4PHTA

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
485
structure length
438
Chain Sequence
RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 127
structure length 438
sequence length 485
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4phtA01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4phtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phtA03
2W6ID 1UBFA 4G5GA 2RGAA 3GJ3A 3NH6A 3P27A 1ZNZA 1N6KA 4A92A 4TQ9A 3A1SA 4PHHA 3RC8A 5CDFE 2GXAA 3KB1A 3T34A 4Q9JA 1AQUA 2VF8A 5E4FA 1W5TA 2WOOA 2GDJA 4XJXA 4DIDA 2IA5A 2ODEA 4ON9A 4PQRA 1KI2A 5KSOA 5JJKA 4CEIB 2O0KA 2C9CA 3LBHA 2G9NA 3BRWD 3NBFA 1NG9A 4IOMA 4JT2A 1CJUC 4POAA 1OYYA 2YNMA 2BEJA 2QM7A 3EASA 2QP4A 2A3RA 3QKUA 1E79A 1W4BA 2ZRKA 3OE7D 4BEBA 1CS4C 3ETLA 2BOVA 1GP2A 1YQTA 4A6XA 2AXNA 3FPAA 1XD2B 2NO6A 4OK5A 5C4GB 1DAMA 4FCTA 4OI4A 4B3DA 1E9CA 3MMPA 4PHGA 3K8YA 1T0HB 5H70A 3HU1A 4PAQA 4II7A 5AJVB 2NO1A 4TLAA 1Z83A 3DPUA 2P67A 3KKPA 5CLLA 5DN6A 4OHZA 1ZYUA 2XTZA 3U7EB 3GJ6A 2O52A 4QM6A 1Z06A 1DAFA 3KFXA 4A8JC 5G53C 4C7OA 4JKYA 5ELXA 1E2MA 5JFGA 1WBBA 1FNMA 1F2UA 2J0UB 1IJFA 4M9SA 2H7VA 3K1JA 4MH0R 1XTQA 2CJWA 1N5JA 1MO5A 1JR3D 4M8NE 3OESA 5F9HA 1OFTA 4GOXA 1LS1A 2Q3HA 3A4NA 4US2R 5BYKA 2WWXA 3VKGA 4MUBA 1T4GA 2Q3FA 3O8BA 3FMFA 3VMFA 2KB0A 1B23P 4US0R 4B35A 2NZ8A 1N5IA 3QI2A 1Z6GA 2ZPTX 4IEIA 3CX8A 1W2GA 4LYJA 2QPTA 4PFSA 3BFXA 2WWWA 1VHLA 4FI3C 5KPDA 3MD0A 3NDBB 2ZM5A 1JECA 2GK7A 3EZ9A 4IDOA 4OJKA 2EQBA 4XTRA 1IN8A 2PT7A 1QHHB 4BFZA 3FE2A 4PQYA 1NLZA 3EC2A 4HUQA 1YKSA 4GI7A 3VQTA 3GLFA 5JSZA 2QTFA 2R6GA 2J7PD 3ND9A 4LHVA 3PUZA 3RABA 1YZQA 2ZYTX 3BOSA 4N0DA 4DSNA 4A4DA 4M1YA 4WOPA 3VR3A 4M53A 4D2IA 1PVOA 3TSZA 3WRXC 3Q7PA 5F3WB 4LPKA 2P6UA 4MRSA 4DDTA 5KSYA 1N6HA 4BASA 3KB2A 2YHSA 1VG1A 2V6JA 1MABA 2EU8A 1UEIA 1KI6A 3WMFA 4HAYA 1PLLA 4LJYA 4PPGA 2W58A 2WV9A 3UATA 1SVMA 2D74A 1TU3A 3GJ0A 4NPHA 1US8B 3CBQA 2O8EA 5J4HA 3LX8A 3SI7A 1IBRA 4W5JA 2BBTA 4YMUA 3NEYA 4M22A 4LJ9A 2WIBA 3CNOA 3H84A 4JLAA 1T8TA 3LD9A 4A0GA 1SXJB 3KZ1E 1G4AE 3RSOA 2A5DA 4QGAA 4LC1A 1E3MA 4JLNA 3WYFA 4CRWB 3TUJC 2WWHA 2IS4A 1PLKA 4R7ZA 1XJCA 2FEMA 2R44A 4B3BA 4HAWA 3NXSA 4HUTA 5IK2D 3C15C 5FPTA 1OT3A 2H57A 2R62A 3MRSA 3QF4B 4PC1A 1TUEA 3EC1A 3IILA 2C98A 1OH7A 4BUJA 4WXRA 5BXQC 5FR2A 4FINA 2V7QA 1D2EA 2IF0A 5SZKB 4BPBA 4KSBA 5EZ6B 2WZQA 3BXZA 3CRMA 3FMPB 1KI3A 2FGKA 3QKTA 2CK3D 2ZANA 4L5BA 5CIQA 3PV0A 1KO4A 1FQJA 5HPYB 3BE4A 3IBGA 2CVFA 2XSZD 1KO8A 1N3BA 1W4CA 2IXEA 2PCLA 1NBMD 4LJ7A 3RRMA 2QGZA 4KU4A 4EQ6A 2EFCB 4Q1BA 2ZI7A 4XD7D 3L82B 4BLPA 3AKCA 1Z2CA 4RCZA 2R8RA 5J4YA 1E69A 1F2UB 2DWPA 2BBSA 5SZHB 5GJVC 3S1AB 2NO9A 1XTJA 3ICQB 3AF3A 3Q8XB 1AZTA 4Q4LA 4LHZA 3RRYA 1D9ZA 2QBYA 4PHTA 1X8LA 2ZYUX 1YR8A 3HJNA 1XWIA 1QHNA 1PJRA 4L9WA 4DXAA 1M8PA 3PR1A 4KFTA 4ESHA 1ZP6A 4GMDA 1KK2A 2QRZA 1P2UA 2FFBA 3KX2A 3TW4A 1IY0A 2GRJA 4JT4A 3KQUA 3TMKA 2WWYA 3I8SA 4Q4HA 4V0OA 1OB2A 3AVVA 4KITB 3TSWA 1JPJA 2O0JA 3CNLA 2QEQA 5DHFA 4NZYA 4EPTA 1KI4A 4PO9A 3ZLJA 2R2AA 5JJLA 3MWYW 1IN7A 3SBEA 4XWOA 4UXHA 2HT1A 4WZ6A 1TEXA 1YR9A 4ARZB 2G0NA 2DR3A 2QMUA 4LJ6A 4NU0A 4UJ3A 4UXJA 2MMCA 1U0LA 2PZFA 3SE0A 2JJ2A 1GG2A 2P6NA 4EJSC 3KXLA 3C4JA 4MYTA 1E2NA 4Q9LA 5EP4A 3REFA 3TVTA 4A15A 5FOXA 1S1CA 3D3QA 3DM5A 4YLGA 3B5JA 1TUIA 4GZLA 4BEJA 2HYDA 1CJKC 1JAIA 3V00A 4NCKA 1WE2A 4QBGB 4LV6A 2OXCA 2H1LA 5DE3A 1EG7A 2D2FA 2GAAA 2EFGA 4LGMA 2YYZA 3Q85A 1N5LA 1ZUHA 4WAUA 1VMAA 3TAUA 3JVVA 2IYUA 1CRPA 1E6CA 2OG2A 1G4UR 5JEEA 4TWZA 2G0TA 2QUZA 3I61A 3SQWA 3LA6A 3IPYA 1CJTC 2R9VA 2ZUCA 3VR5A 5F2EA 3V9PA 1A82A 4IFBA 4PPNA 3IEVA 1T8UA 1E4VA 2PMDA 2GVZC 1VECA 1U94A 4RFSB 3BH0A 4A2QA 4ITRC 4Q48A 2PX0A 2R6CA 3C5HA 1NIPA 2GEUA 1P61B 4RCYA 4MRVA 2WOJA 4URYR 1DELA 4EFMA 1HY3A 2H18A 3AGQA 3K9NA 4CF7A 1HURA 2ZRPA 1W0JD 4O0MA 3BFKA 1ZM3A 2PZEA 2G83A 4C7OB 1Z07A 3MGCA 5EZ5A 1FZQA 3I73A 3B9QA 4XSHA 5FL7A 2BC9A 2J0SA 1WRBA 4XSGA 1DADA 3T1VA 1ESNA 1ZM7A 5A0FA 3THWA 2OSBA 3AVPA 1QG4A 3X1YA 1II9A 5FTLA 2J0UA 1YU9A 4QNMA 1OYWA 1OFHA 4F4CA 1QZXA 3GP8A 4Y0VA 1P9RA 1K5GA 3P32A 1KAOA 3PXGA 4C0SA 2ZTSA 4X8MA 1O3YA 3T1TA 4ZDIA 3H4MA 3TK1A 3AF2A 2FSFA 1TL7C 2OT3B 4Q7MB 2VP9A 3SOPA 1H8HA 5JRZA 2P2LA 2W0SA 3B85A 1P2TA 3P20A 1XXHA 2ZXUA 1U0JA 4KXFB 1LY1A 4TYYA 1G6OA 3EPLA 4BRWA 3J81k 3U5ZB 3OEHD 3SR0A 2NG1A 4TTQA 1X8JA 4BECA 2JEOA 3CF0A 4MGKR 4KSCA 521PA 3X2SA 1G41A 2XZLA 1M34E 3LDAA 2WKRA 2IS1A 2A9KA 4HDOB 2W6JD 5FR1A 1JALA 1KI8A 1N6NA 3TUZC 1G64A 3IBYA 4EPRA 1NY5A 4UNPA 3T5GA 4ERNA 2HF8A 2J3EA 2JDIA 3FB4A 3ZQ6A 2Z4SA 4L16A 4Z1MA 3K0FA 3L0SA 5IT5A 4TQUS 3UMSA 3IDQA 1SXJA 1BMFD 3SDZA 4P4TA 1ZNYA 1XRJA 4NE2A 2F1RA 3Q3JB 4MRRA 2ZRJA 2CNWA 2IYYA 5DISB 4MA4A 1XTIA 1OF1A 2VSFA 4R98A 2F9LA 2FFHA 4G5SA 5GJBA 5KSPA 3N70A 1IXZA 1VYUA 1VG9B 4URXR 2PX3A 3NBXX 2IS2A 4C0BA 4W5HA 3I4LA 3EIHA 5TVKA 4P3YA 4QBFA 1WXQA 2JAQA 5FPYA 1P72A 2C9YA 4D4MA 3BWDD 4NTZA 2QRNA 2KWIA 4IDHA 4Q66C 3THYB 1N6LA 4FMDB 4MYHA 2IX3A 1P2SA 3HDTA 1E2QA 2PL3A 3CF2A 4MUAA 1S1MA 3QXSA 5IF9A 5TY0A 4DLYA 4LV5B 4MKFA 1W0KA 5HR5A 3HWSA 2WJYA 1KIMA 1MT0A 3DO6A 4ZKEA 2XNSA 3WYGA 