIA 3OQ6A 2FWPA 2QMZA 5ALIA 4TWRA 3FYDA 4YPVA 5IS2A 3VPHA 3AW9A 4M49A 1EWKA 4DQLA 2OHOA 3HH8A 2GNAA 1LWNA 1QANA 3DBRA 4UULA 2XB9A 3VQTA 5DM60 4WKCA 3WK7A 1SXJA 1PK9A 3MWLA 3OEHD 3PWTA 4R69A 4MR7A 1P2SA 2I4OA 2O8DA 2WU1A 4YV1A 2ASVA 3B1ZA 4UUBA 4F8EA 4LF8B 3M33A 2JBAA 4HFNA 4EJSB 3C74A 1AQJA 1SD1A 2YZ2A 3PD1A 1UAAA 4ZOBA 4J3JA 4BFLA 1FVFA 4HDNA 1NR5A 4HQKA 4U5XA 3FB4A 3TNLA 1F0PA 1XYYA 5AVSA 4Q34A 4IMIB 1TMKA 3USZA 3DC2A 4QOGA 2Z6QA 4XCXA 3G2LA 1VIDA 3JVVA 4WZZA 3FRIA 2GF9A 4RLSA 2H5EA 1RXVA 3D6UA 1BFDA 2O3TA 1P39A 4ID9A 1Z4QA 1AX9A 1VCHA 4DB2A 3N2KA 1KYWA 1SA0A 3KFXA 1YFKA 2I71A 4ID3A 3TE6A 3GP5A 3VHXB 3IT0A 3ZY3A 1UBHS 2VNHA 5I5EA 5D3KA 2JD1A 2JGKA 3FRHA 3O91A 5KC8A 2XB8A 3AVPA 3PNPA 1DOHA 2XMCA 3HHPA 4IUYA 4FDLA 4MWBA 3E2IA 2EBFX 5ENDA 4BTLA 5C7IO 1NMZA 1YJCA 3DHNA 3VVBA 3CB2A 4QE3A 1OR8A 2Y1EA 5AVJA 3EXHB 3X43A 1U8FO 1CY7A 1GDDA 1J8MF 2AMFA 1UDRA 3BS4A 3Q3CA 1NXQA 5CNJA 2Z4TA 4ETIA 4MUNA 2O2CA 2QUHA 5AVUA 2AC7A 2HU8A 3WZMA 2Y2VA 1HYBA 5LPNA 4PYOA 1JE1A 3TIGA 3IPLA 4PFKA 3EY9A 3P94A 4YRKA 2BKAA 2P9ZA 2ZWPA 2I22A 1S2OA 3I6IA 4AYXA 4AZ0A 4ZN6A 2B3TA 1N25A 3WWCA 4NS1A 4DSTA 5A3RA 3QEMA 4XCVA 4J3NA 4ZFNA 2D7DA 3FMPB 3F47A 2G9QA 1P1FA 1NUUA 2Y77A 3FDFA 3I2IA 1QAOA 3LOPA 1EP9A 1ORVA 1AF7A 4I1PA 3ANYB 4BVKA 3E9RA 1U98A 2JAXA 2IHZA 1M0EA 2D00A 2FR1A 2IF0A 3KUCA 1NVVR 3LYLA 3FH0A 3VHQA 1FFDA 3GQVA 1ADGA 4YONB 5JXHA 5DBGA 1AGPA 3LMKA 3R9IA 5U4XA 1EYZA 2QRHA 5JXIA 1IVYA 1SQFA 2H31A 2OV2A 3LCRA 4GZ6A 1H2WA 1PJ2A 3GXBA 3HWWA 5JCXA 3MT7A 3IESA 3QI2A 3EN0A 4D0GA 5AQ1A 3MBOA 3KSBC 2E5WA 3ABSB 3RPEA 5JU6A 4N3NA 1XNJA 3QIAA 4M87A 4ECAA 1SUPA 1T3TA 1A96A 3O4HA 4V0QA 3URMA 3VYRB 4ZI2A 3GLGA 1CNEA 1BDJA 2IZOA 3FHOA 2YJTD 5NLLA 3UVEA 3C41J 1ZU4A 4J1TA 3SHVA 4MLZA 4M86A 4H27A 3QIVA 4Q1EA 5EWMA 5NULA 1I5OA 2WG0A 2OPHA 4O33A 3TTVA 3MJHA 1Q7TA 2EERA 3LUPA 1ZD3A 4DJTA 2AG1A 2XF8A 3E5HA 4YLGA 3ADPA 5FAXA 3G7UA 1PR0A 3BX1A 3OECA 1V9SA 4S35A 1P7ZA 1DKRA 3G1UA 5FV7A 4YX9A 3BDIA 5C35A 2A14A 4WBNB 2JHPA 4DWJA 1TAQA 4HLQB 2CW5A 1GRQA 3Q85A 3Q3JB 1PQUA 4FMCB 3T3EA 1UK7A 3UJAA 4EMSA 4YI5A 1VG0B 2Z5FA 3B1YA 2B6HA 2JJ1D 