4PPFA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-n
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
310
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 98
structure length 310
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppfA01
3WNDA 3L0PA 1G291 1SZPA 4DB4A 3L0SA 3RAPR 3ZVRA 3U3RA 1G8YA 4M1YA 2P6RA 2YINC 4Q5IA 4TYYA 1NLZA 2QL6A 1ETUA 1NG1A 2QN6A 3BORA 5DN6A 3AUYA 4GNKA 5TV2A 4AIIA 4BLQA 4YC7A 1MO5A 1BH2A 4W5JA 4C0KA 1E0KA 1ESNA 4JKIA 1F6BA 3C15C 1W0KA 4M2LA 1SHZA 4CT5A 5K8LA 1XJQA 1KO4A 1N3BA 4BLSA 3HWSA 3GPLA 2WV9A 2EFHB 4Y0AA 2FSFA 2Q3MA 4LJAA 1E9SA 4DRZA 1JR3A 1T3HA 2ZAOA 2XEXA 1ZW6A 1R0YA 2QAGB 4B3CA 3MWLA 2HDNB 3B8HA 5HKKD 3B82A 4Q19A 4PZLA 4LRWA 3DM9B 2C8VA 1L2TA 3R20A 4D25A 1L4YA 2Q9BA 4DEXA 4EJSB 3IPXA 4TQUS 3QKRB 2GDJA 1Q44A 4P31A 1EX7A 3BAFA 2R6AA 2IXEA 2QM7A 3CH4B 2OFOA 1IJEA 4A0GA 2WWYA 5FUXA 4LYFA 2J0UA 1QHHA 4DLXA 2QORA 3I61A 1YHNA 1S1MA 3UK6A 2VQSA 2VA8A 4URYR 4C7OB 1NBMD 1G3UA 1G9XA 2CCJA 4CT4B 3UATA 1Z0JA 5JWHA 2KWIA 4B3FX 2XOKD 1AIPA 2C5LA 1KSJA 2PCJA 2ERYA 4B3XA 3DZDA 1CJUC 4LJYA 1YZLA 3KUDA 4DCVA 2H17A 1HY3A 2D7CA 4ZKEA 1GNQA 2RGDA 2G1KA 2QPTA 2ORIA 2HCJB 2O5VA 5B2ZA 4OK6A 1F2UB 2QRNA 2VO1A 3HPRA 3OEHA 3PQCA 4WIAA 1E2GA 2OUKA 1OXVA 2ZXUA 3U7EB 1VHTA 3BE4A 1FW6A 3QKTA 1IY1A 1ELOA 1Q12A 2KSQA 3O8BA 1J8YF 4GOJA 2J59A 2J9RA 4NHOA 3GEHA 5J40A 1PJRA 4JLNA 1Z5ZA 1JEEA 1NN1A 1XD2B 3EZ7A 4EPVA 5CB8A 4JBYA 1IONA 4ZDJA 3C8UA 2ZSBA 2NPFA 2PJZA 4XH9B 2GEDA 4G0NA 4LV6A 3BH6A 2FN4A 4C2UA 4OQMA 1KO5A 3RC8A 2ZRAA 5K8UA 4WZBE 2XJ4A 1CJTC 2DCUA 1GKIA 2B8TA 3K9NA 2GILA 2I1QA 3BXZA 3CPJB 4TLEA 5KNDA 1OW3B 4JL8A 5JCZA 1VKJA 3TSWA 1GL7A 3T1VA 3G0HA 1NL3A 3GLGE 3Q5EA 1I2MA 3EXAA 4UNNA 4LHXA 4BFUA 1VG1A 4DHEA 3B9QA 2LCFA 3C4JA 3SE0A 1E99A 2BBTA 1VCMA 3GJ0A 2H5EA 3DO6A 4UXIA 3OEHD 3MWYW 2GTPA 2B7CA 2XNDA 1KI6B 3HJNA 4QM6A 1XRJA 3LXRA 2E87A 1N6PA 2Y8EA 1Q20A 4HDCA 1YJ5A 1D2NA 1I4LD 3GLHA 4N3NA 2GAOA 3SYNA 2ZM5A 1US8B 1GKYA 1J99A 2OBLA 2GZAA 3SBDA 5IHPA 4AKEA 4CF7A 3P1JA 4B73A 3SYKA 3I3SR 3X1DA 4C2TA 1Z3IX 3QXSA 2HYIC 4JBXA 1BO6A 4JBWA 3TLXA 3B7GA 1FNNA 2DR3A 4C0HA 4DCUA 5JS8A 4XVQA 5LPNA 4ITRC 3QPVA 5J4HA 2F9MA 4DLYA 4IVPA 5FR1A 4MUBA 3UMFA 2MMCA 2ONJA 2IF0A 3WYAA 2ZSEA 3TK1A 5CITA 3UKDA 3KQHA 2GK7A 4U00A 1RRCA 1XEXB 3B1ZA 3SQXA 3QKRA 4TWZA 1Z2CA 3ASYA 3ADBA 1E2LA 2V55B 1TF2A 1U81A 4MKHA 1CF4A 4PPGA 2OLJA 1NY6A 1KYIA 4ZDKA 2O0JA 4CGZA 2ZRCA 2E1RA 1N6IA 2OILA 3TSOA 2CVFA 1XFAA 3QENA 3CLVA 4AURA 1ZD1A 2GXUA 2DFLA 1XNJA 3BK7A 4DSUA 4EFNA 4L16A 2QP9X 1EWRA 1E2PA 1E2HA 1W48A 1R5NA 1KSGA 1W4BA 3T1OA 3MFYA 2GETA 2WWWA 4DSOA 1C9KA 2AN9A 3T06B 3GFTA 3MAAC 1IY2A 4PZYA 2JA1A 4P32A 3AF0A 4POAA 2G3YA 2IYRA 2VBCA 2WKQA 3IEUA 3KQLA 1K8RA 2IUSA 1SKYE 2W6JA 2BEJA 1G5PA 3H1TA 4LWZA 1DO2A 1M7HA 2QMUA 4Y0VA 4PC2A 4A15A 2DY1A 4QBIA 1JAIA 3LVRE 4LK2A 5DHAA 3EARA 1UEIA 3P32A 5BN5A 2RGNA 2OCPA 2REBA 4L9WA 4F38A 1FUKA 1N0WA 3J81k 3PEWA 3FMIA 1OXXK 2J7KA 1NMZA 2PMDA 3MMPA 5L3VA 2HEIA 4QXAA 3W90A 4RKEA 1WDTA 3K0SA 4UXJA 2XZLA 2O8CA 4Q9JA 2CEAA 2IXFA 4LJ7A 5CLQA 2GJ9A 3VX3A 5IK2D 2Z83A 5FPSA 4V0OA 1S9DA 3W6OA 1YZUA 4F4JA 4QOSA 3RANA 3VU9A 3U7FB 3PV0A 3BFKA 4R7ZA 3NC1C 4UNSA 1JAHA 2AL7A 3K8YA 2ZRHA 4M53A 4DEYA 1SXJE 2AD5A 2RAPA 1XJCA 2GVDC 1KAOA 4XWOA 4C0BA 5GJVC 2V6JA 1E79D 3CW2A 2R2AA 3RRYA 3LWNA 5JSZA 5EP4A 4MA4A 1XX6A 2ZTSA 3I32A 4N1AA 4V0KA 1NVVR 1V43A 5DE3A 2W6ID 4FINA 5FH9A 4KFUA 3ZZTA 3KB2A 2ZRFA 1EFUA 2GF9A 4G1UC 2JIZD 3SEAA 1MABA 4Q1DA 5JZVA 1EFTA 1W5SA 3AKEA 3IDQA 4FCTA 2EFEB 2ORWA 3VKHA 4FMCB 3O8RA 2XX3A 3MUFA 1S8FA 3R9XA 3DKPA 5AJYA 4LPKA 3WHLA 2NTYC 5BN3A 3PUWA 2MMGA 1E2DA 2IYYA 3ZH9B 1SKYB 1ODFA 4XIGS 5A0FA 2Z4RA 4DLVA 3RVBA 1G18A 2WWHA 2OCAA 2QZ4A 4MRSA 1N5JA 2A5JA 2G77B 3PEVA 4Z8YA 1NBME 1U9IC 2HXYA 2PT7A 3HU2A 3B2EA 5AUOB 4WAUA 4A1FA 1A2KC 1Z0FA 4Q21A 3BGWA 3L82B 3TUJC 4ASUA 4CZ2A 2QPAA 2WKRA 3ZDQA 3QKUA 1KO1A 4NCHA 1KOFA 1XZPA 5CK4A 2PBRA 1UKYA 2XTZA 4Q02A 4Q4LA 3QEJA 5SZKB 2R6CA 3KX2A 4XVUA 1H8HD 5CDFA 5J4YA 1QHIA 2QE7A 4M1WA 1G5TA 5F3WB 4LHYA 1NVUQ 2A7QA 1WP9A 2IL1A 3QEOA 3W8NA 2ZYWX 1NY5A 1NLYA 1N6NA 1ZP6A 2QENA 1KK3A 2WM9B 2XOKA 4LC0A 3LD9A 4C30A 5D3MB 4DLSA 1KI7A 4A36A 4Q47A 5C2JB 3ZVMA 2XB2A 1C1YA 2WOJA 3I1FA 3WMFA 3PJRA 2O8FB 5JRZA 4Z51A 3FOZA 4QRHA 4Q9LA 1FX0A 4PZZA 2HT1A 5ANRB 1OF1A 2FSHA 4XD7A 5KDOA 1TQ6A 4LHZA 2QP4A 4CW7A 4K46A 2CE7A 1U0JA 5CYPA 3H4MA 4HUTA 3PR1A 5L3SA 1A4RA 3BJIC 2QQ0A 5JJIA 1IBRA 1CULC 4X8LA 3AVQA 4NKRA 3H86A 2FSGA 1QHSA 2VHQA 4Q9HA 3A36A 4DKXA 4OK5A 5JHGB 1G7TA 3CNNA 2X2EA 1AM4D 1XPUA 1A7JA 2F43B 2PEYA 2FFQA 4M9QA 1BOFA 3LW7A 2OXRA 1UPTA 3I72A 2DFTA 1FNMA 1JPNA 5DO9A 1BYUA 3W6NA 2JCSA 4HAUA 2JLYA 2D4HA 4LC1A 1P72A 4PHGA 4RD3A 2BBOA 1X3SA 4A4DA 4D4KA 1P3JA 2VP2A 2PLRA 1Z29A 1EFCA 1P75A 1KJWA 2WPDD 1XXHB 3RHFA 5D3MA 3QXXA 5DYGA 2WMOB 1VCOA 3EX7C 4OQFA 2IYWA 4OQXA 4TL8A 2ZRBA 4QHSA 1LB1B 1FP6A 3LDAA 5C4MA 1HH4A 2ZU0C 4MGZR 4E07A 1SVWA 2W0MA 1FUUA 5KO2A 3U44B 3LO5A 2VSOA 2IW3A 4C0SA 2VHCA 2HYDA 3TVDA 4D4LA 3CWQA 3SN6A 2ZRNA 1G6HA 1HE1C 1Z06A 2FGJA 1XMSA 