1W7AA 4N1AA 3L43A 1P6XA 4OJQA 3GLFE 3X1WA 2O8FA 3OZXA 2DWQA 1H8HD 4E22A 4ZIRB 4TYNA 2ZAOA 3AP2A 3DKPA 2AKYA 3OIUA 1E2EA 2A5JA 4PQFA 4TQAA 4AKEA 3PUXA 1Q21A 4DSOA 1QVRA 3GJXC 2XB4A 3OAAA 1FL9A 3AKDA 3K70C 1E9BA 3AH8A 2ATXA 1TQ2A 2IC5A 4RD2A 3K0CA 3UG6A 1U2RA 2ZIAA 3U7FB 1KMHA 5CITA 3LH5A 4TLEA 2ZJOA 3EW9A 1E2JA 1I2MA 4NYIQ 4YXWD 2WWFA 4JJZA 4B3GA 5K8TA 3IQXA 5FBLB 3TR5A 4R2IA 2IYTA 3MWJA 2C2HA 2XX3A 2FSIA 3TJZA 2JIZA 1XPRA 2C96A 4M21A 2ANCA 1Y63A 5CK5A 4P4UA 1NBME 2BMDA 2XZPA 4NONA 1AKEA 2BV3A 2P3SA 3C16C 1FTNA 3QXXA 3ZD6A 1E0KA 1OKKD 4TTRA 1TAGA 4A82A 3I62A 5AK0A 4LX0A 5ANRB 3JZMA 4PAOA 4DEYA 5AUNB 2J41A 3M6AA 3EPKA 1XEXA 3ZVMA 3E70C 1TF7A 1UPTA 3H2YA 5DI9A 4Q47A 2FE4A 2ZRMA 1HTWA 4MRPA 4TYWA 1YRBA 2QGNA 5FOTA 3RRNA 1KSFX 3D8BA 1OHHA 2H92A 1NKSA 2KJQA 5H1YA 4GMXA 3TVDA 1G3IA 1BIFA 2C04A 3AM1A 1KY3A 5M04A 2J7PA 3IIJA 4B3CA 1P2VA 1E2PA 3O8RA 3AVUA 2G1KA 3BH6A 3M0EA 1KZGB 1R4AA 1WF3A 1RRFA 2O0HA 2XXAB 4KFRA 4QG7A 4FD2A 4AKGA 1KYIA 4NYJQ 4EJSB 2FFQA 1UBCA 3A8TA 3SS8A 4ESVA 4HAUA 4PC7A 3MJRA 3NHAA 3C8UA 1NVVR 4Q1AA 3QJYA 4M9QA 4W5WA 4HLDA 3TH5A 2HLDA 3EPHA 4MGZR 3MUFA 1U90A 2JJ2D 5CJ2A 3GLGB 1W0KD 4IDNA 1IY2A 2FWRA 4Z54A 3P1JA 2RAPA 5FOSA 4GDFA 3RS2A 2ERXA 1YZLA 1ESMA 4TMTA 4L4UA 1R6BX 1KDPA 3EX7C 1KSGA 4KJZA 1D5CA 1CR2A 4G5QA 4PC6A 3R9WA 1CR0A 2RMKA 2QMEA 4H9GA 1R7RA 2AN9A 4A0HA 2FSHA 4C0KA 4BLQA 1G3QA 1AQYA 2AL7A 5AUQA 1NLYA 5E7JA 1BYIA 2GA8A 4RZ2A 3TQFA 1KI9A 3CH4B 1EFRD 2GTPA 3KKNA 1UADA 3CPJB 1XEFA 2XNDA 5E3HA 4EPVA 1SHZA 2OCPA 1E0AA 4D0GA 5DYIA 3GFPA 3L2OB 4L9SA 4YMSA 4ASUD 4DEXA 1JB1A 3K70D 4JBXA 1FFHA 1GOTA 3ONWA 4PSAA 2SHKA 4N3NA 1AGPA 2PCJA 3BB1A 1SKYB 1NRJB 1K8RA 1SZPA 1KK1A 4QBHA 4X8HA 2C99A 3KUCA 3VU9B 4MKHA 4R71A 3WP1B 1IM2A 1NBMA 3ZIAA 4B75A 2GCPA 3I72A 5JHGB 2IEZA 4KCGA 2FGJA 4UNQA 4IW3B 3ZVRA 1DEKA 3AVTA 2GK6A 1MO3A 1R8SA 2XGJA 1D8TA 2HLDD 3THOA 2BKUA 3QEOA 2F7SA 2V6IA 4Q1FA 2W0MA 4I1OA 1P7CA 3CUEF 2X77A 3QXHA 4A1FA 1BH2A 1D9XA 1ZD9A 2WJVA 2J46A 5EE3A 3GLIE 1RJ9A 3U44B 1FNNA 4I4LA 1WDTA 3U60B 1SGWA 2NPFA 1XD9A 3EA5A 3UG7A 2Q0HA 1NJGA 2QSZA 2CLDX 5B58C 3LW7A 2L0XA 4LYAA 4AYXA 2AFIE 3IHWA 3CPHA 3CM0A 4LHXA 1MRNA 4FW9A 5FUWA 5JHHB 4Z8YA 2AKAB 1C4OA 2DBYA 4PSVA 4RD3A 1OXUA 4CEIA 4KBGA 2HCJB 1OSNA 4EFLA 2RGDA 1JQJC 4OQLA 1E2IA 1P4SA 1KI1A 2ZE8A 4C3ZA 1DBSA 4ZPXA 1TU4A 4PZLA 1COWA 1E1RA 3SYKA 4EPYA 1GRNA 1T0JB 2ZJYA 4Q4AB 2DHRA 2Q9CA 4HI0E 1KDOA 4PTLA 5HZHA 1F6BA 1U9IA 1E96A 2A30A 4IVRA 3T15A 3RHFA 3DHWC 3T61A 1J70A 4LYFA 3ADDA 2D2EA 4L8GA 4GRAA 1XMJA 3UANA 1G3UA 4A36A 3VR2A 4PPQA 3ZZUA 4DLZA 5J47A 1L7VC 3QQ5A 4YXWA 3W5JA 4GZMA 2QQEA 2YWHA 3AVYA 3B13B 4JSTA 2RHMA 2WKPA 2FFAA 3I1FA 5EP1A 3CPEA 1XU4A 2GCOB 4UNSA 5L3QA 5EE9A 1E2HA 3OAAD 4JVMA 3ZS9A 3HPQA 4NYJR 3SU8A 1CU1A 2DPXA 2JLSA 2VIIA 4ZI2A 1RC8A 4DB2A 4DLVA 4WVFA 2F1HA 4FXPA 1L2TA 4TYQA 4A9AA 2YOHA 3AVWA 2E1RA 1NVWQ 5IHPA 1ELOA 3EXAA 4URWR 1ZC3A 4Q9IA 3PQCA 3U4QB 3LY5A 4JMPA 2C03A 2ORWA 3R9XA 3VNVA 1G8HA 1E9FA 1ZD1A 1TF5A 4Q18A 1R0YA 3CLVA 4PO1A 2ZJBA 4GOKA 2RGEA 4I81A 4CEHB 2CHQA 1RRPA 1RPZA 5FUVA 2MSCB 1XTSA 2B7CA 3IIMA 4DSTA 1U99A 2A2ZA 4OQNA 1NLFA 5FI0B 5F98A 1DG1G 4RSGA 3NC0C 3GLIA 1CEEA 1PZNA 1T91A 5AJWA 2FH5B 1N6OA 3GFTA 5JI3E 3EPJA 4CEJA 1GIAA 4V0KA 2ZI9A 1NIJA 2XEXA 2HJGA 1BS1A 4TSFA 4B48A 5TB5A 4JLMA 4JZKA 1NMXA 5TMPA 2VHQA 2QA5A 1II0A 1ZMXA 5IDVA 2GXQA 3MJHA 1LW7A 2GJSA 1X8KA 3E2IA 3PENA 4EPXA 4NYMQ 2FMXA 3G82C 5EP2A 2F1IA 4M2LA 4AD8A 1XBTA 2FA9A 1GITA 2IYWA 1GKIA 4U02A 1XB2A 2CCJA 2ZRDA 2OLKA 3SYNA 1BOFA 3CZQA 3I32A 1TQDA 4HZUB 1E79D 2X2EA 3OE7A 3UMRA 3KTAB 1UKEA 4NCHA 1GNQA 5E7MA 4KFUA 4C0QC 4TMVA 3BD9A 4M9ZA 4DCVA 1XCGB 4C2UA 1NL3A 5FUXA 4TL6A 3ZIAD 5JBQA 5JECA 2OBLA 2VO1A 3IO3A 4G5RA 4CZ2A 1EFCA 4JIMA 2XTMA 2ZSFA 1VKJA 3SNHA 4AKIA 2F6RA 2OILA 4K8OA 1G18A 1Z2AA 4OK3A 4GT1A 2IL1A 4RD1A 1VYVA 1BYUA 4NCIA 2OUKA 2QZ4A 2O8CA 2WMOB 3U7HB 1YRAA 1Z6XA 1YR6A 2WSSA 3BS4A 1ZJ6A 2ZQ5A 4Q4AA 3LLUA 4A6PA 4QHYA 4C0JA 3KJEA 5AR1A 1JAHA 1TPZA 3CONA 2B7BA 2IT1A 1ZW6A 4M1SA 2R6DA 5FPKA 5JEDA 4QHSA 2DWOA 1E9DA 3WHKA 3F8TA 2OO7A 2NTYC 2FJUA 3JVUA 3W5IA 1NVVQ 1A5TA 2IK8A 3IUYA 1X1SA 2QAJA 2VSOA 4UXIA 1TQ6A 2NGRA 3L0IB 4PC2A 3ZZ0A 3U3KA 4TT3D 3UWKA 3U2QA 1W46A 4LC0A 3GLGE 3RAPR 3D7MA 2JLUA 1KK3A 1M2OB 3KL4A 4BGDA 2LKCA 3IIKA 2VA8A 3Q9LA 3FKSD 2W83A 2ZE6A 2J5XA 2F9MA 2QT1A 5EXTA 1ZUIA 1OPXA 1FMJA 3MWLA 3R7WA 1NJFA 4B3FX 1UEJA 3LBNA 4NHOA 3TGPA 4JLBA 4A0RA 3AVOA 3BFVA 2CLSA 2GF9A 4TL8A 2O8BB 4FMCF 1G3MA 2CMKA 1KHTA 1UFQA 3H86A 4M0LA 4AG6A 3T35A 1XFAA 1Q1QA 4LJ8A 1KKMA 3BJIC 4BZPA 3GEEA 2RH5A 3CNNA 2G88A 1KI7A 1OHHD 4NKRA 4P33A 821PA 4Q19A 4GSYA 2NOAA 3EZFA 5SZJA 2BCJQ 4QJ5A 1G7TA 3B6EA 1KAGA 4I1VA 4DCTA 3ADKA 3THXA 3T06B 2I4IA 1EESA 4F38A 4V02A 3RDPA 4Q1EA 3PVSA 3ZGXA 4TN1A 2BBWA 3I5YA 5E95A 1E1QD 5C2JB 5AJXA 1FOEB 3IGFA 2B6HA 4QXAA 2DY1A 1IXSB 3K0AA 4GFDA 4PAMA 2X1VA 3NH9A 1G16A 3ZDQA 2J59A 3EZ6A 3ZH9B 5HE8A 5AUOB 2GXSA 3QPWA 5JWOA 2FOLA 5DYGA 1NVXQ 3HYTA 1L4YA 3LV8A 1GILA 3I92A 4PO8A 3WRYC 4WZBE 1UKVY 3DM9B 1GUAA 2ERYA 2IYRA 2P5TB 2VP4A 1G7CA 4ZDWA 5UKDA 