4C6SA 5KWEA 3GCZA 4NYIQ 1XVLA 4BMPB 4GOLD 4HTFB 4FHZA 4J8PA 4XX0A 1VL2A 3ZGXA 2A9JA 3ZBPA 2QLMA 2FRDA 4QM6A 1CUIA 3JYQA 2BGJA 2K7FA 2XEDA 5LA6B 4PNEA 1MIHA 4J7CA 2QNIA 4HGOA 1S3IA 3V9PA 2CUZA 2UU9B 2JLWA 5EI5A 3WMFA 5BN3A 4MRNA 1FTWA 1C9JA 2JA2A 4XZ3A 1EBFA 4PLHA 3VR6H 1Q0QA 3LRTA 2DEUA 2O8CA 1BOFA 4ND7A 1TADA 1JR6A 3LUAA 3OFVA 4YLYA 3C7KA 3ONEA 3RIEA 3JASA 2BDUA 4OB8A 1K8XB 5AVOA 1M3SA 1AGRA 2KSQA 4MB0A 2ZVPX 4GUDA 4MR9A 1E3WB 2J41A 4ZAGA 3RRMA 3UC9A 4BEVA 4F2DA 3FCUB 2QYHA 2UZ4A 5BORA 3QG5A 3A10A 1SK8A 1BE8A 3HM2A 3I6ZA 3OM9A 1BMDA 2V7PA 5EHGA 2OGWA 2UZ3A 2V96A 2VAMA 2IV3A 3SK0A 1RAGA 1VRCA 1UADA 4PICA 5GONF 3STVA 2VHWA 4O1HA 3OX3A 4Q05A 3WICA 3EZYA 4YASA 5KYYB 4ZCQA 2QTVB 1XGKA 1K89A 3O95A 3B5JA 1I1QB 2EEZA 4IOMA 3KYDA 1GFZA 5ADVA 4RXTA 4J1QA 1Y9JA 1P2FA 3WRXA 3H2SA 5K0SA 1ZH2A 1KEVA 2GCPA 1U3CA 3OUUA 5B2FA 1OGYA 2GLXA 4XOIA 4Y8VA 4C7OB 4OCZA 1KDOA 1EJ6A 3EUWA 5D5PA 2GPJA 2JFWA 4OXKA 3HR7A 2BFDB 3JQFC 4HNAB 4YY3B 2QRPA 1WG8A 3UXHA 3K7EA 3ZOZA 2UXCB 1Z07A 1WOMA 3G2IA 2PGLA 3HUUA 5C31A 3GRAA 3E3OA 3I9NA 1WMDA 2RGNA 4BNXA 2H4JA 2OGTA 2WAXA 4NONA 3V1KA 4XWKA 5JSFA 4J0CA 1DAFA 2OUKA 4ROTA 3E23A 1F06A 2Z3VA 1EXNA 2ZIUB 3R9WA 3W8RA 3ONNA 4QREA 1QDEA 2IELA 3K72B 4R1TA 5C7LO 4U8GA 5HM6A 2V3WA 3FUUA 2UVDA 1TM2A 2MR5A 1Z4KA 2AXEA 1YZTA 3D4IA 3MINB 3QHAA 4P0QB 1Q7GA 1U8EA 5A1JA 1DI0A 4YMIA 4LJ8A 1VDZA 5JQGF 1Y3AA 4HDKB 4XEHA 3UA4A 2CLOB 5J2UA 3TD9A 3C5HA 4LUCA 3QP9A 1NPTO 3H75A 4K6CA 3CX3A 2PDAA 2CUTA 4UFOA 2I6FA 4LISA 1NQXA 4GPAA 3AG6A 2FV8A 2XH8A 2DCUA 4U6NA 4NQRA 5ILGA 4DQ0A 2COKA 4LZWA 4KITB 1VYTA 4Q66C 5F73A 4BV8A 3GF4A 4NDZA 2NYUA 2P5SA 5LMCA 2LVBA 3HN6A 5DNWA 3SF8A 2ODQA 3ONVA 2WFZA 3RBXA 1RAAA 1WJGA 4YJFA 4GP7A 3U7IA 1H4TA 3BZBA 3CURA 3QMWA 4Z7OB 4CF7A 5IEJA 2W6IA 1A8UA 3MLBA 2B4AA 1J7KA 3L1VA 3LC0A 5EJ5A 2I78A 3DBLA 4N47A 3RVRA 1C0LA 1FP6A 3F67A 4G37A 1NQUA 3ZX4A 1BGWA 2YN4A 4QPPA 2RFLA 4GBMA 2F64A 4JJ7A 4R3UC 2UVQA 3A1UA 5A4FS 1PU2A 4XW2A 1X9IA 3UJDA 1A2KC 4IXMA 1W88B 3FPFA 1JHMA 4JUAA 1F0KA 1K9VF 1Z2CA 1DBSA 2WYUA 1WU7A 2FQQA 3EYWA 4JLAA 4YJ2A 5CFZA 4PQEA 4CHTA 3M2PA 2PFGA 2WV9A 3LLVA 