4Q1AA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 6 {2-[5-(4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-1,3-thiazol-2-yl)-2-methoxyphenoxy]ethanol}
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
230
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 230
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1aA00
5EZ6B 3O8CA 2YWHA 2AK2A 2BBOA 1W0KD 4JJZA 3GLFA 4H1UA 1U99A 1ODFA 2G83A 4PZLA 2DY1A 1AQUA 1XJCA 2JJ1A 2NMVA 4P4SA 1G3QA 2W6JD 3L43A 1QHXA 4BFSA 4DCUA 4D2IA 4UNNA 2QA5A 1XD2B 4UJ3A 4E22A 1YZGA 2ZRIA 1KI1A 1Z6XA 1ZVQA 2MSDB 2HLDD 3WP0A 4ZDIA 4HAZA 1G3UA 2CL6X 1W36D 4PSVA 1FUUA 1QHYA 5EXPA 3OIUA 1TL7C 4LYHA 5J4LA 3DHWC 4C0LA 2XB2A 4Q4AA 821PA 1AGRA 4OI4A 1KSHA 1HE1C 1EESA 3KDSE 2YWFA 3OE7D 4OKSA 2VL7A 2NTYC 2QU8A 4P3YA 1R0XA 3MFYA 2ZU0C 5EE1A 1ZP6A 3KJHA 3PFIA 3LNCA 1GRNA 4D25A 3PR1A 4LBYA 1E1QD 3LBIA 2GCPA 2IYZA 1OXUA 4Y0AA 4V0ME 1WBDA 4QHSA 2H92A 3EX7C 1R5NA 1E0AA 2VF7A 3HR8A 5J4HA 2ZJ5A 5DN6D 5KNCA 2VBCA 1YR9A 2VHCA 1NVUQ 2OAQ1 3A1UA 5DLQC 2W2VA 3B85A 3N5CA 4WVFA 5KPJA 4AG6A 1DAFA 1VDZA 1IXRC 4GOXA 2HJVA 1N5LA 1RRPA 1TF7A 3KFVA 3QQ5A 3QF4B 1EK0A 3OE7A 4AKIA 4HDCA 1KAGA 3GLGE 1OHHA 4C7OA 2IBMA 4M9SA 1IXSB 1E2GA 5CJ2A 4CRWB 4OHYA 1P9RA 4C9BA 1QBKC 1US8A 3I5XA 1LF5A 2XNDA 3K0CA 4Q4JB 2NQ2C 3L0PA 2QTHA 3BC1A 2E9SA 2ONKA 2HUPA 3P1JA 2GNOA 2WWWA 3KTAB 3H0KA 4YXWA 4GOKA 3TRFA 2BIFA 2HF9A 4M21A 1CU1A 3QKTA 2CVFA 1ZINA 2WM9B 3EZ9A 1DAHA 3NVAA 5FPTA 1G4AE 3EXAA 4A0GA 2ZAMA 1SXJC 5J40A 4A1FA 2C5LA 4BGDA 4B47A 1N6LA 2B21A 2BEJA 4C2UA 3I62A 3RSLA 3OFND 4FCWA 1NY6A 2P65A 3W90A 1CR1A 4KITB 3GJ4A 2HDNB 3GEEA 2VA8A 4P0TA 4BWYA 4RD3A 4EDHA 1ZUHA 3IDQA 3O8RA 4X8HA 2H17A 4KI0A 1EX7A 3QXXA 4PTLA 2ZRNA 4UNSA 3VR3A 1A1VA 3QBTA 221PA 1XP8A 1W5TA 1GKYA 2WJYA 2FFAA 3Q72A 2NIPA 4KBGA 3Q85A 1WF3A 4W9MC 3QOFA 1V43A 3IPXA 3TR5A 1XTSA 4B48A 4QJ3A 3VTKA 4PX9A 3I4LA 1NBMD 