5CDFA 1B0UA 1LVGA 1K6MA 1NI3A 4JJKA 1UJ2A 1XMVA 1KDTA 2RHDA 3VKWA 4LBZA 4B6EA 4Q9KA 4TYPA 4ZCIA 5FFMA 4TMZA 1M6NA 3HPRA 2CCKA 2ZRAA 3TE6A 2XSZA 1CULC 4OHVA 4TL7A 1LF0A 1I4TD 1ZRHA 2AD1A 2JJ1A 2QE7D 4A8JA 3GLGA 2V55B 2J0QA 3W34A 3QPUA 2BDTA 3PCRB 3AKYA 3PUWA 4GP7A 4Q00A 2ZI6A 1W49A 4D81A 3PITA 5K8LA 1LTQA 1T3LA 4L15A 4P0TA 4UNRA 2QORA 2ZR9A 2CDNA 4HYYA 4EJSA 3K9HA 3KTAA 4NMMA 4DIEA 3U6KA 4DKXA 4JS0A 1P75A 2X2FA 3QEJA 5EUQB 2Y8EA 2AD5A 4HAXA 3T5DA 4DVGA 3SJBA 2J1LA 1RFLA 3CR7A 2Z0MA 4AG5A 3A37A 4MGIR 4QL3A 4GBMA 1XZQA 3F0TA 1E1QA 3FHCB 2D62A 2DB3A 1OH8A 1DS6A 2Q6TA 3CH5A 1E9AA 1LF5A 2Q9AA 3CRVA 2W2TA 2E9SA 3L0PA 4MQBA 4JL8A 5JWHA 8OHMA 1LS6A 1GZSA 3B78A 2ZE7A 3W3ZB 3A4LA 2GEDA 3P26A 2JLRA 5KNDA 3CZPA 2QROA 1P60A 2AFHE 3RS4A 3QG1A 4DLTA 1G7RA 1E2KA 3E5HA 4BLRA 2W6JA 1U8AA 2RGCA 4OKSA 5HKKA 3K9LA 2IF2A 1P3JA 1U9IC 3EWAA 1EXMA 1KZ7B 5LBIA 1NSFA 1T9HA 3KJGA 1TQ4A 4QHTA 2GAOA 2V1UA 4GPTA 3I5XA 1RJ9B 2IYVA 4EQ6B 4YONB 2ZAMA 4AYTA 3NEJA 4AC9A 3G5UA 4CIDA 4D82A 2FX3A 4OQMA 3U4QA 1N2CE 3HR8A 1Y3AA 3KQHA 1FUKA 5D3MA 4D0NA 1MR3F 3ECCA 2FPMA 3CO5A 3C41J 2PJZA 4Q02A 5JZVA 1ZU5A 4G3XA 2QM8A 2ZJAA 2ONJA 3AUYA 2YC2C 3QNUA 4UQOA 4HB3A 2ZI4A 3LNCA 4JBYA 2IUSA 4RJLA 4C0AC 4BE7B 4D25A 1X86B 3B1VA 4DDVA 1G21E 2BHRA 3IO5A 4PC3A 2O8FB 1ZIPA 1N6PA 4LJ5A 4A2WA 5HKKD 5JLJA 1NY6A 2VBCA 3TUIC 1KSJA 4DCSA 4CGZA 3THWB 3HU3A 5CYOA 1Z63A 5FBWB 4FCWA 4P32A 2JLXA 4QJ4A 5LD2C 1E1RD 1WP9A 2HDNB 3GCGA 5EXSA 5HCNA 3G0HA 4IVPA 4FWIB 4KFSA 4QOSA 4E07A 4Q4JB 1XCPA 3ZD7A 3GMTA 3THYA 1RYHA 2O5VA 2QL6A 2FPLA 3GLHB 4LHWA 2QQ0A 1VPLA 2V9PA 3CF6R 4M1TA 1I2DA 2CXXA 3IPXA 1Z8FA 1KOFA 4OHWA 2VF7A 3LW8A 3OFND 2ZROA 1BO6A 3OEEA 4WXPA 3DOEA 4J0QA 3QKRA 1QHYA 3SBDA 4URVR 1F3OA 1DOAA 2JATA 5L3RA 4O3MA 3VKHA 5DGXA 2ZRIA 4AIIA 5FBVB 1IN6A 3IKJA 2VTKA 2ZRHA 3LBIA 4JSYA 4XD7A 3A36A 1FW6A 2XB2A 5C18A 2JJ8A 2XAUA 1GTVA 4D26A 4RZXA 3W6OA 4ZO4A 3CIOA 2HXSA 2XTNA 4HLQB 1OLOA 1SHKA 2I1QA 2CK3A 2JGNA 2WWGA 4M1MA 1G8FA 4QM7A 4LRWA 2IWHA 4HB0A 1DAKA 2FPKA 2OE2A 4LWZA 2EYUA 3UK6A 2QENA 5JWRA 1KSHA 2X8AA 2VEDA 1UDWA 1N6RA 1Q1EA 5KOYA 3GPLA 5KDLA 5G40A 3RLFA 1Z28A 2NZJA 2ZSBA 3MSXA 1MKYA 1R2QA 3C14C 4HAVA 1U98A 3TR0A 1RZ3A 1DG3A 2AR7A 3GJ4A 3W8RA 1D2MA 1XEXB 2ZI5A 4TMKA 1M7HA 1KTVA 4D0LB 5KTYA 1NMYA 2F1JA 3B82A 4YMVA 3PEVA 2OCBA 1E94E 1GKYA 4TMWA 1GL7A 1S96A 2YC4C 4B6FA 2ZI3A 3FYHA 2ZYVX 2ZRGA 2ORIA 2OM2A 2OLJA 2QBYB 4C9BA 1GVNB 2A7QA 3RANA 1XEWY 1F5NA 5D3MB 4DCNA 1R5NA 3EIEA 1XDBA 4FMDF 4F92B 3KUDA 1HUQA 2OAP1 2GXUA 3A1VA 1IONA 1IN5A 621PA 2PJRA 1VDZA 3FMOB 1IHUA 3O8CA 3L8ZA 4DT1A 3HYRA 4A0FA 3CX6A 3AGPA 5DI3A 2MSEB 2GETA 1H8EA 4GL2A 2D7DA 1G8GA 3R8CA 3CRRA 4MYCA 2GJ9A 3QUSA 3VR1A 3ZYCA 4E03A 4KYUA 2B92A 5DNYB 3TSOA 1CKEA 4LSGA 1U0HC 3VX3A 5B30A 1RYFA 3DOFA 1GM5A 1GL9B 121PA 4F4JA 1ONBA 4KV9A 2FDCA 1Q0UA 2QMHA 5A5GA 2QSYA 4HLCA 3ASZA 1TNDA 4V0MA 2XITA 1GKUB 1A4RA 1EX6A 5GJWC 2JLWA 3NIBA 4QJ3A 2LWIA 4PZZA 3CB4A 3D31A 1KJYA 2GF0A 1CIPA 1A7JA 3SHFA 3KJIA 4P4SB 1J7KA 1FUUA 1E98A 2QY9A 2EFEB 3NVAA 1ZCBA 1KJZA 2QAGA 4C0HA 4OHXA 5G3YA 3SFVA 4CYMA 4G01B 1GWNA 3CX7A 2NO0A 1WA5A 1Z6YA 1SVSA 2J0VA 1CJVC 1IXRC 4I1UA 3W90A 1DARA 2ZJ2A 1W36B 4G1UC 1L4UA 4KBFA 1T3SA 2ZJ8A 2ZS8A 2G1JA 4IKEA 4PPFA 1YZTA 1Z0KA 1VG0B 2A5YB 2WPDA 2G77B 2ZS9A 4RY2A 4DC9A 3K0FB 1W36D 1UF9A 2ODWA 4EUNA 1XMIA 5CYPA 5C4MA 4EPWA 3MCAA 2JLVA 3P4XA 5HTKA 4BFYA 2ZITA 4HLUC 1ODFA 4HLUA 2Q21A 5CLQA 3KXKA 1UBEA 3KKQA 3O8DA 3KDSE 2QTVB 1HH4A 4JYBA 4DWJA 4B44A 1RRCA 1P9NA 2MSDB 4NCNA 3VX4A 3TRFA 1N6IA 2RGNC 4R2HA 4FMBB 2WBLC 1CBUA 3QPVA 1KMHB 2FNAA 2IYQA 5JMTA 4B43A 4XOIA 3SQXA 3RS3A 2R65A 3DL0A 4FMCB 2ZSAA 5H68A 1Z3IX 1ZU4A 3KKOA 3LVQE 4R9UC 4HATA 1PUJA 2IUTA 3N2IA 3NG1A 5J4VA 3ADCA 2V7QD 5B2ZA 4Q7JB 1QHIA 2EFDB 2OCAA 4PR0A 1OXVA 4RKFA 4OI1A 1UKYA 4KI0A 3FKQA 3U7GA 1E99A 5H8WA 1RVDA 3PEUA 3K0AB 1G291 1A1VA 3M4YA 3OF5A 2RGGA 4LJAA 5GVSA 5KPJA 5FUYA 5F9FA 2ZE5A 2P0EA 5KO2A 1ZNXA 2CBZA 4RVCA 3BBPA 4ACBA 2KBEA 5L3VA 2N42A 2J87A 3CWQA 3GEIA 1T5LA 3EZ7A 1E2GA 3ND8A 3LQRA 5FH9A 2WPDD 2QNRA 2PZGA 2ZU6A 1JI0A 3U6BA 4MRNA 6Q21A 1KDRA 2BWJA 2CNWD 3FFBA 3TBKA 1XP8A 3K0EA 2IXFA 3GD7A 4HB4A 5DSZA 1NN3A 1NVUQ 1SXJD 1ZIOA 1ZINA 2V4ZA 1XX6A 4AYWA 1Z0JA 5EE0A 3D6TB 2G3YA 2YVUA 3OIVA 4PXAA 3QBTA 4GNKA 2C78A 2N46A 3UIEA 3TIFA 3LVRE 1EWQA 4F4IA 4ZKDA 5BN5A 3LFUA 2QU8A 3FFAA 4NP6A 1YHNA 1AK2A 5J5CA 3KJHA 4B3XA 721PA 4Q1CA 3KXIA 3PEYA 3QVUA 4B47A 1ZAKA 1DTSA 3PG5A 3SFZA 2FEOA 3GLFB 2XOKA 1MABB 2VLIA 1OFIA 2RGBA 1P62B 5FOWA 4XTCS 2X19A 1DO2A 3TAHA 2QTHA 4NYMR 1GNPA 1JEEA 2BCGY 1ZM4A 2VP6A 1NNEA 2RGXA 5FL3A 1HQCA 1YE8A 4PX9A 4IHQA 1LB1B 1N0UA 4BLOA 2VPPA 2WJHA 4F7WA 4Y0AA 3FKSA 2GWHA 1G8YA 1XJQA 4HZIA 4NYIR 3NBYC 1QHHA 3QIAA 2NO7A 3RNLA 2CL0X 3TW8B 5KU1A 1CR4A 4JLVA 1P5ZB 2AWNA 1XXHE 4JLJA 4DCUA 5JCZA 2WMNB 1W0JA 1X6VA 3X1ZA 1JJ7A 4UKDA 4O25A 5E7IA 3B9PA 5BW8A 1BKDR 4UNNA 3T1QA 5J4KA 2JIZD 1E32A 3GJ8A 4TL9A 4IEEA 2R6FA 1XF9A 1AS3A 1K5DA 2RB4A 2VHCA 3AVQA 2ODNA 3VFDA 3IEUA 3THXB 2FV8A 2F3TA 1HT1E 3CW2A 3DZDA 3T12A 2HT6A 4NCJA 5DN6D 2QI9C 1JR6A 1NN5A 