1IK4A 3OP4A 4FOOA 1T1EA 2NXNA 4XIFA 2AW5A 1I8TA 1ZBDA 2IUFA 2XUPA 2I3BA 5KSOA 2GNPA 1G6Q1 1Y8RB 4OQZA 4AG5A 3L8FA 4KTTE 3QX8A 1AV6A 2GM9A 1L3IA 2FKNA 4JB0A 2P4EA 4JQZA 3BM5A 2OLJA 1DTWB 2GUGA 1OKKD 5AKKA 4BJ6A 4JLVA 3L7DA 3AB3A 3MJCA 1Z56C 2NLOA 3G0GA 4ACAA 1G38A 1G1MA 4EA8A 1DB3A 3O90A 2V5VA 1SZJG 1N75A 2QI9F 3E9DA 2PRZA 4IRXA 4MVJH 3EIHA 5E1OA 3ZU3A 3HVIA 4D45A 3CJQA 2FPUA 5LP6A 4DV1B 2ZRBA 4QX6A 3T8YA 1KZ6A 4G67A 2VYQA 2HHHB 3NTOA 1XDSA 5JBQA 4DM3A 1IWOA 2G9UA 3DVLA 4AROA 5C52B 1TJPB 1OWOA 1MNQA 4O4JB 3OFKA 2FFRA 2Q5HA 3CF6R 3WMGA 5EE3A 4DREA 3D0RA 2CVFA 2ZOSA 3OT5A 5BSEA 5CB4B 2XMGA 3PTZA 1X7XA 2C1XA 4RPLA 1Q57A 1TVEA 2YV3A 3FA2A 1Z2NX 2ISCA 1TYBE 4FDVA 3O3OB 2ZZNA 1CZOA 2P2ZA 3KOUA 1VHLA 3CLSC 4B45A 2JFQA 3AY3A 3C43A 2OYCA 5J3JA 1H9CA 2ZGVA 3GLHA 3NATA 3OOJA 2QPOA 4RV4A 1J42A 2H57A 2INGX 3U3XA 2DFPA 1T5HX 1RPZA 1O6FA 2RMKA 1OFVA 1QQ7A 1YE8A 3P2IA 5IF3A 2B1JA 4IHKA 4N8EA 2WU8A 5HE8A 1CJUC 4ZI3A 1G3MA 4OHPA 1GJRA 3B7PA 4XVUA 4MI1A 4YEDA 3CUVA 1PZGA 4L7QA 1N2ZA 1PQ4A 3G9QA 3DDHA 1A4RA 2PD6A 4KACA 4YRPA 4ZT5A 1BA3A 3HR8A 1WXXA 1QX4A 1FTYA 2ZJYA 5HIAA 5HOQA 5K7SA 3DWGA 5FWXB 3D02A 5ALPA 1GYPA 1Q7BA 5EINA 4PFSA 3NDPA 1QR6A 3S4YA 3VI4B 2HQSA 2RAFA 3E3LA 1PLKA 1IOVA 1KJ8A 3AVQA 4FYIA 3ERCA 3BL6A 4BMZA 3ZLTA 4YRLA 2ZSUA 1BU8A 1L7QA 4LXGA 4HNTA 4V38A 4M0MA 4C7XA 4JBXA 2J3KA 1ZMBA 3LX4A 1AXGA 4MDYA 4WJLA 5FWDA 4W8HA 4GEKA 5BMOA 1C7ZA 3M5WA 1QG4A 2WICA 5I7AA 1D1TA 1YKSA 5CX1A 2WYHA 5BNTA 3F73A 2ZSDA 3T1HB 5HTOA 3SX2A 1TVKA 2B34A 3P19A 1A77A 4QA9A 3T5DA 3JQ9A 4PLTA 1G8SA 5BN3B 4NK4A 1ZM3A 1ICIA 2NO0A 4YS6A 2VJDA 4NAUA 4EFKA 5IXSA 6ADHA 4DUZB 2FW9A 1E79A 1MQ8B 3L8HA 4CLXA 2X3YA 3AILA 2VH5R 1RWXA 5I4KA 1KJ9A 2D0IA 2WDPA 1BRTA 1H1LB 1VLMA 4NY1A 1BJTA 3IVCA 3KHUA 1K7SN 1L7NA 2V97A 4I5IA 3MCWA 1VHTA 1IHPA 3LUHA 3WMXA 1XMVA 4OBXA 3HJUA 3X1WA 3GLIE 1GNPA 2YYYA 5EJ2A 4I66A 2EP8A 2QV0A 3GEIA 3ETCA 5BSMA 2OHXA 4GE0A 3NS7A 2BGMA 2H00A 2H2GA 4C7JA 5DTEA 1N2BA 3DFUA 3QEOA 4X94A 4L4RA 2C8JA 4AJJA 2HUPA 1XZHA 4LMPA 4MGYR 3C45A 1CUFA 1IY0A 1MTZA 2QD5A 2Z9BA 1CY1A 4U3JB 4REQA 3SLGA 2ZR9A 2LW7A 2W00A 2WD7B 4JDUA