4EFLA 1ZAKA 2D3WA 1DAMA 3GLIE 3D8BA 2IK8A 5K8TA 4B43A 3F0TA 2J0QA 2R9VA 1HYQA 4AYTA 2HUPA 4B6EA 1HT2E 4M9ZA 4TLDA 1G8PA 4KJZA 3IGFA 4DDWA 2P0EA 3WP1B 1T91A 2ECKA 2XGJA 2D7DA 3CM0A 2GZHA 2OZEA 1CJVC 4GBMA 4JLPA 4JSYA 4DIDA 4DUGD 5FOTA 1KY3A 4Q4HB 5H68A 1J7KA 3ICQB 4EJSA 3SJBA 4PSKA 4C9BA 3F8TA 3ND8A 4HZIA 3GD7A 4G5RA 2ZU6A 1X6VA 4Q1BA 2GKSA 4LDJA 4NYMR 2QROA 3WP0A 3NVAA 4E22A 3T15A 3LAWA 3VR6A 3WY9A 2WJIA 4LHWA 2VTKA 4AC9A 1OH7A 1Q57A 1JECA 1KDOA 4I1UA 4Q4JA 3GLHB 4PC3A 4OJKA 3THXB 4MRVA 4OL0A 5GVSA 2Q9AA 1XXHA 2BV3A 1AJEA 2WSSD 4MH0R 2PX3A 4Q7MB 4BLTA 1JNYA 4J0QA 5G40A 4KITB 2ANBA 2GA8A 5AJWA 4B2LA 4JLDA 3DDCA 2X8AA 1DG3A 2ZVPX 2BMFA 3AP2A 1F5NA 3LA6A 2QMHA 4NP6A 2XTNA 4RSGA 1R7RA 4D6PA 4M1MA 1MO3A 2JLUA 4LJ8A 3SYLA 4LBWA 2EFGA 3FKQA 3AB3A 4JLBA 2FG5A 1ZUIA 1XDBA 4NCIA 2NZJA 2V4ZA 1MT0A 2OFWA 4KBGA 4RZ3A 4MRRA 4WZAE 2GAAA 5UKDA 3W5IA 3DVLA 4GZLA 3BRWD 1Z0DA 4KI0A 1SKQA 2WWXA 1P9WA 3AVXA 1Q1QA 4FD2A 1UKVY 1SXJD 1N6OA 2KBFA 2WMNB 3TNFA 2F55A 3AP3A 1W2HA 1XTRA 1ZNYA 2F6RA 1KZ7B 2F9LA 2R44A 5L3QA 2CL7X 1SXJB 2JIZA 1OHHA 1KZGB 4BLRA 3R9IA 4B3BA 2GJ8A 3CRQA 3D31A 3OIYA 1E2IA 4P4UA 3QE0A 5DHFA 4ZIRA 2KI5A 1M74A 2YKGA 1G20E 5KSYA 4Q01A 3ADCA 4OHXA 4QHYA 5EXPA 1W5TA 2OM2A 3NDBB 1ZUNB 2QG6A 1ZM7A 2XTMA 3SS8A 2ZRKA 3KFVA 5G53C 3TQFA 2VF8A 1PLJA 2IYVA 3L0OA 4F91B 4JLAA 4A92A 1VYVA 3E1SA 3AKCA 3B6EA 4D0GA 4QNRA 1G3IA 1EK0A 1X8JA 2IEYA 2J46A 1N6LA 3QPUA 3E5HA 1FQKA 2GCOB 4ACAA 2NPIA 2BMEA 2HT6A 3GEIA 1KO7A 1NIPA 3U3MA 3KQKA 2BWJA 3OE7A 4UXHA 3SDZA 1W0KD 3QVVA 5GADl 4KU4A 3FHTA 4TZ0A 2AWNA 1H65A 5KNCA 3IHLA 3M1IA 2Q3FA 3U3JA 1QF9A 3W6PA 4ACBA 2YJTD 2ATVA 3NH9A 2GJAA 5B58C 2Z6VA 5EP3A 3NHBA 5EP1A 4EPRA 1II0A 4BZQA 1YR6A 2BMJA 3B9PA 3R8CA 1ZMXA 2JAQA 4BRUA 3KXIA 5JMTA 3KQNA 2XSZD 3TUIC 3RWMB 2B7BA 3NC0C 3ND9A 5KDDA 2FA9A 1CIPA 1U8AA 1KMQA 3FTQA 1LVGA 3RNLA 1TF5A 3C5CA 1CJKC 2G0TA 2OSBA 1TQDA 3H84A 4JJKA 2ZYUX 5EUQB 2R65A 3GFOA 5KUTA 4ERNA 3BOSA 1UDXA 2OG2A 4GOXA 3V4FA 4M4SA 2NGRA 4XTCS 1X8KA 3RRZA 4EKDA 3QQ5A 3N2EA 4JL6A 1OB5A 2QT0A 4PO9A 3W3ZB 3O47A 3QXJA 1R8QA 3GLIB 2B21A 1VG9B 2LKDA 3CPHA 4Q66C 4LY6A 4QGGA 5M04A 2OEPA 3B1WA 3KKNA 3ZIAD 1KKLA 3NH6A 1GAJA 1PUIA 2J1LA 4MYTA 2O8EA 1OXTA 2ZS7A 3MG9A 4PAQA 4RKFA 5FOSA 4ZDIA 2D2EA 3P20A 1KJZA 4W5WA 2EU8A 4NYMQ 4CEIA 1Z28A 2Q21A 2JLRA 1OPXA 3W5JA 4FXPA 4KSBA 2RHMA 3G82C 2XXAB 4PO8A 2DWQA 4TT3A 3SFZA 2FPLA 4M9SA 4KYIB 5L3SB 1R5BA 3K09C 1NSFA 4HEJA 4Z8XA 3VAAA 2WKPA 4PSVA 3GP8A 2ZJBA 3S1AA 3FDIA 1Z47A 3L43A 2EWWA 4PPQA 1RJ9A 3MRSA 3K9HA 5FUWA 4BE7B 2ZI9A 1KI6A 4TSFD 1TNDA 3U6KA 4C0JA 5FOXA 2CE2X 2IYLD 1BMFA 4Q4JB 5E4FA 3NBZC 3ZS9A 4EPXA 5EE9A 4I99A 4FI3C 1CR1A 2PMKA 2NO6A 1AS2A 4P33A 1OYWA 3UANA 3DZ8A 2N46A 3DOFA 4Q03A 1VDZA 2LWIA 3D7MA 5BYJA 1N0UA 1OYYA 4LUCA 3RDPA 2OLKA 2CJWA 2FF7A 2QBYA 1KY2A 5DISB 4DUGA 4DDVA 1EFRA 5ELXA 4UJ5A 5HTKA 2ZI3A 1UBCA 4GSYA 4HB3A 1FQJA 2ZJ2A 2KE5A 3HYTA 2AX4A 2WOOA 1OFUX 2I1VB 4PQFA 2AHOA 1P7CA 3LBIA 3CRMA 5JEEA 2OAP1 4TSFA 4US0R 4W7SA 1MOZA 4I81A 2WJVA 4YXWD 2ZUBA 3VHXA 1ZC3A 4R98A 1OV4A 3AVOA 1JB1A 1D2EA 2WSMA 3IKJA 2D74A 1XTQA 1IM2A 1N5KA 4G5OA 3SHWA 1OFHA 1CR2A 1NMXA 3TBKA 1NVXQ 4TMVA 4ZV4A 5DLQC 4DCTA 3PVSA 3KJGA 4HAZA 2JJ2D 3AF4A 3M4YA 2IHBA 4OBEA 2WHXA 1GRRA 2EWVA 3PUVA 4M1TA 3W34A 1BS1A 4BLOA 2G1JA 2A5GA 3HDTA 5K8IA 1T4GA 4KAXA 2EFCB 5JHHB 1RE0A 4W9MC 2QM8A 3CF2A 3EIHA 3I4LA 2OXCA 3HU1A 5FL3A 4E03A 4PPFA 2VYFA 1Z6GA 2PCLA 3OIWA 5C46F 1R0ZA 2CHGA 3N70A 4DJTA 2QTHA 1SQ5A 5FOUA 3NEYA 3PEUA 2FFHA 4DZZA 2JJ1A 2KB0A 1JXMA 5AWFC 1GWNA 4QM7A 2F1HA 1OH5A 2WSSA 3CR7A 2IYQA 2FOLA 1II9A 2XZOA 2F1IA 4O2RA 4KBFA 3AVWA 3K0EA 4Q1CA 4PX9A 2JJ2A 4V0MA 1KIMA 1NNEA 4V0LA 1KHTA 3ZVNA 1NMYA 2NQ2C 1R8SA 1IN5A 1LFDB 4A6XA 2BCGY 3FPAA 4BASA 1NKTA 1XXHE 1UBEA 1SULA 2RB4A 3BS4A 3NDPA 3AVTA 3QIAA 2W6JD 1CLUA 4OHVA 2ZJYA 2RCNA 5HKKA 1UEJA 3WYGA 2Z0MA 3FHOA 3QSYA 2SHKA 3HP1A 4RZ2A 5FTJA 3NBXX 4HLDA 4IOMA 2VLIA 4QJ4A 1W0JA 3P26A 3N5CA 4ZPXA 3GJ6A 4CEJA 4MUAA 2BKUA 1SVSA 1XCPA 4NDZA 4KYUA 1E2FA 1S96A 2BIFA 2WBLC 1CR4A 3FKSA 1GVNB 1M1YE 3SJAA 3UG6A 4BRWA 5EXSA 1TEVA 4BECA 1ZYUA 2W2TA 5JJKA 5FTMA 1Q1ZA 4HLCA 4NCNA 4QBGB 4WXRA 3K70B 4LCBA 4QGAA 4ESHA 2IHYA 1NBMA 3KKMA 2BBWA 2ZS9A 1JALA 1GM5A 2XSZA 1U8YA 2KBEA 3FMOB 4NL4H 5FBQB 4TMZA 1NP6A 1AN0A 4MITA 5H70A 4X8HA 4GOKA 4LHVA 4FWTA 1XEWX 2PLFA 5KTYA 5KDLA 1QHXA 2CK3A 1NN5A 4EAQA 2YOGA 3KUCA 4BFWA 3CF6R 4XSHA 4ZDWA 4BUJA 3AUXA 4MGYR 4OJQA 1TEXA 2OHFA 2VHTA 3IPYA 1LV7A 3WRYC 3EW9A 4ABYA 1WQ1R 4YDHB 1UF9A 2OBNA 2J41A 1OH8A 4A2PA 5FTKA 4DLUA 3VR2A 1NG9A 4D80A 1E69A 4TLAA 2P65A 3KJIA 5KSOA 2HJVA 2DBYA 3CRW1 4LJ9A 1RFLA 4Q4HA 5IF9A 1G7CA 2IEZA 1QVRA 4N0EA 2GXAA 3VTKA 4QBHA 1YRBA 1ZCAA 5JSZB 4IW3B 4DT1A 1LNZA 4JYCA 1K5DA 2AFIE 3CNOA 1XPOA 1A2BA 1FZQA 4RZUA 3R8FA 1OIVA 2ZUCA 2WTUA 2UZ3A 3ZGXA 3A8TA 2IYUA 2ODWA 1DE0A 3VHLB 121PA 4BFZA 4H9GA 5HPYB 3AKYA 3NXSA 5BWMA 1LY1A 1QG2A 4JT4A 2IYSA 3A1VA 2BMDA 1YZGA 4AK9A 3LLUA 1BYIA 4S2EA 4XVRA 4MYCA 4JVMA 1DARA 1ZIPA 1ZVQA 2IS6A 5C4GB 1OLOA 1XJ0A 1LF5A 1DPFA 2IYXA 5AUNB 4ZO4A 1GFIA 1KK2A 