4NYJQ 2F1HA 2GWHA 3W6NA 1G291 4D4MA 4F4IA 4K81B 3TW4A 5AJYA 4HB4A 2DHRA 4HI0E 3PUXA 4TMXA 2J7KA 4GP6A 1EFRA 1NVXQ 3UWKA 4JVNA 1GZSA 1JXOA 4K8OA 3ADBA 3FHCB 1EFCA 1E1RD 1DARA 3HYRA 3THWB 1Q22A 2HCJB 4AKEA 5EP3A 1QDEA 2GA8A 4JYBA 2P6RA 1LNZA 4JVMA 1N2CE 3KUCA 2NGRA 1G20E 4TL9A 2QORA 3LDAA 2Y8EA 2FFHA 4M1MA 1XEXB 1ESNA 1NJFA 3H2YA 5CDFA 1OKKD 1NMXA 1XBTA 5JS8A 1XD9A 3PQCA 5HR5A 4GPTA 2ZRMA 5JWHA 1ZW6A 1NLYA 2C77A 1TUIA 3NBXX 4BRWA 4TTRA 5H1YA 1NVVR 1PUJA 4Q9HA 4Q47A 4IDNA 3FFAA 1E9BA 3BB1A 2IYTA 1DBSA 3QF4A 5TDHA 2JLRA 2IXFA 5KSPA 3WBJA 4DLSA 4ZCMA 4A0RA 2D4HA 4QRHA 4DBLC 2VEDA 4B3FX 4UNRA 4MDFA 1J8MF 2D7DA 2W6IA 5B58C 1YR6A 2XTMA 1DG3A 1MO4A 3BE4A 3GLHE 4V03A 3Q8XB 4OQNA 5FOTA 3AKDA 1H8HA 3R8FA 1SQ5A 3A1SA 1KYIA 5KOYA 5JCPA 2GEVA 4GBMA 5KNBA 5GJCA 4UKDA 1R0YA 2BM0A 2W0SA 3OHMA 4B74A 5JMTA 1ZMXA 5FOXA 2A5GA 4OL0A 4G3XA 1Z0AA 3AKEA 5GJWC 1FW6A 4GRAA 2IYVA 3IIKA 2ODWA 3UWOA 4B35A 4XH9B 3K09A 2VPPA 2JIZD 1KOFA 1YZNA 2FEOA 3HPQA 5SZJA 3RYTC 3QVUA 3G82C 1W4RA 2FZLA 2GXUA 3AVQA 5L3SB 2NPIA 4D4KA 4M9XA 3RS5A 2AR7A 1W4CA 3I73A 1HYQA 1Q44A 1J70A 3HU1A 3QKRB 2R6GA 4JT4A 5BXQC 1PLJA 3N2IA 4A4DA 3SYLA 2O0HA 4C2TA 1X8JA 4IHQA 3DM9B 5CK5A 1R5BA 3ZQJA 4FMCF 1KJZA 4D82A 4B71A 1HQCA 2WSMA 1FX0A 1OF1A 3DVLA 3QPWA 1GP2A 4BZXA 3EARA 1E2JA 1Q1ZA 1ZCAA 3K9LA 5DSZA 3SN6A 1SKQA 2DYKA 2F43B 1FFHA 3PIRA 4Q4LA 1I2DA 2CJWB 4DVGA 3T12A 4IEIA 3CZQA 1T5LA 2V6IA 1XDBA 4WIAA 4PAQA 621PA 1Z47A 3MD0A 3FGNA 1XX6A 1RPZA 2JDIA 2J5XA 4RZ2A 2ZRDA 4JKIA 1JNYA 1G16A 4MKHA 4A2PA 1OXTA 2JAQA 1UEJA 4DLRA 4UXHA 1IBRA 6Q21A 3SJCA 4KLZA 2OV2A 1K5GA 2VF8A 4URYR 2NO6A 3CIOA 1SKYB 2WWIA 2QAGA 2VP5A 4AKHA 4BQSA 4W5JA 4UNQA 3CW2A 1R10A 4B3CA 4DXAA 4MDEA 1ZU5A 3ZVRA 2XTZA 3SYNA 3ZD7A 2OBLA 5LPNA 3EIQA 3PEVA 1MV5A 4PPGA 5JLJA 1WXQA 4YLGA 2QAGC 3C41J 3ONWA 2VP6A 1HE8B 4LBWA 3KXLA 3NDBB 1JB1A 4WXPA 4NCJA 4TZ6A 1M2OB 3NKVA 4QBIA 1E2DA 