2ZVPX 2FG5A 2J45A 2GHIA 1ZM2A 3LAWA 3WMGA 2OXRA 2PLFA 3B1XA 1Q1ZA 1OV4A 2GILA 1ZCAA 1JNYA 2V54A 2CL7X 2BVNA 5KNBA 2QT0A 1HYQA 2PT5A 2ECKA 2AXPA 2ZUBA 3W8NA 1RW4A 4URZR 3N2EA 5JCPA 1FMLA 4DHEA 3TKLA 3QXJA 4IFEA 4B32A 4RKEA 5G3ZA 3NHBA 2LCFA 2CLCX 4QKQA 1KGDA 1D6JA 5EXPA 1XTKA 2ZR0A 3R7WB 1GAJA 1CRQA 2GJ8A 4OK6A 4D80A 4AY2A 2AHOA 2JLQA 1YVDA 2VP2A 1AS0A 3AF4A 3HP1A 4UJ5A 4BRUA 1U8YA 5GJCA 1XZPA 5LDDC 2WM9B 1G20E 1CLUA 1Q3HA 4LZZA 3SC3A 2IYZA 2WSMA 3GLHA 4O2RA 2YJTD 2IEYA 3T1OA 1R8QA 4DDWA 4XVUA 3VR6A 5EQTA 3Q72A 2CE7A 1KO5A 4RZUA 3QKRB 4OL0A 3ZVLA 3UPUA 4LHYA 1VHTA 2F3RA 3B2EA 4EAQA 3RRZA 4JLPA 4B74A 4MDFA 1EGAA 1Z47A 4P4SA 4XWKA 1UAAA 2ORVA 4B34A 1NN1A 2VP5A 2GVDC 2WWIA 1GRRA 2OAQ1 4U7DA 1QHXA 4XVQA 1VCMA 3PJRA 4Q9HA 1XJ0A 2G6BA 3AP3A 4V0NA 3KFVA 2IHBA 4YMWA 2GNOA 5LPNA 5JS7A 2NMVA 1CP2A 1W47A 4HAZA 221PA 4XIGS 1SVOA 4PANA 4Q03A 3B1ZA 1CTQA 2QPOA 3W9YA 1VCIA 2HJVA 4LI0A 4G0NA 4LY6A 4BFUA 5L3SB 3ZS8A 1CF4A 2ZYWX 3M1IA 1R0XA 1SXJE 2B8TA 4WA7A 5HZKA 4EKDA 2OHFA 3C5CA 4ZCMA 2C95A 4W7SA 1JXMA 2FSGA 3NBZC 4M1WA 2JASA 5DI3B 2GZHA 2W2XA 3R20A 4C2TA 4DT1B 4LCBA 1KKLA 4MYUA 4DJTA 4CDGA 3WYAA 1S4QA 3CWZA 3HU2A 4IDQA 5TARA 2VRWA 2YV5A 2QG6A 3OFNA 4TZ6A 3A1WA 4MKIA 4HDQB 2JLYA 1OXTA 5HCIA 4BQSA 5JJIA 2D3WA 5KYKA 2AX4A 4U5XA 1I4DD 2EWVA 4X8OA 3CRQA 2H5EA 5FL7D 4B73A 4ABYA 4DZZA 1XPOA 3B8HA 1JPNA 2Z43A 3DKVA 4YC7A 2CJWB 1S0UA 4TT3A 1NKTA 3AB3A 1DO0A 1EFHA 1M74A 3ZZTA 4JYCA 1IOZA 3B60A 5IRCD 3K53A 1T6NA 1NP6A 2IXGA 3IHLA 4LOAA 2IS6A 2ZJ5A 4KYIB 3Q5EA 3PIRA 2BMJA 3E1SA 4E5UA 2O8DB 2WJJA 3QENA 3W6PA 2IHYA 2GEVA 1E0SA 2OCYC 5J40A 2CE2X 3BB4A 1DPFA 1KY2A 2BH1X 2ZEJA 2WAYA 4FWTA 1W36C 4LPSA 4MITA 4JL6A 2BMEA 4MGYR 2ZVQX 2Q3MA 1RKBA 2QP9X 4V03A 2OESA 4DLSA 1OFUX 1AIPA 3OHMA 4DDUA 2EFHB 3FHTA 2ZSDA 1UKZA 2H17A 3NC1C 2VYFA 1US8A 1HE1C 2WTUA 2QAGB 3NKVA 1F60A 1QHGA 1W5SA 3NDPA 4B71A 3FWYA 4QBIA 4LBVA 4S2EA 1EK0A 1XD2A 1DVRA 4A8JB 4DLRA 1KI6B 3BAFA 4OI0A 1OE0A 3QKSB 1Q22A 4W9MC 3LRPA 4EFNA 1VTKA 3B1YA 1XD8A 5CB8A 3VU9A 2XOKD 3DDCA 1TEVA 2PEZA 1II8A 1QRAA 4RD0A 1YZUA 1GNRA 3QE0A 2RKOA 2WJGA 2WICA 1AS2A 3AKEA 3SJAA 1MRSA 1J8YF 1XMSA 2VQSA 5EE5B 3L0OA 1CXZA 3OIYA 4JLKA 2XJ4A 3R9IA 2A5FA 4JBWA 4KLNA 4KODA 1SVLA 3BH7A 4JVSB 2TMKA 1ANKA 3A58B 3BGWA 1MV5A 2KBFA 1W4RA 2WKQA 1IN4A 4PHFA 4LK2A 3RWMB 1SVIA 3ASYA 2K5UA 2ZETA 1G3RA 1G6HA 1MO4A 4QGFA 4AKHA 3LXRA 4Q1DA 1AM4D 2KI5A 2GBLC 5FOUA 5FOVA 2NPIA 1R5BA 2KE5A 2PMKA 2XNDD 2REBA 3BK7A 3LO5A 2AK2A 3P4YA 4MKGA 4D4KA 2REXB 1G7SA 1XTRA 2VHTA 1FX0A 2ZS7A 4IOKA 4MDEA 5KNCA 1Q12A 1Z6TA 4KLZA 3LXXA 1ZNWA 1E9RA 2OEPA 2ZSEA 5BWMA 4JKIA 3RVBA 5BN3A 4JLOA 421PA 2P65A 2IBMA 1II8B 2ZRCA 3DMNA 4BZQA 4Z1MD 1HT2E 2ZRFA 4HZUA 3AQ4A 2XXAA 2P5SA 1QHSA 2QMOA 1A2KC 1E0JA 1TADA 3H0KA 4JL5A 2OBNA 4JVLA 5A4JA 3FHOA 1JR3E 4B2IA 2ASEA 1SULA 4WW0A 5LB4A 2C9OA 1DAGA 3AF0A 2GJAA 1PUIA 2QAGC 2A5GA 3L8YA 2YOGA 1OH5A 1UBGA 4X8LA 1G5TA 4URUR 5EXXA 2ZREA 1WCV1 1R5OA 2H16A 1KK0A 1TMKA 1S3GA 3DZ8A 3AF1A 2UZ3A 3Q7QA 2V8OA 3TLXA 1DAEA 1JBKA 3DVLA 5FTKA 1I4LD 1Z0FA 4CEJB 1SXJC 1ZD8A 5BYJA 4IRUB 4RZ3A 1ZBDA 2VSXA 1TF2A 1ETUA 3UKDA 1ZC4A 2O8BA 5K8UA 1V5WA 3RC3A 5CM9C 3SEAA 5CB6A 1TTTA 4QFMA 3ZJYA 2YWEA 3GQBA 1JXOA 4OYHA 3BB3A 4OQFA 4EIWA 3FMIA 2B8WA 3EA0A 1W44A 4LBWA 2F43A 1JQLB 1COWD 3RWOA 3V4RA 4RFVA 3FOZA 3RS0A 4I99A 1S8FA 4QNRA 1YZKA 4M9XA 2CCGA 4IXMA 3K70B 4Q4JA 3X1DA 3W6NA 1QDEA 3DEFA 4A2PA 3K0SA 1Q20A 1F2TA 1OIVA 4XH9B 3VAAA 3EG5A 1KO7A 4TTPA 2YZ2A 1OIXA 1Z0AA 3PFIA 2B21A 3EARA 4D6PA 1AKYA 1LV7A 3CRW1 2V3CC 3A1TA 1XNJA 4DUGD 1UDXA 4YMTA 3WBKA 1OXXK 1UM8A 1QG2A 1R10A 2HXYA 3WBJA 4Z51A 4CVNA 1H8ED 2OBMA 4IXNA 4B2LA 2O8CB 1IAQA 4DLXA 2OFXA 3BERA 3IQWA 5FBQB 1S9HA 4AK9A 5HE9A 3UXMA 1HV8A 1XCMA 5EUMA 4XWAA 4C30A 3BIFA 1G1MA 4NDZA 2BJWA 1L8QA 3WP0A 1WB9A 3REGA 1S3SA 1FTSA 5KUTA 1YR7A 1KMQA 3PUYA 4TMXA 3GLHE 2F55A 1SQ5A 4OI2A 4DLWA 3BC1A 3EAQA 1GDDA 1CJMA 1JJVA 4ILEA 3Q5DA 5D3QA 1MH1A 2VP0A 1JR3A 3AP1A 5FTNA 2IWRA 2EW1A 5CIWA 1ZM9A 1AJEA 5DIFA 2VH5R 2UVQA 3EIQA 5FTMA 4TSFD 3SHWA 1R0WA 1EX7A 1N5KA 3LQQA 5BQ5A 4HB2A 1M7GA 5EP3A 1ZUNB 1KNQA 4DRZA 2AWOA 5JS8A 1YJ5A 1D2NA 2BBOA 2DFTA 2ZRNA 3QY0A 5JI2E 4XVRA 4CEHA 2FN4A 2WSSD 3A4MA 3CKLA 1EFUA 3U3JA 3EWSA 3U3RA 2ODBA 1GL6A 1BMFA 3KQNA 1RE0A 2C8VA 5DO9A 4C0LA 1KJWA 1AGRA 1WMSA 3MAAC 1W48A 1Z0DA 4Q01A 3ADBA 3A1UA 2JDID 5B57C 4G5OA 1XXHB 1T3HA 3HR7A 2WVJA 3H1TA 1AA9A 1PLJA 2D06A 1J90A 2R6AA 2JJ1D 4V0LA 5K8IA 3SZRA 3QXCA 3ZVNA 4ACAA 4ZV4A 4D4JA 5KDOA 2D28C 2EWWA 2VHJA 2YWFA 2LKDA 4Q7LA 2YWGA 3U44A 2ANBA 1OXSC 2I3BA 2NIPA 4C4PA 1J8MF 4BWYA 4QC2A 5P21A 5L3QB 1Z0IA 2OZEA 2Z4RA 3RS7A 4BFSA 4FN5A 4JVNA 2NQ2C 5DH9A 1W1WA 2PEYA 3PUVA 5AJZA 3U3OA 4PSKA 1YZNA 4I1SA 4NL4H 1NN0A 3OEED 4K81B 5FPHA 1E2DA 1G9XA 2A78A 1E2FA 3I3SR 3VHLB 4CT5A 4IVQA 3TQCA 5EJEA 4KHZA 1Z5ZA 1XPUA 3WNDA 3U3MA 2IYLD 1IQPA 3WNCA 2QPAA 5B64A 3O47A 3SYLA 1SVWA 4Q7KA 3X1XA 3VR4A 3UMFA 3EZ2A 2YKGA 4IJMA 3QBVA 4KAXA 4US1R 1X1RA 1ZVQA 4D4LA 5LD2B 1GRQA 4GOJA 2HYIC 1N0WA 3GJ5A 1NF3A 4RFSA 2JLZA 2Z83A 5CJPA 3KKMA 1GSIA 1HQYE 4LUCA 3K9GA 