4FW9A 4EPWA 1Z0IA 2PZFA 2QNRA 2MSCB 5D3QA 3U4QB 4X8OA 3T1TA 1JBKA 2XAUA 4B35A 4CIDA 4G3XA 4IDOA 4D81A 3VKGA 2DWPA 5E95A 2GCNA 3CRRA 3K0CA 4CEHA 1P73A 1YZNA 3LXXA 3WNBA 4Q7JB 1D9ZA 4PO1A 5LB4A 3DPUA 4IEEA 4PQYA 4RJLA 4TYNA 4OHWA 2QMOA 5EUMA 4A0FA 2OO7A 3RS2A 1UJ2A 4JLJA 1WBDA 3JZMA 1T8UA 5BQ5A 3WMEA 3B1VA 5HE8A 4MRPA 3REGA 4ARZA 1RW4A 1ZNZA 3BH7A 2REXB 3OZXA 4PANA 4GDFA 3X1YA 3AVUA 2FEMA 2MSDB 2F7SA 5TDHA 5CIWA 2BHRA 1ZINA 3ADKA 3TVTA 3D6TB 3MWJA 3KTAA 2DYKA 3EG5A 3GJ8A 1XD8A 3CH5A 5J4LA 1ZUHA 3ZZUA 2Q9CA 3I73A 4HLQB 2D06A 2A78A 1YE8A 1IXRC 2CXXA 4NTZA 1CXZA 3AF3A 1QHYA 2NO7A 1RPZA 4TLBA 1IN8A 2EVWX 1S3SA 5FPHA 2FV8A 1F48A 3LQRA 3T5GA 2GCOA 1KDPA 3EZFA 3W3AA 3AM1A 4EDHA 3QXCA 2FFAA 1KDTA 5CM8B 4R9UC 2PX0A 3TW4A 1H8EA 2CCKA 2ZETA 3OFNA 3Q3JB 1RIFA 1WB9A 2AK2A 2MSEB 1Z6YA 4AG6A 2C04A 2EQBA 2OFXA 4XSGA 5CB6A 1P2VA 1SHKA 2WAXA 1ZIOA 3LY5A 2V1UA 4QHTA 5FPTA 5KSPA 5TXGA 4HAXA 1FOEB 1A5TA 3RS3A 4A2WA 1DAFA 1CRPA 4CEHB 4P4SA 1E2NA 1ZJ6A 4IOJA 3LBHA 1SXJA 1Z07A 4TL6A 2VEDA 1ESMA 2C9OA 4L4UA 2NIPA 3L2OB 4JKYA 4C0AC 1E9FA 1QG4A 5AUQA 4NYJQ 3EASA 4A8JB 2ZRLA 1T0HB 4B33A 4AYWA 2OCYC 5EP2A 821PA 2ZRPA 1XMVA 2ZS8A 3I8XA 3NG1A 4ESVA 4AY2A 1JR3D 4V02A 3MD0A 2EYUA 3AVPA 2GXQA 4Q9KA 3CNLA 3GFPA 2ONKA 3DL0A 1G3MA 4HAVA 1VIAA 4LX0A 1WXQA 4QNMA 2G88A 4H1UA 4P3YA 1G4UR 2V54A 5C18A 4HB0A 4RFVA 3VQTA 1ZM9A 2O0HA 1UBFA 3MJRA 3SZRA 3PXGA 2JEOA 3QF4B 3QKSB 1R2QA 3NKVA 3OE7D 2WJJA 3WYFA 3HYRA 3L8YA 4Q4AB 2ZJZA 2ZQ5A 4I1SA 1E4YA 5H1YA 4PR0A 4V03A 4OHZA 2FEOA 1DAHA 3RSLA 3KKQA 4DBLC 4M1SA 3K0CC 2O8BB 2F43A 2C78A 5G3YA 3VMFA 1P61B 3JVUA 2VHJA 1OSNA 4IOKA 3RS4A 2C2HA 1G6OA 4B3DA 2Q0HA 3IQXA 5HE9A 1IHUA 4Q9IA 5SZIA 2ZI6A 1RKBA 1J70A 5EJEA 5FFMA 4BWYA 1A1VA 1ZM4A 1MO4A 1P9NA 2NMVA 3A1WA 1U8ZA 3FFAA 2UKDA 1AGRA 1AK2A 2ZSFA 3R7WA 3A6PC 4RFSA 3AVVA 2XJ9A 3THWA 1SVMA 1W0JD 2ZYTX 2FPKA 3OHMA 4GP6A 4ASUD 2V7QD 1AZSC 1KI4A 4B74A 4DIEA 1OKKD 1B0UA 4PC6A 4IOLA 2W58A 3Q5DA 421PA 3JZAA 2R6GA 3QG5A 1GRNA 2A5YB 4GI7A 3THWB 2NO1A 4TZ6A 2CHVA 4UNPA 4AD8A 1EESA 2HXSA 2ZROA 1HEIA 5HZHA 4TTQA 4DCSA 2O8FA 2H18A 4EQ6B 5DI9A 3A58B 5HCNA 5IT5A 2VIIA 1NJFA 3FE2A 1KSFX 4JSTA 5J47A 5FI1B 4FMCF 4AI6A 1LF0A 1F60A 2VP0A 3MGCA 3T34A 2A5FA 2ZEJA 2JLVA 1JR3E 4FMDB 2NOAA 5CDFE 3FHCB 2CNWD 3GJ3A 2AK3A 4AYXA 3IHWA 3MLEA 4AG5A 4ZCMA 2BBSA 4KLNA 3KKPA 3E2IA 3OAAD 4CYMA 3PENA 1IJFA 1NVVQ 5FOWA 2CHQA 3TMKA 4MQBA 1O3YA 2XNSA 1RC8A 1VECA 2IA5A 3BD9A 3IQWA 2BM0A 3CX7A 1OFTA 2PZGA 3FB4A 5DYIA 3RS7A 2FPMA 1XTKA 4KLZA 4HB4A 3T5DA 3S1AB 1P2UA 3ZD7A 3HR7A 2K5UA 3QF7A 5LDDC 2ZSAA 3KFXA 1E2QA 2CMKA 1ZU4A 4D2IA 3VKWA 3KZ1E 3TKLA 5SZHB 2R6FA 1GDDA 3RRNA 1ZNWA 2Q6TA 4B3GA 2JLQA 1N6RA 4HB2A 2GJKA 5JEDA 1QDEA 1G7RA 3HU3A 4B76A 2QAGA 4LYAA 3DKVA 1XBTA 3U7GA 1GNPA 2CNWA 3FGNA 1S0UA 1W47A 1U0HC 1N5IA 1TU4A 2C03A 1UBGA 4PHFA 1N6KA 2YWEA 4DLZA 4HAWA 2AR7A 1DOAA 2FNAA 1DAEA 4LSGA 1VG0B 1FX0B 1T9HA 3IIJA 3PUYA 621PA 4DLTA 5JECA 5KU1A 2R62A 4D0NA 3ZZ0A 1QHGA 3AEZA 1M2OB 2VHUA 1IQPA 4MYHA 1R4AA 5DSZA 4TTRA 4EFMA 2FJUA 1PZNA 2W83A 2KJQA 4YLGA 2GXSA 2V1XA 5F9HA 1L4UA 1JQJC 1U90A 1JJVA 2VF7A 3X1WA 1CEEA 4C7OA 3VX4A 2H16A 1Z6XA 2V6IA 3CRVA 3NIBA 3ZD6A 4D26A 2E9SA 1QVAA 4TT3D 4LV8B 1W4AA 3QJYA 4JVSB 2FE4A 4M21A 2CDNA 3TAUA 5FOVA 3WNCA 2QSZA 1C4OA 2C9CA 1G64A 4K81B 1MO6A 3U2QA 2ZSDA 1W49A 1D9XA 3EZ6A 4PQRA 5P21A 2X19A 3NWJA 3VNVA 1IOZA 1G5RA 4PC7A 2H92A 3SFVA 3CONA 4A6PA 1RRGA 1Z6TA 5A4JA 1Q1EA 4KFTA 5FPKA 1KMHA 3EZ9A 3GJ4A 3MSXA 3OF5A 1OXSC 2V9PA 2FMXA 5L8VA 4X8MA 2FWRA 1SVLA 2REOA 2ZJOA 4LGMA 3IBGA 1U2RA 4XOIA 5FL7D 4DSNA 5HZKA 1E9CA 4P4TA 3B85A 2G9NA 1JJ7A 2EFDB 2QTVB 4CRWB 4I1OA 3I92A 1AGPA 3QY0A 4FCWA 1JI0A 1FMJA 2D62A 1M6NA 4PC1A 4RD0A 5DIFA 1UDWA 1X8LA 3V9PA 2ODEA 1OIXA 4CEJB 4QGFA 1J2JA 3AF2A 5EE3A 1KNXA 5L3QB 1KO8A 2AXNA 3NTUA 4OKSA 4D0LB 4TN1A 3VR1A 3K0AB 4ZIRB 3P4XA 1LW7A 2C9YA 1N2CE 3A1SA 1NN3A 4HSEA 4DWJA 4US2R 4UQOA 1MKYA 2J7PD 2RKOA 3QOFA 5E3HA 3QG1A 4PAMA 2W2VA 2JLXA 1AS0A 3EA5A 4TYQA 5TMPA 5IDVA 4DVGA 5CJ2A 4V0ME 2OAQ1 2ANCA 3MWKA 3IIMA 4IJMA 4DDTA 5JLJA 1O87A 1L7VC 1D8TA 1QRAA 3LBNA 4U02A 2QP3A 4JLKA 4URZR 4IHQA 4Q18A 3VR5A 3KKOA 2QAGC 4GL2A 3QNUA 5AJZA 2O8EB 1XF9A 1G7SA 2BC9A 1FFHA 1TUEA 2F1JA 4ON9A 3SI7A 1YZTA 3FVQA 3LW8A 2CVHA 3GLIA 1RYHA 3F3YA 1AZTA 1DTSA 1YR7A 5C1BA 1F2TB 1U98A 4PTLA 3U60B 3NEJA 2CCGA 4UKDA 1W36D 2WIAA 3I5YA 2ZR9A 4Q4AA 1VMAA 1Q0UA 4RCYA 5HCIA 2XXAA 3KJHA 1T0JB 4XWAA 1OKKA 2BOVA 3T12A 3ZQJA 4AKIA 4A0RA 1XTJA 2BJVA 1OHHD 1W1WA 2PEZA 1IAQA 1E6CA 1SGWA 2QE7D 4WZ6A 4WOPA 1SXJC 1TF7A 2L0XA 2ZVQX 1MRNA 2JASA 4U5XA 4BLPA 5CK5A 5EXXA 3I5XA 2GZDA 5IK2A 1X1RA 4BFXA 3Q8XB 1TADA 2A2ZA 2DPXA 2I4IA 1Z0AA 3LX8A 2CL6X 1X1SA 1NI3A 3Q7QA 4JLOA 2ZUDA 1XD9A 5L3RA 3BH0A 2H8KA 3ZJYA 3A4MA 4E5UA 4IDPA 3C7KA 1MR3F 2HF9A 1AKEA 5DH9A 1E98A 2FGKA 4FWIB 4LBVA 2QSYA 2Q3HA 2YOHA 3EIEA 1ZD8A 2B92A 1LTQA 5EE5B 4HUQA 5G3ZA 2BKEA 3ONWA 1HE8B 1GL9B 3A4LA 4G5SA 1Z8FA 1T5IA 2HCBA 3BFXA 1EXMA 2P2LA 2FDCA 4LZZA 3WMGA 2ZE6A 3OAAA 2P5TB 1N25A 1G16A 4LV5B 4YDSA 1LS1A 2IS4A 5HR5A 1W4CA 5TY0A 1Y63A 