3A1WA 3CPEA 3WNCA 3ZVLA 5JWRA 2QPTA 2BCJQ 4RZXA 2D2EA 1G3MA 4Z1MD 1KY2A 1SVLA 4JL5A 3KQLA 4B2LA 4LPSA 1S9HA 1IN6A 4DCSA 2IS4A 1G3RA 1RIFA 2YZ2A 4Q9KA 3SYKA 4C0HA 1VG8A 4F38A 4B2IA 2IF0A 2VSXA 3KQNA 1L8QA 5IHPA 2OLJA 1II9A 2QP9X 1CXZA 4IKEA 4KFSA 2F9MA 4PHHA 1PLKA 2DCUA 4XSGA 2G6BA 1N25A 2QM8A 1NRJB 1UPTA 1W2GA 4NYMR 2BEKA 3OIWA 3SI7A 1QG2A 2HT6A 4V0MA 5A5GA 1SXJB 2DFTA 1P6XA 3G0HA 2OO7A 4BPBA 3KKQA 4I99A 1EWRA 4HLQB 4JJKA 4ZKDA 3PEYA 3AF2A 1DELA 4IOLA 1W7AA 2IW3A 1E6CA 1GNPA 3T15A 3PUVA 4DLYA 3ECCA 1ONBA 2REBA 3EZFA 2UVQA 4P31A 2P3SA 1CR4A 1N6HA 4YMTA 2G0TA 2XOKA 2G1JA 3WRYC 4BE7B 3B9PA 3U61B 1R0ZA 2UZ3A 3BXZA 1P5ZB 2QSZA 1IQPA 5GJBA 1CF4A 2QQ0A 1N6RA 4DSOA 4EPVA 1FNNA 2HLDA 2YOHA 3C4JA 3RRMA 2ZR9A 3VHXA 3RANA 1P60A 4CW7A 4ZKEA 4TTQA 5JRJA 3LBNA 1XMJA 3IEVA 4B32A 3ZLJA 1DG1G 4MRRA 2A5FA 5FTMA 4IXMA 1ELOA 4Q00A 5LB4A 3P26A 5G3YA 2OG2A 3F3YA 4S35A 1Q3TA 1X8KA 2CCJA 4JLJA 1NVWQ 4XTRA 4DJTA 1S1MA 1UBFA 2OCYC 2FV8A 4LJ4A 4PPFA 4DC9A 1SXJD 3LXRA 4PSAA 4YQFA 1AN0A 1CBUA 3UPUA 1X6VA 4D80A 1RZ3A 5UKDA 4V0KA 4J0QA 1VIYA 3SHWA 4PHFA 1DTSA 1KI9A 3CONA 3UKDA 4F92B 1OH5A 3DKVA 3MJRA 1E32A 4TL8A 1EG7A 1CR2A 4GZMA 1GM5A 1AGPA 4L9SA 1IONA 3TSZA 2YWGA 3FKQA 2HJGA 3VKGA 2PX3A 3CUEF 2JLSA 4JKYA 2WVJA 1Y63A 4L9WA 3AVVA 1W4BA 3LAWA 1YE8A 1JR3D 3V4RA 1H65A 4O25A 3AVYA 2QGNA 4GL2A 5C4GB 2Z4RA 3JVVA 1XPRA 3A6PC 4DRZA 2FU5C 2GJAA 5D3MA 5FL3A 4MKIA 2ZAOA 2QTFA 4QHTA 4YONB 1VECA 2WSSA 2A3RA 3GLIB 4I1VA 3K9HA 3LW8A 2DWPA 1EFHA 4RFVA 2ZE5A 4MRPA 3B13B 3WHLA 3GMTA 3I92A 3Q7PA 2RHDA 3FTQA 2IC5A 4IEEA 4DLWA 4G5OA 1E9CA 2OM2A 2H16A 3I72A 4JZKA 3U4QB 4TMKA 3AEZA 3M0EA 1F60A 4NKRA 4XIGS 4AG5A 3HU3A 3A8TA 3MWLA 3NH9A 1Q21A 4LHYA 2OEPA 4XJXA 3WY9A 1X86B 2JLQA 1UKVY 3PUYA 4BFWA 2AL7A 5FBQB 4PHTA 1JXMA 4A6XA 2ORWA 1ZM7A 1MT0A 1RVDA 3AF3A 4I1UA 1GL6A 1KI8A 1ZNYA 3KZ1E 4LCBA 1ZC4A 4EJSB 3LQRA 3SQXA 2CK3D 4GOJA 1ZD1A 