4QGGA 1J2JA 4RD6A 3RS5A 3K09C 2DYKA 1PV4A 3GFOA 1OIWA 2WAXA 2BKEA 3I8XA 1JEDA 5EE1A 1OJLA 4BLTA 1Q57A 3F3YA 2IUUA 2W00A 5C1BA 1CR1A 5SZIA 1E2LA 2ZUDA 3B7GA 4FCVA 1A2BA 4P31A 2F43B 4E09A 4WIAA 2IW3A 1Z6AA 2DFNA 3QSYA 4NH0A 4U00A 4DLUA 1AZSC 2GJKA 3WY9A 2Q9BA 1XEWX 1VYTA 1YZGA 3QVVA 2MMGA 3JZAA 2DFKB 2P6RA 1SVKA 5G41A 1E4YA 2HF9A 4EDHA 5DHAA 1VG8A 1NG1A 3MLEA 1VCNA 1W2HA 5BN4A 1V43A 2PLRA 3NWJA 4N0EA 4CT4B 4H1VA 4M1KA 3SJCA 4KO8A 2D27A 3MWKA 4GP6A 3QOFA 4LJ4A 4ZDJA 1N0VC 1H65A 1T5IA 2ZRBA 4DUGA 2HV8A 1QBKC 2GCNA 3QKSA 1FQKA 1WBDA 3AVXA 2W2VA 1Z22A 2PBRA 2BJVA 2ONKA 3WHLA 3B1WA 1HEIA 5TXGA 5KSZA 2O8DA 3RYTC 1TX4B 1HA3A 1R0ZA 4RD4A 2UZIR 5AJYA 2JA1A 1IJEA 3ZQJA 2E87A 2HUPA 2ZJZA 1E9SA 4LV8B 4Q4HB 4PZYA 4QRHA 4YQFA 3K09A 1LFDB 5FBRB 5JRJA 1DAHA 1FP7A 2V1XA 3K0CC 1FX0B 4BFWA 4BZXA 4B76A 2BM0A 1QF9A 3GEHA 4O2LA 4ASUA 2I1VB 4KVAA 1S9DA 5AWFC 2GKSA 2J7KA 2WHXA 3OIWA 3VTKA 2FF7A 3AEZA 4B33A 2CHGA 1F48A 3S1AA 2CL6X 2VL7A 2IYSA 4CW7A 2N1BA 2AK3A 3VNUA 1LNZA 5CM8B 1G17A 1J99A 1P73A 4AI6A 4F93B 1E9EA 2BM1A 4OHYA 2ZU0C 3BORA 3GJ7A 3LLMA 3LWNA 4YDSA 2DFLA 4NBSA 1NMZA 2EYQA 4OBEA 2XJ9A 4BFVA 2QN6A 3W3AA 2YOFA 2Z6VA 2QE7A 3WXMA 3PEWA 2GZAA 2OFWA 1OW3B 3FGNA 5GADl 4DBLC 5J4LA 4IDPA 1MO6A 5L8VA 2CEAA 3QF4A 5DLQC 5GVRA 3MFYA 2HEIA 4HDCA 3FVQA 1HE8B 2BEKA 5KHOC 2WIAA 3MG9A 3SJZA 4WBSA 1Q44A 1DE0A 2IYXA 4QGHA 3RSLA 4M1OA 1FP6A 1C9KA 1EWRA 4LDJA 4FIDA 4F91B 2JCSA 4S35A 1SKYE 1U81A 1SKQA 2CHVA 4DSUA 1GFIA 4LYHA 3TNFA 4Q21A 3QF7A 4HEJA 4JLDA 2H8KA 2RCNA 2Z5FA 3FTQA 4ZCLA 1G5PA 5IK2A 3WNBA 3VHXA 2BMFA 1OH6A 2CVHA 3F5FA 4ARZA 5TDHA 4AURA 3N5CA 2O8EB 3SN6A 1G19A 5FI1B 2GESA 3A6PC 2KSQA 1U8ZA 2FU5C 3FDIA 2EVWX 1EFRA 3KQLA 1RRGA 1P9WA 3LX5A 1AN0A 3ICEA 2XZOA 2HCBA 4IOJA 2OFOA 2W6IA 3U61B 1OKKA 2WJIA 5C46F 4YDHB 1IY1A 4TLCA 2D4HA 1G5RA 1Q3TA 3WMEA 4BFTA 1OB5A 1FPMA 3V4FA 1O87A 1M1YE 3NTUA 4K46A 3GLIB 1X3SA 4BLSA 5JSZB 4TLDA 1C1YA 4HUQB 2C77A 1Z08A 2ZR7A 3AV0B 1WQ1R 2GZDA 4Z8XA 1VIYA 3R8FA 3OEHA 2D7CA 1KO1A 1MOZA 1KNXA 1QVAA 4HSEA 5AUPB 1G8PA 1NSTA 3CR8A 5FPSA 4M4SA 1VIAA 1VCOA 2OV2A 5KDDA 4OQXA 5L3SA 2ATVA 2DCUA 4ZDKA 4Q5IA 1EFTA 2FZ4A 4H1UA 4DB4A 1RIFA 4WZAE 5LB2A 2VHUA 4ZIRA 4ZI3A 4TLBA 2GCOA 1W4AA 2REOA 2YINC 4TZ0A 4V0ME 3UWOA 5CK4A 3QG5A 3DMDA 4AWXA 1N25A 2ZRLA 3C7KA 3KQKA 2FZLA 5FTJA 4B2PA 3AUXA 5TV2A 2RGNA 4BFXA 4IOLA 1M7BA 1F2TB 1Q1BA 2UKDA 1S2MA 1Z29A 1DAIA 2BIFA 2GBLA 4KVGA 4LBYA 2C5LA 2J9RA 2PH1A 2QP3A
chains in the Genus database with same CATH superfamily
3PQDA 3UO8B 4IFTA 5DTMA 3RH8B 2JAPA 5TJ9A 1BXKA 1X7WB 1ZGZA 3NH6A 3P27A 1OLSB 1PW7A 4GSLA 1LK7A 5YASA 3LFHA 2CGEA 2HSGA 4GXQA 1QYRA 2O0YA 3EOZA 5FLYA 3RFVA 4A92A 2BLSA 3PL1A 4FE7A 5JXJA 1IUOA 3BTVA 1H3EA 2FAXA 4RM3A 3RG2A 5E6SB 3OBBA 4V3CA 2O3UA 3NDJA 5E4FA 4LCLA 4OH7A 4RQUA 3PVZA 4DIDA 2LB9A 4CEIB 4C4OA 2Y1KA 1V26A 5JH7F 1P17A 3TG9A 4EG4A 2J5QA 3OWOA 5CA1B 1HNWB 1KZHA 3KTDA 1SA0B 3TR6A 4Q6WA 3QTLA 2A3UA 1CJUC 2Q5JA 3PC3A 1SJ9A 3OIFA 3HCRA 2FOXA 4OOLA 2IXBA 3I6BA 2VA9A 1DG9A 1DIRA 2A3RA 3G7NA 5KTOA 2XDWA 2ZRKA 1AHPA 2C5WB 1CS4C 1T15A 3TKAA 3Q87B 4ZZ3A 3GXBA 4FYVA 3ETLA 4DDKA 4MPPA 3USCS 2BDEA 2OOSA 1Y37A 1S6RA 3I0ZA 4EHKA 1GP2A 4Y9TA 2ZD8A 1UFOA 2AXNA 3D8NA 3FPAA 3I1JA 4BXOA 2XUOA 3HC7A 4KLRA 3G8CA 3LI2A 4B3DA 3KAQA 4HNTA 2I9KA 3BK1A 4MLPA 2BKVA 5EM0A 3SG0A 1G60A 1Y9EA 1DEAA 2NV2B 5H70A 1IXYA 5FA7A 3P8ZA 4PAQA 4II7A 4ANFA 3VP4A 2NO1A 3UK2A 3LY4A 3IUBA 5CTJA 1Z83A 4G41A 1XPBA 2BFPA 3ISJA 2P30A 3ESZA 2QKPA 3KKPA 5DN6A 4AULA 1UK9A 4OHZA 5B55A 3EGIA 5H8WA 1VP9A 3VYTB 1C0PA 4KG5A 5HWWA 1VE1A 2BSAA 3GJ6A 3KZCA 3LGAA 4IRMA 2Q3CA 1FCOA 1P81A 4YECA 1ABBA 2HDHA 3QHYA 4ZDXA 1BGXT 2AJCA 1KGGA 4H7FA 3VP1A 2KW5A 2O2ZA 3WWXA 3NWEA 4KX5A 4MS4B 3TIGA 2OFFA 1OTBA 3A32A 4IHAA 2BE7A 2QTBA 4RVFA 1XTQA 3G3EA 3DMTA 2VDLB 2Q1TA 2CUTA 1TMOA 2WJPA 1JR3D 4O4HA 3AR3A 2GPTA 4UBLA 4P93A 1DKUA 1ODVA 1DX6A 4J1SA 1LSWA 3TW8A 1KFEB 1CERA 4J2HA 4PROC 1LS1A 1BDMA 2VQ3A 4Q3NA 4XM2A 4E3WA 2QB5A 4US2R 4FNGA 3U4QA 4E3LA 1PIWA 1PZHA 1EVZA 1T4GA 3TGLA 2ZOHA 2ZIXB 1ISIA 1NDHA 5KJ6A 1L8AA 1GY8A 1P0IA 4FU0A 2VZ9A 3MLAA 1RYNA 1NRFA 1IQUA 2GUWA 1EFPA 3BQ8A 1QH0A 2ZPTX 3QI2A 5ALDA 4IEIA 3CX8A 3ILXA 4XA8A 2B36A 3FPSA 1JHVA 4PFSA 5A3QA 2WEKA 3P9PA 2IRWA 1R12A 1NUQA 1VHLA 1RXYA 2XQJA 3MD0A 4FI3C 4FHEA 2ENWA 1UMCB 4IDOA 3IP7A 4QBKA 3NOXA 4G24A 4WELA 2EQBA 3O4FA 4G9BA 4OJKA 1IN8A 4KZ7A 5MN5A 3U5TA 2PT7A 1QHHB 1Z4PX 4BFZA 3EZNA 5IP5A 1TQHA 1U2SA 5EJ4A 3CXRA 3VQTA 3AEKB 2D13A 4BMCA 3ZDCA 4P7GA 4OHPA 4Y6QA 2HV9A 3X1KA 4KMMA 3LYXA 5CRFA 3O5YA 1SCBA 3ZPXA 4BS9A 2JKGA 4LHVA 3RABA 1E6WA 3BOSA 3HHPA 4N0DA 4U2BA 3GZTB 2V1BA 3DEJA 1MU0A 5EFZA 1MQ9A 2PNFA 5TBMA 2GNXA 5GHYA 2YFQA 3TSZA 4AN1A 5FH9A 5F3WB 4YV0A 3IUNA 2J80A 3B70A 1Z3CA 1UZUA 1MABA 3U7JA 1KI6A 2WHPA 5KOJA 1NXVA 3GDGA 3LUAA 2NACA 2IPMA 2CT8A 1JFVA 4PXSA 1RLIA 3UN7A 1BDBA 1J0CA 1FTGA 2W58A 2WV9A 3ORHA 4ZAWA 4ZCSA 2NU8A 4Z6KA 4S2KA 1IIRA 4ZXPA 5T4HA 1GPMA 1VM6A 1AKMA 3IBFA 3LX8A 3ZY4A 3PFWO 4KIGA 1T1EA 4U0XA 4W5JA 2MCFA 3TZKA 4PZ9A 3D4PA 1ZMOA 2WHQA 3EH2A 3NEYA 4JIGA 5DNEA 3SNKA 