4F93B 2N42A 2JATA 3PITA 4OYHA 5E7JA 5F2EA 4Q00A 1T3LA 4TMTA 2RGNC 2RGGA 2GVZC 5GJBA 2QEQA 3BWDD 2J87A 1GILA 1RJ9B 4KXFB 4URWR 1TAGA 1HV8A 4FMDF 2O8BA 2WJHA 4KCGA 1V5WA 1IY0A 3UWOA 4C0QC 3LVQE 2WICA 2VP6A 3WXMA 5KPJA 4HZUB 4F7WA 3PG5A 2DB3A 1W44A 2RGXA 2QAJA 5JI3E 1D5CA 1ZNXA 4NYIR 1RRFA 2DFKB 2N1BA 4BFSA 5F9FA 4DSTA 2ATXA 3ASZA 4L9SA 1P62B 4B44A 1W4RA 2HF8A 1M7BA 1BKDR 1P4SA 4O25A 3V4RA 2FX3A 1D6JA 1WBBA 3ZIAA 2R6DA 4HLUC 4W5HA 1G41A 2GCPA 4PFSA 1T3SA 3AGPA 3EPLA 4G5GA 1B23P 3TRFA 3UWKA 4JLMA 3SJZA 1R10A 1KDRA 2IYTA 3EWAA 2QGNA 4B6FA 4ILEA 2ZRJA 1EX6A 2CLSA 3SBEA 1TL7C 2QRZA 5GVRA 4B71A 2I3BA 1UKEA 3MJHA 3U61B 3UXMA 1KI2A 4MDEA 3BB3A 1E9EA 2GEUA 1P5ZB 4NU0A 1EWQA 1II8B 2GEVA 3B1XA 3QF4A 2BVNA 3OIUA 2P5SA 4JZKA 1ZRHA 2J5XA 3RRMA 4F4IA 4CEIB 1M7GA 1LS6A 2YV5A 2VP9A 4E09A 1KK0A 2QI9C 4HDQB 3GLGA 2FZ4A 5DNYB 1QHHB 5KHOC 4RD6A 4HDOB 4EPTA 1KGDA 2NO0A 1Z83A 3NBYC 4BEJA 4KVGA 3O8CA 4LI0A 1Q1BA 5JRJA 1YKSA 4KVAA 1NKSA 1UKZA 4R71A 4IRUB 3EPJA 2OT3B 3LLMA 3KXKA 3Q9LA 4RD1A 1Q3HA 5CIQA 2RGAA 3R7WB 2YZ2A 3T1QA 4FN5A 4DC9A 4AKHA 1XPRA 1XD2A 2O0KA 4BFTA 4D82A 5KYKA 4KV9A 3K70C 2QU8A 1G8GA 1W36C 4BGDA 2QBYB 3C14C 4QC2A 1AS3A 1GKUB 4DLRA 6Q21A 1N6HA 3PUXA 4I1VA 2F3RA 3BIFA 1YQTA 2WWIA 1GUAA 4TMKA 4OQNA 2ZRDA 4AWXA 4KSCA 3K9LA 2JJ1D 2ASEA 2NG1A 3CB4A 3P27A 2P6UA 2J0SA 4MRNA 1RZ3A 2QPOA 3HR8A 1N0VC 3THOA 5JWOA 1PLKA 2RGBA 2ZITA 4Q1EA 3VFDA 2EW1A 4OK3A 3EIQA 2XITA 1E0SA 3CPEA 2J0VA 4K8OA 4D4JA 1SVKA 4B32A 3AKDA 3OESA 2G6BA 4I4LA 5AJXA 4A8JC 2OE2A 4BFYA 4BQSA 2C77A 4YQFA 3VU9B 5FUYA 2QA5A 1XTIA 4II7A 5JJLA 3A4NA 1XU4A 1F3OA 1CS4C 1CJMA 3SOPA 2DWOA 3Q72A 4YMUA 1IN6A 3OFND 3KJEA 5KPDA 4IVRA 1XMIA 4R2HA 1E1RD 2B8WA 1JEDA 3CX6A 1TMKA 1G8HA 3C5HA 1DADA 4LYJA 1WF3A 1Z63A 3QI2A 2V7QA 3IIKA 1XZQA 4TL9A 3TUZC 1WE2A 2ZI4A 4NBSA 3TJZA 3A1TA 1Y3AA 3W9YA 5GJCA 2ZR0A 2O8DA 3WRXC 3K0FA 3EPHA 1NJGA 2W2XA 4QKQA 2OBMA 3U5ZB 1TU3A 2HV8A 1DG1G 3DHWC 3Q85A 1DO0A 3QBTA 5B57C 1GSIA 4IDHA 1E2KA 2ZJ8A 1G21E 3B78A 5FTLA 2JLWA 1G17A 4QFMA 3KL4A 3LX5A 4KODA 1HT1E 2C98A 1OT3A 4NCJA 1U0LA 1FTSA 4TTPA 4AKGA 3QVUA 4M8NE 2JJ8A 2QMEA 3PUZA 1E79A 4P0TA 4EJSC 2FU5C 2LKCA 3GLHE 4L15A 4Q1FA 5BXQC 3RSOA 1YZQA 2R8RA 4LOAA 2CK3D 4IDNA 2CLDX 5FPYA 3X1ZA 3LNCA 4JMPA 5LD2C 3GLFB 2C95A 2W6IA 4L8GA 1M34E 2IYZA 1E1QD 1ZM3A 2JLZA 1TTTA 2XB4A 5FUVA 4JVLA 2GWHA 1E9BA 3CWZA 4DT1B 1H8HA 1Z2AA 4WA7A 1XEFA 2GJSA 1P60A 2ZRGA 4O2LA 4B2PA 2A5DA 1G4AE 1R0XA 4JJZA 5FTNA 3TE6A 3UMRA 4PPNA 1JPJA 3AH8A 1P9RA 1MABB 4LJ6A 2GHIA 2ZRMA 2IUUA 3CZQA 2CJWB 2VP4A 1G19A 1S9HA 2AKAB 4EIWA 3DEFA 1GIAA 4TMXA 5H8WA 3F5FA 5LB2A 1MV5A 3O8DA 1S1CA 1JR6A 2C99A 4QG7A 3CKLA 1G3QA 3U44A 4RD2A 3IUYA 3LH5A 1NN0A 4BEBA 3IEVA 3RABA 4XD7D 4CDGA 4DDUA 2O52A 5E7MA 1E0AA 1Q21A 5J4VA 4ZCLA 2AFHE 2ZJ5A 2J0UB 4URUR 5EE1A 1XWIA 3FWYA 3RC3A 1TQ2A 5F98A 1PV4A 1ANKA 5J4KA 2ZI7A 4EPYA 2IXGA 3RS0A 1RVDA 2GBLC 1MH1A 3CR8A 4JLVA 4GFDA 3PCRB 3GLFA 4IFEA 2IC5A 2ZE5A 4Q7LA 4C4PA 1I4DD 5JWRA 1E9DA 1M8PA 2B6HA 3IILA 4OI4A 4TYPA 1AA3A 2Z43A 2D2FA 3ZS8A 1XCGB 2ODNA 3BC1A 3G5UA 2JDIA 1FP7A 2UZIR 5EE0A 5EQTA 1XTSA 1N5LA 1U94A 2WJGA 5FR2A 4BPBA 1HQCA 2NO9A 4XTRA 3GJXC 3W8RA 2GESA 2ZE8A 4DB2A 4JIMA 3TW8B 2AWOA 4OI2A 4EUNA 2J3EA 2ZR7A 4H1VA 1COWA 4MKIA 2ZPTX 4KO8A 2P67A 5E7IA 1KSHA 3B13B 1GP2A 4GRAA 2RGEA 2RGCA 3K1JA 5SZJA 1AQYA 5BN4A 3PEYA 1CKEA 4LPSA 3K0FB 2ZJAA 4NPHA 1XB2A 1E96A 2BEKA 3AV0B 2RHDA 3TH5A 4NYJR 5FL7A 3OEED 1XMJA 4NCKA 4KFRA 4QJ3A 1NRJB 3VR4A 3U4QA 1ZD9A 1WCV1 3CX8A 2EYQA 2H57A 3B5JA 3U3OA 5BW8A 1KMHB 3MCAA 3UG7A 3LV8A 1XCMA 3X1XA 1GTVA 2WPDA 3GMTA 4B47A 1E2EA 2P3SA 5JFGA 3ECCA 4PAOA 4JL5A 4FIDA 4NH0A 1G1MA 1CRQA 3A1UA 1YRAA 2FZLA 4G5QA 1COWD 1EGAA 1GITA 1VTKA 4IKEA 4WVFA 2HJGA 1Z22A 4LJ4A 2YC4C 2TMKA 1OJLA 3OIVA 4QJ5A 2P6NA 3SJCA 4UJ3A 4M1KA 4TLCA 1QZXA 5B64A 1XP8A 4TMWA 2IX3A 2F3TA 1DS6A 3THXA 2QQEA 3CO5A 2FFBA 4QL3A 2V3CC 3UIEA 1W7AA 1E9AA 1GOTA 2NZ8A 4GP7A 2J45A 1D2MA 1W2GA 2AD1A 2VRWA 4B2IA 1KAGA 4M22A 1GNRA 2F1RA 5EZ6B 4HLUA 3CIOA 4Z1MD 1EFHA 4C0LA 2WVJA 2YC2C 4A82A 3QPWA 3SQWA 1US8A 2G0NA 4NYIQ 4BZPA 521PA 1OIWA 5AK0A 1P2SA 1PUJA 1KI1A 3VR3A 3R9WA 4URVR 1KJYA 1VHLA 5AUPB 3HPQA 2PZEA 2YWFA 1EFRD 1PLLA 2X77A 5GJWC 1EG7A 1K6MA 2VPPA 2JGNA 1OE0A 1YZKA 1ZBDA 2WAYA 3K09A 2ZREA 2GBLA 3A37A 4IDQA 4WBSA 3T35A 1CBUA 1J90A 3CUEF 3FYHA 5DI3A 4WW0A 4DXAA 3AP1A 1UFQA 2WJYA 4UNRA 4KFSA 4RCZA 1E0JA 1YU9A 2WZQA 2IWRA 1QBKC 3VNUA 4HAYA 3IO5A 1NIJA 4FMBB 4GZMA 4TQ9A 1Z0KA 3FKSD 2ZRIA 3PFIA 2DHRA 5LD2B 4RFSB 1I2DA 2FSIA 5BYKA 4HZUA 1GZSA 2QT1A 4GPTA 3TSZA 3QBVA 4RY2A 4LBYA 1G3RA 3U7HB 1SVOA 1FTNA 1VPLA 5B30A 1E2JA 5JI2E 1HURA 2IBMA 2XZPA 5KNBA 3U6BA 4QBFA 3ADDA 2DFNA 1AA9A 4RZXA 1NF3A 2IT1A 3EA0A 2CBZA 4XJXA 3EAQA 5CM9C 4YONB 2ORVA 3QKSA 2UVQA 1E1RA 1RYFA 1YR9A 1IXSB 2BCJQ 3B1YA 3BB1A 4OQLA 4F4CA 3TGPA 4U7DA 1GL6A 3EC2A 4L5BA 2J7PA 5DN6D 4IEIA 1UADA 3P4YA 5LBIA 4D4MA 2O8DB 1FL9A 4N0DA 1E32A 1R0WA 2ZANA 3WBJA 3FMPB 1DAKA 2GRJA 3UMSA 3L0IB 1E3MA 2H7VA 4IXNA 4HYYA 5CLLA 1WRBA 4Q1AA 1CU1A 3GEEA 5TVKA 2PL3A 1KI9A 3UPUA 1VCIA 