5EE9A 1WQ1R 1XPOA 4QGFA 3P20A 4URUR 4ZDJA 4XVQA 3VR1A 2XJ4A 5F2EA 3NBYC 3LX5A 5AWFC 3VKWA 4QOSA 1E2QA 2VP4A 2VSOA 5EZ5A 1BKDR 2G0NA 1J90A 5DE3A 2J9RA 3R20A 2CLCX 1IJEA 4A0HA 4TQUS 4URXR 1G4UR 4NU0A 4OQLA 4Q5IA 1UBEA 4B43A 5KDLA 5FH9A 3BS4A 1CJMA 4C0JA 1ZUIA 3CF6R 5BN4A 2ZVQX 4POAA 1RRGA 2RAPA 4PQRA 2BC9A 4FMDB 3QXSA 3MSXA 4M1SA 4Q01A 1QHSA 1AA9A 3TMKA 5BYJA 5TY0A 1TUEA 1XZPA 4Q19A 3TNFA 4DIEA 1UAAA 2VP0A 1KO5A 1R5OA 2B7CA 3PENA 2KI5A 5JHGB 1LV7A 2KE5A 1ZBDA 2ODEA 4ESVA 5KPDA 3LH5A 4LK2A 1Q0UA 1G8FA 2X77A 1OYWA 4TQ9A 5FBLB 4DUGD 2CNWD 1KK1A 3A58B 1ZNWA 2OSBA 2IYUA 1FMLA 1OJLA 2Z83A 3DKPA 2GZDA 2ZR7A 3SC3A 2IX3A 1KY3A 2WJHA 4OI0A 1JR3A 2WOOA 1T3HA 1OIWA 1LS1A 2R6AA 2R6DA 3FFBA 2QAGB 1EX6A 1OW3B 2QE7A 4IOMA 3B1VA 3WMEA 4GDFA 3CWQA 4N0EA 1G7RA 2KBEA 4Q9JA 4CYMA 3EZ2A 3OIVA 5TV2A 1JECA 3KJIA 3GLGB 1TQ2A 5FUWA 4PC1A 1TF5A 2ERYA 2J0QA 1I4LD 3QEJA 5JRZA 4WXRA 5L3RA 4H1VA 1KK3A 2I1QA 2VP2A 1E2PA 5BW8A 4HAVA 3TSOA 3VMFA 4JL6A 4P32A 1GL7A 4KFUA 2UKDA 3M6AA 2IHBA 5EE5B 1Z0IA 5DIFA 5JJKA 4FMBB 3ZIAD 4O0MA 3IO5A 4DDWA 2ZREA 3RC8A 4Q1EA 5F9FA 3FOZA 4IFBA 2WOJA 2QMHA 5D3MB 3EWAA 4Q1AA 2J0VA 4LSGA 2RGGA 4UNPA 2Q6TA 3B60A 2IS6A 5FBWB 1ZIOA 3ND9A 4JSTA 4KAXA 3TK1A 4B6EA 1W36B 4CEHA 4JLVA 2PMKA 1E79D 1SVOA 1K5DA 5SZIA 1OFTA 1HH4A 2J7PD 1LFDB 2Z5FA 2CVHA 4LHWA 4TQAA 5FPKA 2E87A 2J3EA 4G1UC 4OHWA 3KQUA 4AC9A 3TW8B 1Z83A 4A0FA 4LHZA 1DAKA 1FP6A 1EFTA 2CMKA 3EA5A 3FYHA 2G9NA 3P4YA 3WRXC 1US8B 4L4UA 1CJTC 5FR1A 5CIQA 1Z22A 3K8YA 5FR2A 5TB5A 4QGHA 4JSYA 3CLVA 1G5PA 1JBKA 5LD2C 2BHRA 4LWZA 2ZYUX 5HKKA 1C1YA 3PUWA 1Q1BA 4M53A 1W49A 3U44A 3UK6A 3KFXA 2EFHB 2DR3A 1OB5A 1YRBA 2OAP1 4BLTA 3Q5EA 4BFXA 4BLOA 1S3SA 2FNAA 1A5TA 1GKUB 2H7VA 1KHTA 3NTUA 4HLDA 1W47A 4WBSA 5BN5A 2O8EB 1G6OA 1R7RA 1VG1A 2AD5A 4RSGA 3LLUA 2C8VA 1F5NA 2QENA 1SGWA 3P32A 2IYXA 1U0LA 2K5UA 3AP3A 2FX3A 721PA 4NTZA 2O52A 4R2IA 1TAGA 3SJAA 