4JQYA 3FLBA 3DLIA 4I8XA 1UJCA 1T9BA 5J5VA 2P9VB 1XQXA 1RGYA 2Q4BA 3B5IA 4J1NA 5DT9A 3OZGA 1CIVA 1E3MA 2NU8B 4MIKA 2HPHA 3LIEA 5FQJA 4TUYA 4Y9RA 5LZ8A 4YV1A 4DCGA 5G4KB 4Z3DA 2WHPB 4B8YA 1FSGA 1XZKA 3EIOA 1XQYA 4RA6A 3MRVA 2O57A 2WHEA 4HAWA 4ZC8A 3FFXA 5IK2D 1WA9A 3O4VA 1L7OA 3G8DA 3QF4B 4G3KA 5KTRA 2ZG6A 4QU9A 1TUEA 1QK3A 2C98A 4EFKA 1OH7A 4MQEB 4IDDA 4KPFC 4AUKA 1GGMA 2QYOA 1D2EA 2BM9A 3QUTA 5IZ4A 4BPBA 3ICYA 3CZAA 5EZ6B 2ZL1A 4MIYA 4EETB 3BXZA 3CRMA 3FMPB 1KI3A 1WZNA 5SY6A 5F2NA 5CIQA 4EY6A 1RQLA 3FNGA 1DINA 4IDFA 3TL6A 5HPYB 1CYEA 3OMLA 4PG8A 4ZARA 4BQNA 5DMXA 1N3BA 3UVEA 5BW4A 1KXZA 4ODJA 3NHMA 3P9YA 4P7KA 1VL6A 1V3TA 3TDMA 4EQ6A 5BY2A 4X56A 1W59A 2W2OA 2FW6A 4YJGA 5FWXA 4RCZA 4NX2A 1KYZA 3WIVA 4MRAA 1Z6FA 1GT6A 5JAHA 1JZSA 5SZHB 1FB5A 2VPTA 1RKVA 1XNQB 2AXQA 5DTQA 2PX5A 2ZDGA 2ZB7A 2YIJA 3CLSD 3AF3A 3JQAA 3Q8XB 4MR7A 3WS1A 2VTVA 4LHZA 1C8BA 1MN6A 1Z0ZA 5KYNA 2UUBB 4YI5A 3LQ4A 3RJUA 5B4VA 4PHTA 1HE4A 2ZYUX 3BIXA 3DC7A 1XWIA 1QHNA 1PJRA 1BX0A 1MPTA 2SCUA 3PR1A 1Z45A 4JEMA 5E8RA 3A9CA 1Q92A 3ESXA 3N6XA 4UTOA 3ZJ4A 2FETA 3PIIA 3NOTC 2AZXA 2GRJA 4KE7A 1F8FA 2EX6A 1TCAA 1XDWA 3MN1A 4OGFA 3ZNOA 3D6FA 2NYAA 4V0OA 4X64B 3AVVA 4KITB 4EGCB 2O0JA 3GDOA 1MWSA 3NHJA 4X1IB 5KUTA 1HFWA 4NU8X 2XLNA 5GONF 3TXAA 2OSVA 1BX3A 1K0UA 1EB8A 1JDZA 3L7YA 1SCAA 4Z4IA 5JJLA 4GUAA 3IJEB 1J8DA 1P29A 4YT2A 1ZK4A 2W6CX 3LYUA 4UXHA 2HT1A 1PR3A 2IYNA 2OYSA 4ARZB 2Y66A 1HYGA 1JPVA 1R6DA 3PUIA 4QD3A 5K6TA 3KX0X 3KSFA 3SE0A 3PUHA 4H7KA 4RACA 5DHTA 4ETNA 4MVJM 1YULA 1GG2A 3UA3A 4EJSC 3U17A 2CC1A 3ZIDA 2DH6A 3VR6H 3OM9A 3VV3A 3VR5H 1Q3KA 3ZKWB 3CLRC 3D3QA 2P20A 1RG9A 1D5WA 2V0UA 3B5JA 3JYPA 4W6ZA 1YRLA 4ZO8A 1XHEA 3SKVA 2CXHA 1JEQA 3GCDA 5DE3A 2D2FA 4CQLA 2YYZA 1PYYA 5EYPB 1N5LA 3M6UA 1ZUHA 3FZGA 3P9KA 4MUXA 1DXYA 1XA4A 2IYUA 1CRPA 1E6CA 2JS7A 1QUEA 3IQEA 2Q4EA 5HJEA 4IO0A 3PNSA 4BC1A 2WM2A 1STZA 5JEEA 4XEUA 3I61A 3SQWA 1M67A 5C5DA 4WXMA 1M76A 3FUWA 1CJTC 1PE0A 2RHRA 1C2TA 1NYYA 2C07A 1Y5LA 2NQTA 3O7WA 5C32A 4JYAC 2XH8A 3L92A 4TV8F 1DOHA 4YDQA 1MB2A 1R3DA 5LQCA 1ZCJA 4U3JB 5EMLA 3N7UA 1E4VA 2PMDA 4HQNA 4X65C 1RT9A 1U94A 4RFSB 5IEJA 3BH0A 3IT2A 4D57A 1BWSA 2J3IA 4ITRC 1YHZA 1DOZA 4NZPA 4RKYA 1ZI6A 4GJ4A 5TNXA 3C5HA 1IZ9A 3P5SA 3BVPA 4KWHA 1P61B 4MDHA 4MRVA 3FPEA 4RCYA 4PVCA 3DLHA 2YV2A 4DZRA 3N5KA 4EFMA 3PGMA 1JG4A 1LBIA 3L9XA 4CF7A 5EZSA 4B82A 3KJZA 4BQRA 1L7NA 3A1EA 3LCMA 4R1OA 1JR2A 2G83A 4FYJA 4L28A 1Y89A 4Q82A 3KYBA 1C0IA 5I8ZA 1Q83A 3C8HA 3KUKA 4HI4A 4EHFA 1LPMA 1EIZA 3CEMA 4HGQA 5DHSA 4F11A 4YFVA 1KYYA 3WAKA 1K25A 4NABA 4RXUA 3WK9A 1YDEA 4XSGA 1AO3A 4UC0A 2I6TA 3VM6A 2Z3WA 1T0PA 4NV3A 3R7BA 2R78A 2OSBA 3AVPA 4NFLA 1KPIA 1II9A 4CN8A 1J0BA 4QNMA 1OYWA 3AHCA 3GP8A 2HDQA 1L0GA 4WOJA 1JKMA 3KOOA 3D6JA 3RRXA 4KR0A 3TQOA 4Z4GA 1O3YA 1NV9A 3NHQA 1UL1X 1MOPA 3SDBA 4ZDIA 1YB1A 2Q1YA 3W4KA 4MBFA 1H8HA 4GLBA 4KTVE 4U3JA 5DYTA 3D1VA 2QJFA 4ZTUB 5C1IA 3AWDA 1P2TA 3HNOA 3FPCA 1H9BA 4MAFA 4MSUA 3ICOA 4JB3A 4TYYA 3TTVA 1CT9A 3IBJA 4HEA1 2O2SA 4EWLA 5EGNA 5MFZA 3SR0A 5A2QA 1NXSA 2JGFA 2GB4A 1X8JA 2P2FA 2IY7A 4LZNA 5IT9D 2F3SA 5JXHA 1G41A 1Z9BA 3MBZA 4ZJZA 1IRIA 5AW4A 1SXQA 4G4JA 2XDYA 4B9EA 4QUDA 1V1MB 2A9KA 3HFSA 2O7RA 4H4CA 4GLQA 1PG3A 1ZD5A 1KAEA 1KI8A 1YBMA 3T5PA 1MAWA 1NY5A 3T5GA 5BV0A 2HF8A 4MJXA 2J3EA 2WSLA 3SHQA 3IJRA 5LYJB 1MBLA 4L16A 4Z1MA 1WPGA 2HA0A 1K6SA 3EEIA 5JH7A 5IT5A 1B74A 4HDRA 5A5EA 4TQUS 3Q8LA 4ZICA 2P75A 2WUFA 3UMSA 1SXJA 3QX8A 1VPTA 1BMFD 3SDZA 1QQ5A 1ZNYA 4YAGA 1R4NB 4NE2A 5EIBC 1PEAA 3CLHA 5K20A 3OTIA 2PZJA 3FMVA 4R7GA 3IV7A 3WGMA 2G7MC 4H08A 5GJBA 2F9LA 3JYOA 3UATA 1QWIA 2YZ7A 5KSPA 3ZWOA 4HN9A 2NW6A 3QJGA 3CKYA 2G7UA 1LSOA 1A69A 2VNHA 4NK3A 1SQGA 2XUKA 3NBXX 2UUOA 2XH9A 3OOWA 4QUHA 2IS2A 3N53A 1U8FO 1B3RA 4MTNA 4N5IX 5EJ8A 3TSGA 1WUTA 4WN9A 5TVKA 1C2YA 2MSKA 2QVGA 3RVDA 4B1FA 1TA9A 2GDZA 3T1RA 1P72A 3MJCA 4MQFA 2I8AA 3FTCA 8LDHA 2X15A 2IQ5A 4D4MA 3ERCA 2ZM6C 3S68A 2QRNA 3FETA 1JBEA 4J07A 4B4OA 1N6LA 1OX6A 4IYRA 5TGDA 3V7YA 3LT2A 4TKLA 1CCWA 4MMNA 3FNQA 3PNKA 4B4DA 2IX3A 4KLCA 5K85A 1PTJA 3HDTA 3LWDA 4BMZA 1ZGCA 4JI0C 1H1LA 2C57A 1P97A 5I9IA 3G13A 5IF9A 5I7OA 4JUIA 2UUBC 3D8TA 4CLOB 3LC0A 1EDBA 4LV5B 1W0KA 1EVLA 2DH5A 3DO6A 3HSKA 1MT0A 4XE5A 1PI3A 4ZKEA 3C3BA 5I45A 1DWUA 4N1AA 1ULSA 3ZV3A 3BJMA 5TT1A 5J3JA 2JB9A 3DEIA 5EHQA 4UTXA 3I6ZA 1XX2A 3UK1A 4EBNA 4HDMB 3BJEA 3LCEA 4PRLA 3Q88A 3U0VA 4E22A 2E7GA 3LFVA 4R9SA 2ZAOA 3OIUA 4ESPA 2R2GA 2X6RA 1XNRC 1E2EA 2A5JA 4LVUA 5DWDA 5FFFA 2DLNA 3H1PA 5KNCH 3FPFA 3UBTA 3PVCA 3UAOA 4YJFB 1Z7WA 4E94A 4Z4QA 5KNDH 5IAOA 1WU7A 2VK8A 1FR1A 3Q7SA 1FUIA 3OLZA 4TUYF 1WBDA 3UG6A 4ND7A 3OZVA 2YFYA 3RHZA 1U2RA 3T52A 1GSWA 1SWVA 2P62A 3R1IA 4XJSA 3LH5A 4BX3A 2ZJOA 4BXOB 1T2FA 1U31A 4IIFA 1F6DA 2WWFA 1GDHA 3LS2A 3MWDB 3IQXA 3N9IA 2PR7A 4MV1A 3OZ7A 3TR5A 4IH4A 3DE1X 1TZMA 4TKVA 3MWJA 2WQZA 1P39A 4GHWA 5K4AA 4YRQA 4PQGA 5LQSA 4WZAB 3TOSA 5JANA 2C96A 4ZODA 3BT7A 2FYTA 4A03A 3ZHXA 4DG8A 1LBEA 4BZZA 2BMDA 2XRFA 4NXBA 2XDQA 2QE6A 2HFJA 3P19A 1G2OA 1AKEA 5CVJA 3U80A 2VEAA 3HCPA 4XASA 1J7JA 1U2EA 2PHZA 2AOXA 