2WWGA 4NMMA 3PIRA 1P6XA 3RS5A 1DAIA 5FBVB 4MKGA 1UM8A 3M0EA 4OHYA 5G41A 2RH5A 1OXUA 1W46A 3IO3A 4QGHA 4C3ZA 1Q22A 1WMSA 4IFBA 3LRPA 1VG8A 5JBQA 2ERXA 5JS7A 4MYUA 3K70D 3NHAA 3H2YA 4A8JA 4B48A 1E4VA 1KI3A 1DELA 3K0AA 3SNHA 2GK6A 4ZI3A 1U99A 3GLFE 4PXAA 4RVCA 2ZE7A 1VYTA 4JYBA 3H0KA 3REFA 1RRPA 3GLGB 5A5GA 5J5CA 2X1VA 3BBPA 2VSFA 3KTAB 1DBSA 5CJPA 4FCVA 4MGIR 3TIFA 4PHHA 4ARZB 4WXPA 4ZI2A 3JVVA 1E1QA 3N2IA 1AKYA 1Z08A 3SR0A 1K5GA 2C96A 1NSTA 2VH5R 3GJ7A 1JXOA 3EWSA 1QHNA 2BJWA 3TQCA 2OV2A 2YYZA 3IBYA 4YMWA 3ZYCA 3AGQA 4TL7A 721PA 1ZM2A 1CR0A 2GF0A 2W00A 2ZAMA 1BIFA 3WHKA 2BM1A 2FH5B 5IRCD 2W0SA 3CF0A 3TR5A 1UAAA 4EQ6A 4YMTA 4KHZA 2X2FA 1KTVA 2WWFA 2IWHA 2YWGA 4PHTA 2PT5A 1FPMA 5FBRB 2JDID 2HLDA 3C41J 3NBFA 4LYHA 1J8MF 3M6AA 4M1OA 2Z4SA 3ETLA 5DGXA 1PVOA 3SHFA 1S3GA 3T61A 1TUIA 5TB5A 2YWHA 1ZCBA 1S2MA 1TQ4A 3KQUA 1T6NA 1Q3TA 1JQLB 1ZC4A 3AQ4A 3QXHA 2IS1A 1TPZA 3RYTC 2A30A 2JLSA 2BDTA 4JT2A 1II8A 5FBLB 3ZLJA 1L8QA 2QTFA 2ZI5A 3KDSE 4NE2A 5KOYA 3V00A 5AJVB 1OFIA 4A9AA 2QY9A 1BMFD 2V8OA 4V0NA 3ZVLA 1A82A 1DAGA 5JCPA 1KK1A 3LFUA 1KNQA 4B75A 1T5LA 1P2TA 2A3RA 1R5OA 5AR1A 5EZ5A 4Q7KA 4GMXA 4M0LA 4M9XA 1E94E 3LQQA 2HLDD 4G01B 1G8FA 2WIBA 1GG2A 4MDFA 3FFBA 2OESA 2XNDD 3GJ5A 2PH1A 4ZCIA 3KB1A 2OCBA 3BB4A 1DVRA 4LJ5A 1H8ED 4MGKR 1TX4B 4DLWA 4CVNA 2CL0X 1T8TA 4YMSA 4NONA 2H1LA 2QGZA 2PJRA 1S4QA 4IVQA 2ZIAA 2O8CB 3THYB 3K53A 3Q7PA 2CLCX 4A2QA 1CTQA 2YHSA 2AXPA 1HTWA 5FI0B 5DI3B 4YXWA 4MKFA 4R2IA 4BZXA 1CP2A 2A9KA 4F92B 3OEEA 3AVYA 2AKYA 4TYWA 2YVUA 4S35A 2IF2A 3AF1A 1FMLA 1IXZA 3BERA 3I62A 4A0HA 3CBQA 1ZU5A 1HQYE 1MRSA 4O0MA 5EXTA 3DOEA 3FMFA 1SVIA 3CZPA 4HI0E 4B34A 1YR8A 4Z54A 3C16C 3SC3A 2YNMA 3RLFA 4P4SB 1IN7A 4UNQA 4OI0A 1I4TD 2VSXA 4LBZA 3QUSA 1HA3A 3ZQ6A 1NVWQ 4JVNA 3RWOA 4YMVA 1VCNA 2IUTA 1OH6A 3GCGA 4IXMA 3WBKA 1XEWY 8OHMA 221PA 4OI1A 3ICEA 2ZYVX 1VIYA 1F2UA 5CYOA 2RMKA 3B60A 1Z6AA 3GQBA 3L8ZA 5FBWB 4US1R 1OB2A 4TQAA 2G83A 1DEKA 3DM5A 5KSZA 2Z5FA 3KXLA 3DMDA 1AQUA 3I8SA 3TAHA 3D3QA 2QUZA 3EPKA 4JS0A 1YVDA 1GRQA 4O3MA 2GNOA 1WA5A 2YOFA 4ZKDA 1F2TA 4HUQB 1W36B 1IN4A 1XEXA 4Z1MA 1HUQA 4PSAA 4NZYA 3EZ2A 2VL7A 4DCNA 3K9GA 3X2SA 3DMNA 5TARA 2VP5A 4RD4A 1E9RA 1KI8A 3SU8A 4BFVA 3U3KA 1KKMA 1E2MA 1ONBA 2ODBA 3EC1A 3BFVA 4Q48A 1U9IA 4URXR 3THYA 4XWKA 1X86B 4GMDA 2IS2A 3TR0A 4HATA 1VYUA 1NLFA 1R6BX 3E70C 4GT1A
chains in the Genus database with same CATH superfamily
1XDZA 1G291 2XLBA 3OQIB 5BVHB 1SZPA 1E5TA 4N5LA 4DB4A 4KQEA 1DQRA 1VHQA 3ZVRA 2NSYA 1YI8A 4XR9A 2OYCA 3U3RA 4EITA 3CG4A 4DXDA 4ZYTA 2P6RA 2LRHA 4Q5IA 2ICAA 2I78A 3L1HA 1ETUA 5LA6B 2V5UA 3HE3A 2FEKA 4L72A 5DN6A 4C5AA 3CKYA 1XROA 1XRLA 3AUYA 1I3CA 5TV2A 1EFAA 2FZEA 2P8JA 1BH2A 2XB8A 4C0KA 1V5FA 4EI7A 1ESNA 2P9CA 4IG4A 3ZBPA 1GPMA 3HABA 4I9HA 3C15C 3FHJA 3HRKA 4M2LA 4NU8X 4RQUA 5EJAA 1XJQA 1KO4A 1N3BA 2OHJA 1UXJA 1UJMA 3AIKA 2Z2JA 1VJGA 4N82A 4BLSA 3MQ4A 3H5VA 3NM4A 2WV9A 3UFXB 4G0XA 3HG7A 1WZCA 1RWMA 1T9GR 2IZZA 2J9FB 3KLMX 4HXFB 4L07A 4LJAA 1WSBA 4JDPA 5AW5A 2QI9F 3B6JA 3FRHA 2A58A 3WYCA 2DY0A 5LVAA 5JOQA 2HV9A 4ZU1X 1H9AA 3V1TC 4L9AA 2IY7A 4HSGA 5AM4A 5GAJA 2IDMA 1K97A 4GQIA 1DIHA 5HKKD 4NZZA 4YRZA 1BDMA 1M10A 3PX2A 1X2EA 4Q19A 4LRWA 1VSBA 3JASA 1D07A 2C8VA 1V5EA 2UUAB 2I91A 1L2TA 3TTUA 3UWMA 3IQDB 3KOOA 5IEJA 1RPJA 4O1HA 3AR3A 5H5JA 1ODCA 2C4VA 3HYSA 3NRJA 3BK1A 2YUTA 4TQUS 1CS0A 3PKZA 5C35A 3VPAA 2FVYA 5IBPA 5AVXA 3DF9A 1EUYA 4XQEA 4QEZA 4ALNA 2AN1A 2Y1KA 2HC9A 2R6AA 3N1UA 3CHYA 3ZHSA 3JWJA 1XZNA 3CH4B 3R0QA 4FU0A 1JAZA 2ST1A 4ZVLA 1YDHA 1RTTA 1QHHA 4JB2A 2C8KA 3HSKA 4Y2UA 1G8MA 1JG2A 3D0QA 4CT4B 1ONOA 2CHEA 5JWHA 1ARZA 3JWPA 4DBLE 1F20A 2XOKD 2C5LA 1Y6JA 3JQAA 5FIUA 2PVCA 4CM5A 4QU8A 1J2YA 4ABTA 1N8NA 1EHIA 2PXAA 3G9TA 1SKBA 1VL5A 2ZIEA 2FP4B 3M6WA 3TPFA 1RJWA 3DGFC 4PZEA 5K45A 3KUDA 1DIRA 1H6BA 4YJGA 1HY3A 3BWXA 4OHFA 2X41A 3OOWA 3E5NA 2ORIA 5U4QA 5B2ZA 2A57A 3TEJA 4OK6A 1AXEA 2P30A 3HPRA 3FWZA 4NNOA 4WIAA 3ZHUA 1UP4A 2FOIA 3I53A 1MAHA 1SCNE 1JKJA 4M54A 5LC1A 1GCGA 3ZK7A 3FLBA 3RTGA 3BE4A 3OICA 4KRGA 1ELOA 1Q12A 3O8BA 1AKMA 1QNFA 1TW2A 1Y4AE 2QYHA 3JWEA 3AHEA 3ZW9A 1HT0A 4NHOA 3WV4A 4JLNA 1E8NA 1JXAA 1JEEA 4QUGA 4EPVA 3FI9A 2I6XA 4Q3BA 1E1YA 3QTTA 4JBYA 1XLTA 2P90A 2V7BA 4H6PA 4S24A 4GM1A 5D6NA 1OYVA 1UP7A 4C7VA 4G4SP 3MLAA 5DRTA 2PJZA 1UMKA 4G0NA 1F6WA 1SD5A 5BV0A 4C2UA 4OQMA 3Q3IA 3HCBA 1JHOA 1RKQA 2WDZA 4CM9A 4BWFB 2FWAA 1Q16A 1GTZA 2D2IA 3WGGA 4JL8A 4JR0A 3O95A 5JCZA 1VKJA 2ISSD 1GL7A 1VE6A 4KQIA 3T1VA 2H2IA 3GLGE 3K9WA 1K08A 4GWLA 4TKVA 3Q5EA 2XMQA 3EXAA 5IMBA 3VOSA 5IDYA 5DRYA 4I1IA 3V1NA 1VRCA 1ZGGA 3C4JA 3KQSA 4I6EA 4J3FA 2H5EA 4UXIA 5HX7A 3ILXA 4F72A 2GTPA 2GZRA 1NVTA 5EYPA 4CTKA 2O48X 4I9NA 1TM1E 2YYYA 1KZ6A 2VDQB 2FY8A 3R5FA 5EIHA 5HK9A 5B3KA 2GCGA 3WYDA 1IUPA 4ZT6A 4PSDA 4M89A 3GLHA 1BGWA 1I4LD 1ZGAA 2R7MA 2PTHA 1PQYA 3LC0A 3TD6A 1RM3A 3KL2A 2I80A 1SG6A 2WU8A 2C1EA 1T8YA 1S7GA 1OREA 1XZGA 3KZOA 5H02A 3SYNA 4WEQA 3ISJA 4TM8A 1RI4A 4X6LA 2PR7A 5T3UA 3SBDA 4AJHA 4D0RA 1G21B 3UPTA 3WQRA 3P1JA 1ZN2A 2HM7A 3PDIB 1RQLA 4OHKA 4G4IA 1Z3IX 2HYIC 