4NMMA 2OILA 1E0JA 1PUIA 3AB3A 4HAWA 2FEMA 1ETUA 1E69A 2BV3A 2H57A 1CTQA 3ZVMA 2SHKA 1G17A 1QVAA 1TU4A 3U5ZB 4Q4AB 1KSGA 3AVOA 5BQ5A 4LV8B 1UDXA 1Z5ZA 3MWJA 2GBLA 3AF0A 2Q9CA 1WDTA 4LJAA 5DNYB 2X8AA 4ARZA 2ZEJA 4RD4A 3GPLA 2R6CA 3QXJA 3RAPR 4B6FA 1Z06A 2WHXA 2KSQA 2A30A 1XNJA 3QG5A 4QM6A 2O8CA 4JBYA 4V0NA 4LJ6A 4D4LA 1S96A 5CB8A 2X2FA 2QTVB 1ZAKA 2O0KA 3GLFB 4CEHB 1KIMA 1HURA 2XNSA 3CX7A 3TAUA 1QVRA 5LB2A 2O8BB 2IXEA 3A4MA 5TVKA 4M4SA 1IY1A 2EYQA 2BBTA 2N1BA 1NBME 3JZMA 4HLUA 4XWAA 3EZ6A 1E4VA 2QPAA 3T5DA 3RS4A 1GKIA 1Z6AA 2J46A 3T1QA 3VHLB 4ZIRA 4MYCA 3I5YA 1J8YF 3MCAA 4FINA 1QRAA 4KSBA 2F55A 4TZ0A 2WJVA 1KDOA 2QMEA 4PC7A 3RWMB 3SEAA 3T61A 1TF2A 1T6NA 4D81A 1Z8FA 2PZEA 4JS0A 2C99A 3QIAA 2O8FA 4DEYA 3CPHA 5JJLA 1L2TA 4MUAA 1ZNZA 2RGXA 3B9QA 2ATVA 2Q9AA 4KYUA 1G21E 5CYPA 2VHUA 4IW3B 3A4LA 3HPRA 3FPAA 1Q1QA 2F1IA 4QGAA 3CH5A 1FOEB 1PVOA 3PITA 4LX0A 5G40A 2GXAA 1A7JA 2BMEA 2XOKD 3OEHD 2QSYA 2GXQA 1YZLA 4NCKA 3KB1A 3WMFA 4OI1A 1Z63A 5AUOB 2NO0A 1CRQA 3CRMA 3BH0A 2ZJOA 2ZXUA 1XFAA 2YYZA 4F93B 3QKUA 1N0UA 1II8A 1IN4A 2QM7A 4PO8A 1D2MA 3KKPA 3W34A 3ZZ0A 2OHFA 4PAMA 2MMGA 3EIEA 4ITRC 5SZHB 5JCZA 1Z08A 3EWSA 2R62A 3AP1A 1IOZA 1KSFX 2F43A 4A2WA 1KK0A 4LJ8A 3RRNA 2N42A 121PA 1AM4D 4WOPA 3RRYA 2B8WA 3I32A 4RVCA 5FFMA 1KJYA 2WV9A 1PV4A 1JQJC 1KO8A 3LX8A 1SKYE 2MMCA 1I4TD 2DBYA 1JPNA 3VNUA 2G77B 1S2MA 3NIBA 1UKEA 4PHGA 1Z0JA 1FQJA 3WBKA 4BFZA 4X8MA 3REFA 5FPYA 5CIWA 1TQ4A 5L3SA 3BFVA 3GEIA 3GQBA 1M1YE 3PUZA 5HE9A 3X1DA 1D5CA 3ZS9A 1GWNA 2JLVA 2PEZA 3KTAA 2FA9A 4MH0R 1NMYA 1T8UA 4V0OA 4RFSA 1Q12A 3OFNA 1P75A 5C2JB 3CZPA 4B75A 3TQCA 2OUKA 2IYQA 3H1TA 4A8JA 1F6BA 5BYKA 4R98A 2IS1A 2QAJA 1T0JB 2ZRJA 4IJMA 3CX6A 4QHYA 1T5IA 5J4YA 2FPMA 2XEXA 3K9NA 1KDTA 1JAIA 1WCV1 2AHOA 2ODNA 2QN6A 4MGZR 4B33A 1W46A 1Z0DA 5AUQA 4EPWA 3U4QA 4DCNA 2RCNA 2GESA 3MWYW 2BBWA 4HYYA 4BFUA 1CULC 3BAFA 2XX3A 4LDJA 5M04A 