3DYIA 1N33C 1DT5A 5HUJA 1XZAA 4JJ8A 4LX0A 5ANRB 4PAOA 3RRJA 3WIBA 3WDSA 4D7AA 5AUNB 1XEXA 3L6OO 5A05A 3ZVMA 1A8SA 1I4WA 1UPTA 1KYWA 3H2YA 3CQ1A 2HJ9C 1E2UA 3VDMA 3EVGA 4URFA 4L57A 3A6DA 5CGSA 2P2SA 3EGXA 5AKJA 4PG5A 5EI5A 5H1YA 4BC7A 3M6LA 3F6SA 1E7MA 2BEVB 2XEPA 3R3JA 3NOUC 4M1ZA 1BIFA 1DIGA 3VJKA 3SBOA 2Z58A 2J7PA 1PG2A 1E2PA 2SICE 4H4EA 2G1KA 1BWQA 3M0EA 3PQ4A 3T1SA 3P9RA 5K1ZA 4EG1A 1XSEA 3F3MA 3TAXA 4DQDA 4F5WA 4FYXA 1WF3A 2QQGA 3PA6A 2Y2LA 2CDBA 1TUGA 2W8BA 2O0HA 1W5EA 4OXKA 4JOQA 3I5MA 5CVDA 4RS3A 1G8MA 5BV8A 2WU3A 4L0QA 5DYWA 4DLYA 2D1FA 3D54D 3E15A 3OPNA 1UBCA 1Z5WA 3ACDA 1QKIA 5H02A 4ZVTA 2P9GA 3L0DA 3MJRA 4O0PA 1L5SA 1ONGA 1NVVR 3C8UA 4Q1AA 3SGLA 3RIMA 3PD1A 3PWTA 4FHDA 4WEQA 5D7NA 4W1QA 3BXXA 2JJ2D 2OORA 1GG9A 1UEXC 3DCYA 1QX3A 4EB3A 1Q0TA 1H4SA 3VO2A 5I51A 4LRYC 4KUEA 2A24A 1A76A 1SR8A 2RAPA 3HKEA 4MPRA 4LF8C 4U2DA 3OA2A 5FOSA 4RE6A 4QPCA 1YZLA 3NEPX 4FQ7A 2OWDA 3Q7ZA 1ESMA 3WRYA 3ZNNA 4D5GA 1AMOA 1KDPA 3UY6A 1MDBA 1GNVA 2IUEA 1KSGA 3OZDA 4ZEWA 1O0BA 2O3QA 2XA2A 3DFZA 4JI6B 2RMKA 1GSVA 1D0IA 2P4EA 2QMEA 1E3DA 4HWGA 4OBWA 3PBNA 2FSHA 5IAKA 3KBBA 1G3QA 1AQYA 4QDZA 4BLQA 4C07A 5AUQA 2M7VA 5ITZA 3ADOA 1QBGA 3WLIA 3DEKA 5E7JA 4BX8A 2GA8A 1O95C 4F2GA 3UB4A 5FNVF 1XL0A 1A5SB 1CC1S 1EFRD 2UUPA 3I28A 1ZXXA 2PKQO 3KDAA 3S40A 2XNDA 4E7PA 2PBFA 4LFAC 4QFDA 5COBA 2ZSUA 1NP3A 1ATZA 2OD9A 1F8YA 3MJTA 3IB6A 4IXTA 4YAFA 1T1BA 3K70D 4G0VA 4L3OA 4L4ZA 4RXTA 4WE3A 4DTIA 3KR9A 2Z2MB 4MLDA 4PZCA 4YRAA 5JNVA 4I4TF 1AGPA 4WFQA 3WGJA 1N36B 2VRCD 4KYVA 1NRJB 1XWWA 3FB1A 4MPTA 3DLPX 1Z5OA 3C3WA 1D4FA 4TSKA 3TTXA 1DC3A 1C3EA 3E0QA 4GX5A 1JBQA 4IH1A 4PM6A 2GD6A 2JFGA 3EXEA 2GCPA 1OMOA 4KCGA 4EBLA 3ZVRA 2CKDA 3UQZA 3KPWA 2QX8A 2GYVA 5BWBA 2HF7A 2GK6A 2E18A 1UGUA 1R8SA 4GS5A 3THOA 2CL5A 4EI7A 5T6MA 2BKUA 3QEOA 4Y7DA 2F7SA 5CG1A 1Y42X 3UWPA 2X77A 5E2FA 5ELMA 1MNAA 1QIHA 5K0TA 2B4KA 4N5DA 1HDEA 1FNNA 1W4LA 3OZCA 2OK8A 2X58A 5FKJA 4N65A 1IKIA 1NVFA 4I4LA 3FYTA 1SGWA 1LL9A 2FUNB 5ENDA 3TNYA 4KR9A 3EA5A 3UG7A 4E12A 2BPOA 4ARCA 2AUTA 1T6BY 2QYSA 1ZK0A 3S2GA 3RHTA 4IUBS 1QTRA 3QKIA 2AHRA 4L4YA 4RF2A 5BSTA 4BBYA 2DQKA 2K87A 1XGJA 2IZ7A 3ONFA 3O6VA 5FUWA 1YQEA 4O2AA 4YIHA 5LMNC 3F1OB 1NW3A 2AKAB 4XPIB 1USPB 1V95A 1V37A 3W5UA 3BHIA 2QDKA 2QMIA 3JWIA 3SIWA 4KWCA 4ZJ2A 4CQMB 4OMCA 2OR3A 1B14A 4RXMA 4EX7A 1UZLA 2HRDA 4BJ6A 4MW7A 1U8EA 4YJ3B 4DR2B 4PZLA 1JDBB 2JAHA 3LRXA 3SYKA 2BTQA 3RUHA 5ILQA 3WIOA 5F1GA 4PIPA 4QEKA 2UXDB 2FXIA 3I9JA 3BSWA 3ILVA 3RK1A 3QP1A 4N0MA 3ZC3A 1U5BB 2J30A 2YWDA 1HLPA 4O02B 2PRFA 5B58T 3IDZA 4HI0E 3T3PB 3W4JA 2IIPA 1F6BA 1GLVA 1U9IA 1SUDA 3G1UA 3JD1A 2X1MA 4IVRA 3DHWC 4OY3A 3T15A 4J2TA 1YL7A 3FN4A 3M5CA 4YJFA 1YKFA 3L7OA 1N34B 1TTQB 2P0AA 4L8GA 2PKXA 2QN3A 2OCDA 4A36A 3VYVA 1GYQA 4LV1A 2MYUA 5CM2Z 5MGBA 2B9EA 2QTWB 2RCYA 1ZSNA 5J47A 3QQ5A 3W5JA 5JAZA 4ZQBA 2JFHA 3B52X 2QQEA 3JQCA 5TMBA 3FNHA 2ZBGA 3IP9A 3HJKA 4PLCA 3I1FA 4I9NA 4KAJA 1XU4A 2XMPA 1VQ1A 1MQSA 2I8LA 2VH1A 2XB8A 2VBFA 3MWEA 4NQRA 5EE9A 4JVMA 5AHWA 3ZS9A 4KWIA 1Q2UA 1PJTA 4NYJR 4JF5A 2V8BA 3SU8A 4N82A 4AECA 2DPXA 2LIVA 4QUJA 2NT3A 3ORYA 3KHSA 4Z1OA 5B6PA 3GVXA 4ZAGA 1FFWA 1HFJA 2XWJI 3MWEB 3HCYA 1B0AA 3W4PA 2BFCB 4F3LA 1ZVJA 2F1HA 5D87A 4KR6A 1XNGA 4FXPA 4TYQA 1WDLA 5F2OA 1SCJA 2E1RA 4YMGA 1S5PA 3OSUA 2B98A 1BDIA 2VGJA 3EXHB 5E0KB 4ZJUA 4URWR 4AJNA 3LQYA 4MRMA 3U4QB 4E33A 2CHFA 1U7UA 3PR6A 1F1BA 3UJ9A 3R9XA 2HIHA 2ZWVA 3QIVA 5CH8A 4DTCA 4HPVA 3D6HA 3VNVA 3PLNA 2C88A 2N75A 3L18A 1TF5A 4RPIA 3RUAA 1CQWA 1JXAA 4P5EA 3A2LA 1CRWG 3CLUC 3VKFA 3TD9A 3HZZA 4IUHA 1GSXA 2CHQA 5C81A 1F0NA 3MS6A 1XTSA 1XOIA 4E5YA 4DSTA 3JCZA 1T4DA 5F98A 4LNHA 1CQJA 3NC0C 3K2IA 5TPZA 3PDUA 8ABPA 2FKNA 2EATA 2IP2A 2Y68A 1N6OA 4BGIA 1T36B 1UWNX 4QD4A 2AI1A 1EI5A 3UJ8A 3UT0A 1FYVA 4TTTS 1S2NA 2DU8A 2JHCA 4C3OB 2LTAA 1L5YA 4B48A 4W5QA 2O9BA 2FN7A 1MLDA 2CEKA 1CPYA 2IUYA 2ZJ3A 2I65A 2YCBA 4OLDA 2Z5LA 4KO2S 5KQPA 3AGDA 5IAJA 2GXQA 4JI1B 4DUYB 1E62A 1LW7A 3LX4A 3EF3A 3QX3A 4PONA 4B3HA 5EP2A 4M2LA 4AD8A 4ISBA 4MW2A 3PHHA 1GGJA 4XIIA 2IH2A 2B8EA 4DG5A 4EHJA 5JD3A 4D98A 4EEZA 2UUCC 1TAQA 1TQDA 4HZUB 4AZ3B 3UMRA 4HX9A 4XDHA 2W3FA 1PL7A 4J2OA 1HR0C 3LIPA 4M6WA 4YV2A 2Y76A 3EQUA 3D3EA 4UZFA 2VYNA 4ERXA 1X13A 1MA3A 2DBZA 2VQEB 4HEHA 4TMVA 3V8QA 2AR0A 3SP1A 5DVAA 3D6NB 1XCGB 4M9ZA 4MW0A 4W9NC 4X7PA 4DMKA 3MTDA 4KQWA 4DJ2A 2O4CA 3W3AD 5K01A 2WAMA 5JBQA 1IWPB 1D0VA 5JECA 1NE7A 2OBLA 5IDYA 3IO3A 5KIZA 3GUUA 4E2XA 5IJ0A 2NUTC 3N2YA 2NAFA 4ZOLF 2F6RA 2OILA 1A4UA 2B99A 5FUBA 4RA7A 1FQOA 1OZGA 3QITA 4J4HA 4MCHA 4OK3A 4RD1A 5IEBA 4LE2A 3VZDA 1BYUA 4R3JA 3KEFA 2LR0A 3E4OA 4HESA 2WMOB 2XY4A 3ML1A 4HGPA 3ZZ1A 3U7HB 1Z75A 3BS4A 3EPRA 1GT91 1R1DA 1ZJ6A 2ZQ5A 3FBTA 2PJUA 1N4DA 3NM6B 4DDYA 1O97C 4L02A 4P83A 1IHXA 4W1SA 4V1CI 4CQMD 5LWHA 3CONA 3WS5A 4DMFA 1SIOA 5DYNA 2ET6A 1ZW6A 5E3JA 2YZMA 4K9LA 1GSHA 1WNTA 4QHSA 4EA9A 5JEDA 5F5LA 4EGAA 2ZWOA 4JCCA 4A0QA 4XD2A 4BMNA 2NTYC 3OU6A 2EX1A 4LDQA 4P5PA 1I33A 1WYCA 1CFZA 1V16B 3K71B 2VTBB 3W5IA 1Y8ZA 2GARA 5BW5A 1ST3A 1ZJWA 4OPYA 3OPQA 1XELA 2QAJA 4HH4A 4HQ6A 4OL9A 