1EBFA 3D6FA 3B7GA 4JBWA 2C5BA 5IYZF 1S3FA 2O06A 1O95D 2EKDA 3KLBA 2HIGA 4ATNA 2AG8A 4F6LA 5LPNA 5DBFA 2WPNA 1ZL0A 2IU0A 3FPKA 4F1JA 4DANA 1A96A 1BDBA 5FR1A 4XCVA 3OI7A 1DO8A 5SY9A 4PYMA 5JAHA 2R5WA 3ONDA 5LP6A 5CLIA 4TXHA 3WYAA 1TECE 4MICA 3GZJA 1N4AA 4CLRA 2BEWA 2GK7A 3NHMA 4PS0A 5IAAA 4K9DA 5AW0A 3B1ZA 4Q3KA 1NBAA 4TWZA 4EW1A 1YT5A 2YXPX 1FRQA 2I1WA 2H65A 1DWUA 3ASYA 2N9UA 2V55B 1TF2A 3RJ9A 4PPGA 2BAGA 2H6EA 4YK7A 3ICPA 1T2NA 2QUKA 3BYZA 3GBSA 4V38A 1L1FA 4DV2B 1N6IA 1PZEA 4WZZA 4ZO9A 1TIKA 1C7JA 4YUZA 4W5OA 1XFAA 1EA5A 3HADA 3QENA 4X95A 2QTRA 2GXUA 3GVXA 1OLUB 2DFLA 3BCUA 1F0NA 4HADA 1NJ1A 3PNBA 1L9KA 4B45A 1R5NA 4FQ5A 1ZA1A 4H6XA 1SPBS 3COPA 5HF6A 4YJGB 5HIIA 2P91A 3MFYA 2GETA 1G59A 5BWOA 4KN5A 3T06B 2K6GA 1LX6A 2Z4TA 3MAAC 3RTCA 2WU0A 2XMRA 4XVHA 4P32A 5DX8A 2PUCA 3A31A 2G3YA 5CGZA 4N54A 5IYZA 2IUSA 5CIYA 2BGJA 1A71A 1NVFA 1HG0A 1ZQ9A 2P79A 1U04A 1Q0ZA 3EXEB 3F6SA 4LGVA 2I2WA 1M7HA 3JAKA 4KPUA 4KWEA 1L7NA 3E7WA 1L5NA 4JX9A 3SJ7A 5IFKA 1SOMA 2UUCB 3DVSX 5BR1A 1EXWA 4DUYB 1XMOB 2GRUA 1UDBA 1U28A 2I65A 4EZBA 4PQGA 5DHAA 5BW5A 3N58A 2P7HA 5AVOA 5HFJA 1Y7TA 3RYHB 1XRSB 2RGNA 1CQJA 4BDSA 5BN5A 2REBA 3NC4A 5KQGA 1FUKA 1LLQA 2YJ4A 3AU8A 4RUKA 4Y2PA 2VHEA 4LQDA 4QULA 1NMZA 1NT4A 1AMOA 1NI5A 1L0BA 4RKEA 3AF6A 1UPUA 1Z74A 1ZI6A 1N0HA 1WDTA 2Q1TA 1SB8A 1T13A 2L82A 3IT1A 4OUDB 3K0SA 2CEAA 5DP2A 5K4HA 2IXFA 4LJ7A 3CLTC 1ZJ5A 3VX3A 1T5BA 1QPGA 3KVRA 2B4RO 3W6OA 4QOSA 1P0MA 5KVVA 2A0XA 3ZWWA 1R18A 3ZV3A 2MYNA 3VNQA 1UPAA 2RAPA 3EXIA 1ZHOA 2J33A 3B53X 3WK8A 3EVCA 2H1CA 4D5EA 1XDUA 3KOYA 4C0BA 2VYND 3VKFA 2V6JA 1HK7A 5AQ1A 5LMNB 1JV2B 4TUYB 3WV5A 1D09A 3HNRA 5EP4A 1ZPDA 1VKRA 3I32A 5IKPA 1NVVR 1RYZA 1LUAA 2LDXA 3KPJA 4ZFNA 2W6ID 2ORYA 2QW8A 4FINA 3H9GA 4JI7B 1Y81A 5B7QA 4FS3A 3SEAA 1CF9A 3ECSA 2V7GA 4MEBA 1NNLA 2CWWA 9ATCA 3BDAA 3MGKA 3FRIA 3GAMA 2P75A 2J3DA 4NS4A 2LBPA 2XX3A 3ZV4A 1GGFA 1FU8A 3R9XA 5AJYA 4GE3A 4WKCA 2P3LA 2W6PA 4J8PA 2IYYA 3ZH9B 1N4DA 5KVSA 4LXXA 2WJPA 3R5KA 1M2EA 4XIGS 1GA1A 5CDHA 1IZ9A 3RVBA 1EGMB 4RAQA 3D6NB 1EUDA 4DLKA 2G77B 4QXMA 3PEVA 4PSCA 1DRJA 1RVV1 5ITZB 1LJLA 1Y3CE 2V96A 3W8EA 3CLSD 4K6FA 5AUOB 1VE3A 5E6RA 1A2KC 1L3BA 2WC1A 3HACA 4G24A 4Q21A 4ZMBA 1VB3A 3CXRA 2IITA 3ICVA 4CZ2A 4E1BA 1YR1A 4UU1A 2ZYAA 3GLQA 1WW3A 1T2DA 2BF4A 5TEWA 4RIEA 4BP9A 4EF4A 2D59A 4PRZA 1JPVA 1PR6A 3ZHYA 2FW1A 4XQ9A 1Y8QB 2GN1A 5CT9A 3IMFA 1QHIA 3GWZA 1UKAA 2FSVC 3ADOA 2AIRA 5IARA 1TCCA 1G5TA 3LY8A 4LHYA 4M1WA 2WE8A 3O8OB 1V4NA 3TL3A 5F3WB 2NUBA 5EJ6A 2IL1A 3COZA 4E2WA 5C32A 3QY9A 2ZYWX 1NY5A 3OJFA 1NLYA 1N6NA 1ZP6A 4LC0A 5K1ZA 4O02B 3LD9A 2B8NA 1UBMS 1DG9A 4F1KA 3UJHA 3HI4A 4FFRA 5F73A 4KMMA 1YRQA 2FK7A 5I7RA 3ZVMA 1C1YA 1E8DA 1KVRA 3E23A 2PSFA 1CRLA 1NULA 1R66A 1YZVA 4K3VA 4RYLA 4YBZA 4Z51A 3P52A 4Q9LA 1TEHA 3MELA 2HT1A 1OF1A 2K87A 4KX3A 2ZIFA 3QX7A 4D4HA 1JZQA 4FLMA 1TQ6A 2FRDA 4LS3A 2QP4A 4CW7A 1SCUB 2X42A 1Y7IA 1VSTA 1U0JA 3W5BA 5IP5A 3H4MA 1WPXA 3DC2A 3HBAA 1ZOPA 3PR1A 4FVTA 5B1HA 4HUTA 3RSZA 1DIGA 4TSRA 1PU2A 3BWYA 5KAPA 2FK8A 5K5EA 1PYGA 4OP2A 2P9FA 2JFHA 2YUIA 2VYVA 3H86A 4BVLA 2FSGA 1SBNE 4UMVA 3A36A 4OK5A 4YMIA 1XL1A 4WK4B 1RJFA 3CNNA 3M4ZA 3VR2D 4ZYLA 2NZYA 1SN7A 2CLLB 1YD7A 3DB2A 4OGFA 1XPUA 3PXBA 3KEQA 4BYMA 1EM8B 3PHHA 1ADYA 4WXYB 2OXRA 2Q4DA 4KR0A 4FR0A 3ZOZA 2EGHA 3GMDA 1L6IA 2JLYA 3HYLA 1SOVA 4L22A 4OU4A 1J9ZA 4HDNA 4C04A 2VHXA 1Z29A 2Z2IA 4S04A 1B3BA 1KJWA 2WPDD 1X77A 1DQPA 5A0VA 1LBIA 3QXXA 3HJCA 2SCUB 3U56A 5U1PA 3W5DA 5EMHA 5EXDA 3E35A 5CG1A 4KNYA 4E5SA 1B16A 4TL8A 2ZRBA 4FGJA 1FP6A 1V9LA 2XCLA 2M6LA 1RWOA 3E9ZA 4MGZR 1FSZA 1T0IA 5KYTA 3PYXA 4AQ7A 2WRZA 4GX5A 3U44B 3AR6A 3LO5A 1EQ2A 2A0WA 1P0CA 2IW3A 2VSOA 2VHCA 3PXCX 4DL9A 1RQ2A 2CDRA 3IX7A 3SN6A 4D4LA 1AZLA 3EISA 1Z06A 1UJNA 1ZAKA 3SU8A 1S2IA 4Y2XA 5G02A 3SEQA 2H1HA 2X6RA 3RG2A 5I47A 2IK8A 3KQWA 3MPUA 3F0TA 1PKXA 3TBHA 4Q34A 2R9VA 5BWBA 5K8TA 1HYQA 3BSSA 3CLUD 4ZYZA 2J0QA 1FXUA 3QUAA 4X84A 5DHPA 2PSJA 4RY0A 3VA7A 3USCS 4DDWA 5T41A 2P0EA 6REQA 4MR7A 1H66A 3D6JA 4PPYA 5H3CA 5A3SA 3DR3A 3A6EA 3F97A 1U9CA 4BFCA 1B2RA 4DIDA 4JLPA 2I6FA 4L4RA 4L2IA 4DUGD 3P45A 4U2CA 2BFBA 3G2QA 3VPFA 4CMHA 2DF8A 4GKBA 3H6KA 4HZIA 4X63A 4YWJA 1IDN1 5JD3A 3RLIA 1OZFA 2GD6A 4G5RA 3NW9A 2GKSA 4HOYA 4NYMR 4EZEA 3KJXA 2FPUA 1CUFA 4WFIA 1P1CA 1WZEA 3LRXA 3MS4A 4RLQA 4WXHA 3VR6A 4BNIA 2YHIB 5KJFA 3A25A 3FPSA 4AC9A 1OH7A 1WV0A 3WYBA 1NVBA 3LCRA 4ZZIA 3O2SB 1EJBA 2DJIA 1EDZA 1KU0A 3CN9A 4LMRA 3UFBA 4DMGA 1KDOA 1BC5A 1P0FA 4OJKA 1W4ZA 1BW9B 3THXB 4AQDA 1BG6A 2JLCA 4BV2A 1V4BA 3OLZA 3WO1A 3DKIA 4MH0R 2PX3A 3A9RA 4QXOA 4RV9A 3NHLA 5G40A 4FEGA 1THMA 5FDFA 1VXRA 1YB7A 2GA8A 5AJWA 2OCDA 1OUMA 3QVKA 4F93B 4MARA 2X8AA 3NHKA 5JYEA 2ZVPX 1NJSA 1BMQA 3LA6A 3RC7A 2QMHA 3VPXA 4EVRA 4KQ9A 3HBFA 1R7RA 4WT7A 4RXMA 4D6PA 4EJ2A 4HF7A 1TQ8A 1DNPA 2AEEA 3MRTA 1PZGA 3PYLA 2PZBA 2XAAA 1X80B 4LBWA 8AT1A 3PXAA 3FKQA 2HTEA 1ZUIA 3WIBA 2JCVA 2V4ZA 1MT0A 4ZVVA 3HGTA 3QFFA 3PFNA 3HU5A 3L0BA 2AI2A 3OA0A 4RZ3A 3AEQB 4WZAE 3T7DA 3ZDYB 1KBQA 4GZLA 4RKRA 4F2GA 2CVZA 1ZVKA 2PTGA 4HDKA 4QYWA 1Z0DA 