5CB4F 5DRTA 3RE1A 1A27A 3GLGE 3K7EA 1MPLA 1H0HA 2O06A 4PLVA 2AVXA 5ES3A 1GHMA 3OOSA 2AE1A 5J23A 1FFDA 1OGJA 1W94A 1H5NA 3KYCB 4AZTA 1DKLA 1P9LA 4BNIA 1OMEA 2W83A 5EIOA 3Q4GA 2J5XA 1OPXA 1TOAA 2F59A 3MWLA 1NJFA 1WEHA 2WTBA 5C7YA 3MKEA 1UEJA 2C61A 4NHOA 3TGPA 1SUEA 2DVMA 5BRNA 3CGWA 1H1TA 1HNXB 4FMCF 3TQIA 3C2QA 5IAAA 1SOVA 4WDQA 2C6WB 1KHTA 2V20A 3GROA 4X71A 4CKWB 4V1CB 2ZUSA 2ZQDA 1SCKA 2B1JA 3H86A 3M3DA 3TQQA 3LZCA 1FS4A 3GMIA 3T35A 4AG6A 5KU7A 2DTEA 2WT9A 4KZ5A 1M9NA 1Q1QA 2JFPA 4ZVMA 4H3VA 4UE3S 4BZPA 1S89A 3NULA 2RI6A 5AHOA 3B53X 3TLMA 1T0UA 4Z4EA 4BNVA 2ZBRA 2FTKE 1CNFA 4CKWA 3MA0A 1M40A 4HRYA 2P90A 4NKRA 2QRHA 4P33A 4Q19A 4KXYA 3IPLA 2HWKA 1HNXC 2H0YA 5LYJF 3A3OA 3O86A 3H6GA 4J9UE 2BCJQ 7GPBA 2IHZA 1G7TA 3DXZA 3JQGA 4BNMA 1R74A 1XZLA 3O0DA 2Z2JA 2O9JA 2JAWA 3ADKA 3AR6A 4I1VA 2ETVA 3ITBA 3PRKE 3T4EA 5I94A 3ZBTA 3THXA 1X1DA 2LP4Y 1YCFA 4RH0A 4E6PA 2F8MA 3NV7A 4LDZA 3EIUA 5TR9A 3DHEA 4FFSA 2BE9A 3TL3A 1RD4A 1FFXA 2ZGVA 1Q0ZA 3R5XA 4FVTA 3RDPA 1V0JA 6GPBA 2DWCA 2A8YA 3Q10A 3A6KA 2NU6B 4NFHA 3H3XA 3I5UA 3JQAB 5E95A 3CUYA 3SR4A 1FOEB 3PT9A 3REQA 4UAAA 2H5JA 4XFJA 2JIDA 1HZZA 3UHFA 4MN5A 4NEED 1A72A 4FFBA 1S67L 1LRKA 1ZR4A 2VVTA 2I29A 5ALIA 3TFQA 1L6RA 3V97A 4WXHA 2V3WA 2NUPC 3LCVB 3ENWA 3ZH9B 5HE8A 4IP0A 3MQQA 2GXSA 3M83A 3LC1O 2R8XA 2FOLA 5DYGA 3ZI4A 4QNNA 5A7GA 4B4WA 1DDIA 3DBAA 1JJBA 3QQPA 2BFEB 2PKWA 1E6LA 1UBUS 1VHWA 4EYOA 3IT9A 1B0UA 1RQ2A 1K6MA 3NVDA 3OOHA 4KUHA 4IVIA 1L7DA 3QH4A 1P1RA 4IDAA 4F3LB 1NI3A 3PHJA 1XMVA 4PS1A 1YS9A 5F68A 1KDTA 4WERA 4U39A 3MMXA 5FFMA 5IT9A 1N77A 2AS0A 3QOYA 2GFHA 1WQ3A 4CNQA 2QN1A 5BSUA 3DTTA 2ZRAA 3QYJA 2EXAA 3E2LA 4H7EA 3FZCA 2BT4A 3A3NA 1XRLA 1G68A 2INWA 1MQ8B 2AD1A 2JJ1A 3QYAA 2ZC6B 4TLLB 4A8JA 3GLGA 3HKBA 1R9NA 1EPUA 3W34A 3QPUA 4GP7A 3AKYA 4GWLA 4X44A 2ZI6A 4IIVA 4D81A 3PITA 4K9NA 1LTQA 4XRGA 3IA7A 1UWCA 3F73A 3FROA 4P0TA 1H8ZA 1I2WA 3CEPB 3ECAA 3DFIA 3THRA 4UNRA 1Z2PX 2C4WA 3LR3A 3U2AA 1L8LA 1NQ5A 1JLMA 2CDNA 4HYYA 1K57A 3KTAA 4XCQA 4TV8B 4EJSA 1MOSA 3DEHA 2A4MA 1VKRA 2O50A 4AY5A 2X2FA 1W6UA 1ADYA 3H5RA 4HS4A 3TJMA 4EUKA 2VJLA 1HYHA 2OFPA 5G4YA 1NSYA 1W79A 4ND2A 2J1LA 5FQ9A 1JE0A 3I04M 1QR2A 1PQPA 2ZQYA 4R1TA 3IX7A 4GEKA 1WY7A 1M10A 2GPWA 4GBMA 5H80A 5CHMA 2FG6C 1EG2A 4EX6A 4RHEA 3F0TA 4R01A 4OQ4A 2IODA 4X94A 5A62A 3OTOC 3VP0A 2VJPA 1T24A 1E9AA 3DL7A 3UB7A 1XGKA 3WQSB 3UPTA 1EGHA 4Y1RA 3X1JA 2RONA 1A98A 3L0PA 4KQGA 4JL8A 5JWHA 8OHMA 2X9VA 4KRYA 1UPBA 2WGIA 3B78A 7YASA 1LPPA 2QTAA 5L95A 3H99A 1G5QA 1KVLA 1R4NA 3OTQA 3FR8A 1GGHA 2QROA 3CTPA 5DF8A 1QMPA 4DR3B 3AT1A 1N5DA 1COZA 4EW7A 3QG1A 3E48A 4I4NA 2F2TA 3EBPA 3NXKA 4KGXA 3RYCA 4LZLA 3E5HA 3ZI7A 4GX2A 2PLAA 3UH0A 1YS1X 2B5OA 5HKKA 3BKWA 3K9LA 3OCJA 1HMPA 1U9IC 4D8VA 3EWAA 3ZE1B 1RHUA 1NU6A 3B6KA 2JKRM 2Q9MA 1NSFA 1MNQA 2Q4RA 4O59O 4E5NA 3QVLA 1HEUA 1ZL2A 2GAOA 1ZITA 4GPTA 3Q07A 2IYVA 4HQKA 4RAQA 4YONB 2ZAMA 5BQOA 3NEJA 3ZWWA 3ZWAA 3U1BA 4CIDA 1H6DA 2FX3A 2EXBA 4OQMA 3BZBA 4MRMB 2IDKA 4JI7C 2M6LA 1TMGE 2RJOA 2WUDA 1AD2A 4FJ0A 3EXHA 4ME6A 3HR8A 2QWXA 4G0PA 4G5XA 1R6AA 3JWHA 1FUKA 1OLUA 4LK3A 5D3MA 5H82A 3LR5A 3ECCA 3V7FA 2FPMA 1OFUA 4YRGA 2BASA 3A3EA 3O2QB 1JMYA 1O95A 3IDSA 4JYAB 2FVXA 4NY1A 5JZVA 3JRNA 2UYHA 2VAMA 3T9DA 4AJHA 4DIFA 3B3XA 4TXHA 5CX1B 3QNUA 4MVXA 4UQOA 1DFHA 2PVPA 2P2ZA 4IY1A 4L9FA 4KQKA 4YNBA 4ER7A 1FU8A 5LZ5A 2LW7A 4CLCD 3D3JA 1BLCA 2P11A 4AF8A 4YQEA 2ICAA 3RSQA 4PC3A 2N3ZA 1WPQA 5JCXA 1PD0A 2G9UA 3PUKA 5HKKD 1A5BB 2HSEA 3OQ6A 4TKUA 5EMMA 1H2ZA 2NTJA 2BFMA 2V65A 3THWB 5A91A 1Z63A 2BELA 3VFFA 4QJ4A 1E1RD 1WP9A 3A6LA 3FJYA 1JSXA 3LY7A 3W3AH 4EB0A 3ED5A 2NP7A 2KZFA 3F71A 2AG0A 2HO5A 3H9QA 1EM6A 4IVPA 2FR0A 3COZA 5ALJA 3G0HA 4OLAA 3Q2IA 4Q4JB 4NG2A 4MCJA 3C43A 2AMJA 4CG0A 1RYHA 5ALOA 5B1EA 4ZYTA 3D5EA 4LHWA 2W6MA 3GLHB 1RCFA 2QQ0A 1FILA 1DJCA 3KK0A 2POQX 4REQA 3CF6R 2XTJA 3RVMA 4EZEA 3NUGA 2JI8A 4Y2UA 3PAEA 2B4QA 3BIJA 3VYRB 4M1TA 5F2KA 4ARSA 1WUJS 3ZWVA 4S0ZA 1GPDG 5K9ZA 2YXBA 4OHWA 2VF7A 1D0SA 1LDEA 2Q7OE 4K8RB 4L2IA 3RU2A 4DMCA 3OEEA 1XLVA 1S01A 2WJAA 4J0QA 4JF6A 5C5KA 4DE3A 5JS2A 2VHEA 3TDNA 4UAGA 2VSYA 5GONA 4L85A 3V39A 1D1JA 2MOKA 5L3RA 4K88A 4QU3A 2GFIA 3ETJA 1QOZA 3DTEA 2GJ4A 1CW2B 1FRVA 1WZCA 2BI7A 3CG0A 2VTKA 2JKVA 2ZRHA 3UWSA 1R0BA 2WFLB 2C3OA 4CF3A 4AX4A 5FHQA 4GI5A 1QWOA 2GGSA 4HXFB 3CIOA 4HLQB 1U6KA 2A9FA 2C0CA 4UTZA 3SYMA 1S8OA 3PCTA 1DAKA 3UMMA 2QKYA 4LWZA 4D3FA 2EYUA 2LPMA 5AYVA 1Z15A 1B2LA 5D3ZA 1Q1EA 2XYGA 3IVGA 4YUVA 4RULA 4OCZA 1EH5A 1EFPB 4KPUB 5KDLA 3T6KA 1GTZA 3MSXA 3VNQA 3J7AC 3C14C 4HAVA 5IJZA 2PYRA 4LF5C 4PFKA 2Q2WA 1YA4A 4UVHA 3WLOA 5B7NA 1DG3A 3DO5A 5KX5A 3QEAZ 4Y17A 5JJ5A 5LFAA 1PX0A 3VOBA 1KTVA 3DYBA 1NMYA 4N03A 2X02A 2F1JA 1JEOA 2L42A 2O7SA 2DE0X 2RAFA 4FZ3A 4M0KA 1YVEI 3GJRA 3H4VA 3TD6A 4JI2B 1QGYA 3O2EA 3NPAA 4M0CA 4BKRA 1PG0A 2OCBA 3I8OA 5T8TA 4D56A 1OREA 4QXPA 1Q0QA 4DLBA 3EGDC 1TIBA 3STYA 5BN3B 1U7PA 5B2FA 4BBPA 1U2TA 3T1XA 4FDAA 2ZI3A 2OCIA 3FCOA 4U5QA 5E6RB 3G9TA 2ZYVX 4L50A 3B20A 2ZRGA 1O5TA 4S1TA 2PYDA 3WQHA 4PAGA 7ABPA 3VZPA 4UQLA 2QRPA 4D0SA 3HEAA 3JAMD 2WNSA