1SKQA 3TCXB 1O1YA 1P9WA 1Q1QA 3CISA 5HMLA 4YAUA 3WFIA 3JYLA 1KAHA 1ZS9A 3FIUA 5JMPA 3TZHA 4B8WA 2XUZA 1XKLA 3RV3A 1W2HA 1XTRA 1XTVA 5ADWA 2OBBA 4JA0A 3R1IA 4RVNA 5L3QA 4RL4A 2KLBA 3UHOA 5EKSA 2HWWA 3IEMA 4HEA6 2PFKA 2C4UA 1Z2PX 4Z2YA 2B8EA 3CRQA 4P4UA 3HL0A 3OIYA 1E2IA 4OHOA 2EZ8A 1E5LA 2Z57A 4ZIRA 5I7AA 3U16A 1SM4A 3GUZA 3GNTA 4FGWA 4Q01A 4FNMA 2QMQA 4JQZA 5JD6A 1TCUA 3R6GA 1DDOA 5FWYA 4UUBA 1DXHA 3TQSA 2EARA 1QZUA 2PWAA 5DM4A 3E81A 3IPAA 5C53B 2IYVA 3L0OA 4AFNA 4FFOA 4JLAA 4MS4B 5HIMA 3AKCA 4O2BB 4D0GA 4G84A 3R8XA 4EM6A 1G3IA 1Y8RA 1ULSA 2ZBUA 1PFYA 2RJNA 4HGQA 2AT1A 1LBTA 3E5HA 3QPUA 4V3CA 4ACAA 1VJ5A 2HT6A 5JUWA 2IHNA 3CCFA 3H4VA 5J5VA 5I4KA 3KQKA 2BWJA 4RWEA 1XLUA 4CL3A 5EIAA 3QWHA 4B3IA 2PA3A 3LYHA 1U28C 4J3JA 5LZ4A 4DV0B 2FZ5A 4BFLA 1YJAA 2RARA 3IERA 3PP8A 3IHLA 3M1IA 2Q3FA 4HYEA 3U3JA 3ZD9A 4Z49A 3T1YB 1H0SA 3W2GA 5B58C 5EP1A 2PH7A 1F38A 3SF8B 1NBIA 3R8CA 4JYPA 2BSAA 1GZHB 1ZMXA 2JAQA 2XUDA 3WKBA 1KRXA 1T10A 4W63A 2XSZD 4JBIA 1V8OA 2H5JA 4JLSA 1QKIA 1V9CA 2Q6KA 4J3NA 1Z4MA 1GL3A 1XHFA 3EK2A 5EHXA 2FE1A 1T4CA 1GN9A 2XMZA 4RLHA 3A1FA 5L4NA 4F56A 1CZNA 3RVQA 5H9WA 2IGBA 4HC4A 5L95A 3RNLA 1N1DA 2DTEA 3K15A 4BMVA 1IBSA 1WCYA 3BHMA 3DEHA 4JJKA 4EVQA 2R6ZA 2FZVA 3ZHXA 1UDXA 4MPTA 4GI2A 4TUYA 3DBOB 2NGRA 4M4SA 4UZEA 4ZOAA 2Q7XA 1P6QA 1SFRA 4UTPA 3N2EA 1QAQA 2B4QA 3BJRA 4PNHA 1T2EA 3LP6A 1OB5A 4PO9A 2H0QA 1Y89A 4ISCA 2IVFA 2LCIA 1CHNA 1SUPA 2VBIA 5G2OA 5A6SA 3RT1A 4LY6A 4JXKA 3B1WA 1CLEA 4HN2A 3ZIAD 1SBHA 2VC2B 1XTBA 4MRMB 4P22A 2PRIA 3L6OO 4HDMB 4EBFA 3KIPA 2O8EA 1AKRA 4ZDIA 3WLNA 3RBAA 3DHYA 2FKAA 1A5BB 1OGJA 4W5TA 1IHYA 1U9JA 4O3FA 4X64B 2PM8A 4QELA 1O6FA 1U8FO 2BEVA 3L1VA 1P4AA 3K2IA 2P11A 3JYOA 3RJTA 3SFZA 1MIOB 2FPLA 1N2ZA 2P78A 1R5BA 1KH1A 1D2CA 1NSFA 4HEJA 3O5AA 4OPMA 3T6KA 4LCEA 3T5MA 4IY1A 3IQIX 3KXPA 4RS3A 2JPDA 2O14A 4G8JA 4Z8XA 1MPXA 1BCRB 3PCXA 2NZ2A 2ZJBA 1QH1B 1O6CA 1RCFA 3GLUA 4NNJA 4F4FA 2N1MA 2EC5A 2ILTA 4CTMA 2AJTA 2CNNA 2O54A 2LZ0A 2JRLA 4RHYA 4NDAA 4BE7B 4UAJA 4RTNA 4KDFA 2WVGA 4EG7A 2PIDA 4RM3A 2H0AA 2DU8A 3CVOA 4IQ8A 1YVUA 4IH4A 5FOXA 4X1YA 1B26A 4AF6A 1XQ9A 2C88A 5E4FA 4NI5A 3MWGA 1U8XX 2VJMA 1PDVA 4I99A 1WTAA 1U8TA 3VVCA 2BJHA 3O8QB 4XQ0A 2NXWA 4PSUA 4G9EA 3OX1A 5JPDA 1Y1PA 5IG2A 4P33A 3TLZA 1OYWA 3UANA 2P8SA 3H5TA 5JG7A 3DOFA 2CFRA 2MSWA 2X2PA 2O2DA 3D7MA 4ZICA 2QM0A 2YJNA 3L5KA 4LUCA 3RDPA 1U80A 2FF7A 4OXKA 2EJUA 2C9ZA 3FTPA 4K87A 5BURA 1KY2A 5KWEA 2VHWA 4PG8A 1EFRA 3GLTA 4UJ5A 5HTKA 2A6PA 4PQEA 2O23A 5AKZA 3UUEA 1UBCA 1H1LB 1XAGA 5JVDB 5C1IA 2KE5A 3HYTA 3OM8A 4PXSA 2FRDC 5E8JA 4PQFA 2IUYA 2O2IA 3JZFA 2DQZA 1EXNA 3GFVA 4RPIA 2OAP1 5E9WA 2OR3A 3FNRA 4J4HA 4TSFA 3RVOA 3SEZA 1I6LA 1U2QA 2WJVA 3RJ5A 4J7UA 3I9KA 4YXWD 5ES4B 3VHXA 2LW7A 1OV4A 1FNDA 2WSMA 1NA5A 1RYYA 1T2VA 3MN1A 4XYLA 4Q4CA 1N5KA 1KZHA 4J0JA 2V4MA 3WYNA 5LJLA 2FQXA 2PH3A 1CR2A 3TBKA 1GSHA 4TMVA 1Z35A 3P9YA 1O97D 1V8DA 2JAOA 1HDGO 3CE9A 1HE4A 1NU6A 1AVTA 2VUSA 3FOWA 2JJ2D 3AF4A 3GO4A 1IHXA 3CT4A 3HHEA 3KJGA 4HAZA 4JUAA 5LIPA 1Y1KE 3LI2A 3PGLA 4NAHA 4TRNA 2WHXA 3QU4A 3K31A 4TVBA 1Y3HA 4FOSA 5KYXA 1BS1A 2H7YA 2V74B 1WUIS 4K1XA 5ERXA 2EFCB 1ICEA 1RE0A 1HZZC 1JIQA 3CF2A 1EFVA 2B83A 4FZ3A 2DSTA 3I4LA 3ZJVA 3IESA 1BWPA 1YS1X 2A84A 3HU1A 4IHKA 4GXQA 1CUGA 1XVIA 1Z6GA 3VNRA 4C3UA 3S68A 1QORA 5DSXA 3OIWA 5KNBH 2NO4A 1IJKA 1V6CA 2FN7A 2IBTA 4QEDA 1D4ZA 1VIMA 5HKLA 2QTHA 1J33A 3GRPA 3KKZA 5KKCA 4DZZA 1C41A 2D5CA 2OORC 4JH0A 3F90A 2FW6A 3PEFA 3ER9A 2X0IA 3NPMA 1ONNA 4LKOA 2ZTUA 2WSSA 1S8NA 3CR7A 2XZOA 1T4DA 4FN4A 1QZ3A 4IZ6A 3JARA 4KBFA 3AVWA 4YAJA 3R9XB 4WJKB 2FVXA 4Q1CA 5IU6A 3LUAA 5HRUA 4PRKA 3H5AA 3P2EA 4V0MA 4JXZA 1E8MA 1KXZA 3VOBA 3BEDA 3D9QX 3ABQB 1HYBA 1NMYA 2Z5LA 5WRFA 2C58A 3D2BA 1GJRA 4G5HA 3KSAC 2WJWA 1L9XA 2UDPA 3EGCA 3IA2A 4BASA 4C3OB 4UDNA 3KTDA 1UBEA 1ZMTA 1JHAA 4FNOA 4FHGA 4BO2A 3BS4A 2DXIA 1NV9A 2W6JD 4D56A 2IH5A 5T64A 3Q7IA 4FB4A 3LPLA 5IHXA 5BSGA 5FTJA 4R41A 4IOMA 5AK5A 4KTTE 5H16A 3DMRA 3OIDA 4JB3A 4KNVA 4Z5XA 1WX1A 2DHCA 2BHNA 3AEKB 1XCPA 4NDZA 5KQPA 2OOKA 2XMDA 3MCZA 3K30A 4R84A 3S3TA 3ZQUA 5A7HA 4KWHA 4BMPB 1ZH6A 3PU6A 5T6BA 4FONA 4L57A 1PL8A 1M1YE 1SIBE 2DULA 2I6UA 1UP6A 4I14A 4BRWA 5A3RA 1BHSA 1KEVA 5TGTA 4E2YA 2OP0A 1DX6A 1Y6GA 2G6TA 5CVTA 1T36A 2IPAB 4TTAA 1DSSG 1Q1ZA 3OE4A 4NCNA 3V8MA 2F64A 3VDRA 2JKZA 1V16B 1CUJA 4QGAA 5HS6A 5A6SB 3SYTA 3KKMA 3UB4A 1Z0SA 4P4LA 3JZDA 2RKWA 1PQPA 5FAXA 3KD3A 2BDEA 2CLEB 3GOQA 3I12A 4CV1A 4BKOA 5CXUA 2JBWA 1BH6A 4NL4H 5FBQB 1YI1A 4ED9A 1V6SA 4HN4B 2WP0A 4C0WA 4J0DA 3UJPA 1C30A 3M6VA 1FP4B 4PGGA 4AF7A 2EBHX 2ONYA 1MX3A 2G08A 1QHXA 3WG9A 1QE5A 3UMMA 4I1PA 2A1UA 1KPHA 4WRRA 4EAQA 1KQPA 3KUCA 4Q9AA 4BFWA 4J2OA 1LI7A 4ZDWA 3A9UA 2AUMA 3AUXA 4OJQA 3UCEA 1QC5B 4O4LF 5J3JA 5CT8A 5IVDA 1PEKE 1OH8A 3GMIA 1AD2A 3F6PA 3QKIA 1BQEA 4LQ4A 2CNDA 4CKYA 1NG9A 5TVGA 1E69A 4P08A 3KFLA 4TLAA 3KJIA 1DRVA 2VNJA 4QDXA 4Z7JA 3NVDA 1RFLA 3LUCA 4NE9A 1IRIA 4Q37A 4Q3EA 4F1WA 3L0ZA 4RY8A 5JSZB 4IW3B 4XKJA 4DT1A 3RAEC 2XUAA 1O96B 2QJWA 4BVAA 5K3FA 1K5DA 2AFIE 2LR0A 3ADPA 4QLAA 3V8NA 3HB9A 4GIBA 3VZQA 4P4GA 3K5HA 1QS0B 5BPHA 5K6RA 3DOCA 1TTQB 2QG4A 1WKBA 1W5AA 1PR3A 5HMMA 4Z4HA 1DE0A 3FZEA 121PA 4RNDB 1A77A 1CUXA 1H4SA 1R27A 2GBFA 4HGYA 1N5OX 3NXSA 2WT8A 4WD3A 3JS5A 4JT4A 1PEDA 3HWRA 2IYSA 3A1VA 4TOIA 5IVIA 2IUEA 4YHHB 1QIIA 1JFSA 1BYIA 2TMGA 4HEQA 3ZKAA 1ZVQA 3K72B 5REQA 3E9MA 1ECLA 5C4GB 1OLOA 1XJ0A 1TXGA 3FZYA 3Q1LA 1DPFA 1E63A 4MQEB 2CWDA 5JT1A 1YQUA 1KK2A 4FW9A 4ZVQA 3BE6A 1NJ2A 4RMNA 4GQBA 3OKCA 3IQZA 3RVMA 4ZODA 3L6RA 3WIUA 3MTEA 4V0RA 4IIEA 3EOBI 4P3PA 3VC7A 5MDHA 3RTAA 5TPWB 2ZXEA 1TW3A 4KLAA 1M5TA 1XQYA 2BKXA 2XAUA 4KYTA 4B35A 4CIDA 3JD2A 3RNOA 4RC9A 2VNKA 3BXFA 3VKGA 4OLHA 4DQKA 2GCNA 1A5SB 3CRRA 3S2ZA 5HTOA 5LM3A 4QUDA 1I7DA 1ZVVA 3R6WA 3DHEA 2YN0A 4NFYA 1B6RA 1EP1B 1L1EA 2E2WA 3R09A 4PQYA 2YASA 2IHKA 2FJPA 1QK4A 5J43A 5F1KA 3CNEA 2BTOA 3ET4A 1JA9A 3EVGA 2UYQA 2PKCA 1KIFA 1UJ2A 2GVNA 3PDWA 4K1LA 5EYPB 3SQOA 5BQ5A 2X4IA 5HE8A 2YMPA 4ARVA 5CEEA 3VH2A 2VI5A 2W11A 1ZN9A 4XGNA 2HSJA 5A04A 2HBYA 4PANA 4GDFA 1FQOA 1H6DA 2P3QA 1AUXA 1TDJA 4NJMB 4PX3A 4RA6B 3I42A 1J25A 2W5UA 1JEYB 2AEJA 3G5TA 2NUPA 2BHRA 2QVBA 5AXCA 4DA6A 4DC0A 5C37A 3TVTA 1O2DA 4R3WA 4FX2A 2DYKA 3BHJA 2BYTA 3CH5A 1K7YA 2Y0DA 5C8DA 2Q9CA 2IYAA 2YHUA 4WXMA 4HJRA 2LXNA 5M7EA 4CLOA 1IXRC 5TMBA 4N5IX 1CXZA 2JB9A 5JQGB 3O1LA 4TLBA 4YREA 1IN8A 2XKBA 4ZRMA 2CJXA 1Z0ZA 3SIXA 4MB2A 1E64A 2NADA 2XMSA 2GCOA 4OM8A 2WYOA 4LZWA 3T5GA 2LDYA 4EGSA 2FFAA 1A72A 4NCXA 1EGHA 2ZFUA 1A8SA 5CM8B 3NM5A 4GX0A 4R9UC 3GW8A 3P8ZA 4C08A 5E9AA 1CUVA 1O08A 1QK3A 2V3WA 2MSEB 4F4DA 2EQBA 3WZLA 2OFXA 4HH3C 2WAXA 3LY5A 3TZ6A 4CMEA 4EG5A 5EHZA 1I9CA 1CRZA 2DR0A 5KSPA 1MW9X 3RIXA 3COJA 3JRNA 1QIMA 3HDVA 5IJXA 4XDZA 3V8VA 3LBHA 1F3LA 1MDFA 3QEMA 1PGQA 2LNDA 1MB0A 1R74A 1X7HA 5EZYB 4LF4B 4JKYA 1UDCA 4QTYA 1PL6A 4UPEA 1OOEA 5ICCA 4NYJQ 4GDMA 2QG9A 3HEAA 4MEAA 5EP2A 2BFPA 1XMVA 1OGIA 4MKZA 3I8XA 3NG1A 2QYSA 5TS3A 4AL4A 4R1NA 4V02A 4HWKA 4R1PA 1VCHA 4R1MA 5CVDA 1NKVA 1Z75A 3EZGA 1BVHA 3OWOA 3O38A 3DOJA 5IBCA 4X1KB 3MMZA 2O1SA 1DFIA 2QTBA 3O03A 1TIBA 4OSPA 4D3XA 1GGKA 3DL0A 1JQ3A 4GEGA 2C9MA 1DOZA 3NP9A 4WN9B 1NXSA 3LECA 1IVYA 4LX0A 3L8CA 3HJRA 2J9XB 3L0YA 3T9AA 3VHRA 4QU9A 2G88A 2OGUA 4M36A 4P3YA 3DLAA 2G9VA 3DCYA 4KK3A 3SQDA 4ZOBA 3U9LA 4MLDA 4YJFB 3SZMA 3VQTA 1SB9A 5IJ0B 1ZM9A 2O0HA 3RIYA 2FWMX 2PU7A 3PXGA 2CGEA 1ZJ4A 2JEOA 3QF4B 4L0QA 1MC5A 4P0QB 4OJNA 1KEKA 5GOTA 1Y5RA 3FTCA 1B6GA 4Q3DA 3WJAA 1MX1A 1ZRSA 4RF4A 5BSRA 2WA1A 1NUQA 3KKQA 1GXSA 1LDBA 4OB6A 4W7HA 1W8IA 2R7NA 1ZVJA 2O8BB 3CJTA 2QZSA 1C8VB 1ZOOA 4IINA 4LSWA 5G3YA 1OAAA 3DO8A 1IZ7A 4H7JA 1OSNA 3FYTA 3UH1A 2C3OA 2IVZA 3K20A 7MDHA 3IP5A 2ZQZA 5JH7A 2IPNA 3PK0A 1Q74A 4BWYA 3HBLA 1ZM4A 5CDGA 3P2OA 1P9NA 1TIPA 2KHZA 5IN5A 1XGKA 1WW2A 2FFRA 2QT9A 4H7EA 3ZXUB 4FYKA 1HZZA 1AGRA 1E3WA 3M8KA 3THWA 2O2YA 1SVMA 2ZYTX 3EVFA 4ZVKA 3OHMA 4EH1A 4V0SA 4ASUD 4G4GA 4OTZA 2V7QD 1M8KA 3Q0IA 1UBSB 1JRLA 1I1OA 5EHNA 1DC8A 3L4BA 3NJ8A 3T4PA 3LX4A 4IOLA 3EE6A 5DNCA 3DAHA 421PA 4CU5A 5KMGB 3F6RA 1JHXA 1TCVA 1Z33A 1E1KA 2QR3A 4ZP1A 2R6GA 2D54A 2OORA 4OA5A 4MRAA 3TW0A 3WDSA 4ARSA 4GI7A 3IKTA 2YJGA 4TZ6A 1ZXXA 4KXNA 1G1AA 2HXSA 4DA0A 1Z8NA 1DI0A 3JQPA 3SIPA 2H11A 2YKQA 1ZH0A 4DCCA 2WG2A 1RBZA 4CFZA 3FFXA 3B48A 2RONA 3M2PA 1J2TA 2G1UA 3A58B 4OYRA 2VIIA 3HEBA 3HXLA 1ZRNA 3FUWA 4UFPA 3IDSA 5LFAA 1DIAA 3EBPA 2CYCA 1C1XA 1KSFX 2VUTA 1KGSA 5J2TA 4FTWA 2WDPA 3FNFA 1A2QA 2A5FA 3HY3A 2MINA 2JLVA 1HETA 2NOAA 2FHSA 1G98A 2IHVA 2CNWD 3KUKA 4AMBA 3IDZA 2PMFA 2QMYA 4LDRA 2WUVA 3OHSX 3NPAA 3UA3A 1BX1A 2O3UA 4AG5A 4AYXA 1SCBA 4ZCMA 1JVSA 4N0PA 4OGGA 1FK8A 3RAFC 4FHEA 3UJ9A 4EI9A 3JQAB 4K9PA 3RFCA 2B61A 3TMKA 3PXEA 1JEJA 4IS2A 4BOYA 4C3VA 4DILA 2AR0A 3JD3A 2BM0A 1HRKA 5DYIA 1XTKA 2CDAA 4KLZA 3U37A 4HB4A 3VYRB 2RBGA 3HR7A 1P4RA 3LHSA 3QF7A 3T7AA 5LDDC 1T8PA 2O9JA 3SDSA 3KV1A 2DAPA 5K0TA 2WABA 4DMLA 5BVGA 4QXQA 5KTMA 1K6XA 1BEZA 2B30A 4ZT7A 3EXHA 2R6FA 1GDDA 2PLWA 2IDZA 1TRHA 4RO0A 3LQKA 2OMEA 2Q6TA 3KZXA 3RRNA 3NX4A 3BWMA 3GVIA 4N7JA 1QF7A 4DGQA 1Z34A 1QDEA 2VF2A 4L74A 1IG3A 4XM0A 3NEAA 1PJ2A 2QAGA 4I3HA 4DJAA 5FA8A 4KAJA 3SGLA 4F3TA 1KYTA 1UOOA 1GLVA 1S0UA 2VK1A 1I10A 1CY6A 3OP4A 1GXSB 2R47A 1O0BA 4JI5B 4D9BA 4PHFA 2G1PA 1YBAA 4DLZA 4O4IA 5C8YF 2AR7A 2Y68A 1HR0B 1DAEA 1DC5A 1ZWKA 1FX0B 4LZAA 3PUYA 2K4MA 5ETJA 3VZCA 621PA 4LG1A 5IDWA 1UMBB 2HY7A 4U9IS 1JHYA 5JECA 2R62A 3NI2A 4QD3A 5ELMA 3P0RA 4D0NA 3PNOA 5ENDA 4EK9A 1QV6A 2VHUA 1IQPA 5FNVB 3L7NA 4KXYA 5HVNA 4HVLA 4MWZA 3DHNA 4WLNA 5G0VA 4EFMA 5CA1F 1XRRA 1N3IA 1Z25A 2YS7A 3D54D 3NASA 4YLGA 5BNTA 1ULAA 4ZK2A 1U90A 1JJVA 1O58A 2KS6A 3RQSA 4EYQA 4KTVE 1OJ7A 3JQ9A 3NANA 4I19A 1T4CB 3A2MA 4KFCA 3NORA 3VX4A 2XDYA 1Z6XA 2V6IA 3C4VA 5GPBA 1SH7A 2E9SA 3FDFA 4OQ4A 1SU4A 4IJQA 2WFAA 4JVSB 4BMSA 1R0KA 5CPBA 3WTBA 1DKMA 1ORWA 2V7UA 3KHTA 1R9MA 3WNCA 3GX1A 1NI4A 1BGXT 4NPCA 1CUZA 1JMKC 2HA5A 2ZSDA 4MRMA 3VZPA 4I7EA 4D8UA 1D9XA 3L79A 1E6KA 5AKYA 4AMGA 2WZBA 4XB2A 2GEBA 1YOVA 5P21A 4AF8A 1GU7A 5LQSA 2JFFA 1P6UA 4C06A 5ISMA 3EBLA 3CONA 3L04A 2XCIA 5E6SB 1RRGA 3AO0B 3UEOA 4A6PA 2NVOA 1I4OA 5DLYA 1C3XA 3GJ4A