1D2NA 1EFRD 3IEUA 4LHVA 2IHYA 1GITA 1P2VA 3T34A 3UANA 1OXVA 1HEIA 2XITA 2VQSA 3A1VA 4LZZA 1KI6A 1VCIA 4NYIR 1Z2AA 5A0FA 1DAEA 3AF4A 3E2IA 2WAXA 4RD2A 1ZUNB 2FSHA 2IWRA 5K8UA 3BORA 3CRVA 3IIMA 4TMZA 1U8AA 5CLLA 1LW7A 2BJVA 1TTTA 3KQHA 3W6PA 5TMPA 1W4AA 1FP7A 5EE3A 3LD9A 3BFKA 4A8JB 1VYUA 3EIHA 1L4YA 2RKOA 4HZIA 4QGGA 1JEDA 2D62A 4N3NA 4ZI2A 2G3YA 3DO6A 4QM7A 4I1SA 4WW0A 5JS7A 1ZNXA 4Q7JB 2YV5A 1RC8A 2AKAB 1HV8A 1DE0A 1Y3AA 2FE4A 2MSEB 2R8RA 4CT4B 1QG4A 2JIZA 3QKSB 5HCIA 3BIFA 2XZPA 2PJRA 2FFQA 1X1SA 1ZCBA 3JVUA 1KO4A 5F3WB 3BOSA 3O8DA 3D7MA 3QBVA 1VKJA 1S1CA 3RWOA 1G5TA 5JI3E 4LBVA 3B8HA 3THYB 3O8BA 3RDPA 4UJ5A 3IUYA 5EJEA 2YC2C 3ICEA 2FWRA 2C78A 3DL0A 5CITA 1G7CA 4ESHA 2PCLA 2AFHE 1XCPA 3CO5A 1E9FA 4FMCB 1CS4C 1XCMA 1Z6TA 2WJGA 2W6JA 5JHHB 3FMPB 1XWIA 2JJ1D 2ZS9A 1F2UB 4NYMQ 3K0AA 1M7BA 1B0UA 3NHAA 2NO9A 2W0MA 1E9EA 2WJJA 3PEUA 4DLUA 3TLXA 3SZRA 2DFLA 4EFLA 2DFNA 3PG5A 3GJXC 1KNXA 4A8JC 4PQFA 1DEKA 1E2NA 2NZJA 3OEHA 1IN8A 4CDGA 1TQ6A 4KYIB 5DN6A 4EFNA 2ZRLA 4EIWA 1XZQA 5JEEA 1COWD 1AKYA 2ZRPA 4NL4H 1CIPA 4TL6A 1XXHE 4B3GA 3ASYA 3N70A 2YJTD 3UMFA 2FGJA 4KU4A 4O2RA 2DB3A 3ZS8A 2GF9A 2WIAA 4R9UC 2CEAA 4ON9A 3ZDQA 2DWOA 2RHMA 5C46F 1OKKA 2V1UA 1AKEA 4OJQA 1G19A 1MO5A 2I3BA 2YVUA 2D3WA 4YDHB 5FTLA 4Z1MA 3NH6A 3WHKA 5AJWA 1Z07A 4MRSA 5KTYA 2KBFA 3BD9A 1NG9A 1GG2A 3K0CC 3PVSA 4N0DA 5FOUA 1NSTA 4M0LA 1XJQA 3Q7QA 2D74A 3BH7A 1NN0A 4M1WA 1TMKA 1D8TA 2GBLC 2IUSA 1YHNA 2WWFA 1DAMA 5CYOA 2B92A 2ZE7A 1M6NA 1WMSA 2PZGA 3EW9A 1U0JA 4DWJA 2XB4A 4BEBA 1WA5A 2AFIE 1GL9B 4PSKA 4QNRA 4KJZA 1VYTA 4D26A 2DFKB 4YDSA 4ZO4A 4JLDA 4I4LA 1W0JD 4YMVA 3CNNA 4GMDA 4BUJA 1QHNA 4QBHA 3LXXA 2ZI6A 4AYXA 2CLSA 3AKCA 1WP9A 2FN4A 3GLIE 2DPXA 4ARZB 2HV8A 1FQKA 2WWHA 2Q0HA 1AIPA 2A5DA 4FCVA 5TARA 5DI3A 3CH4B 3U7GA 3L0SA 2WWYA 3IPYA 4LC1A 1IY0A 1RJ9B 2IXGA 1G9XA 1GSIA 2FPKA 3BBPA 1AS2A 4TWZA 2OZEA 1J7KA 421PA 4H9GA 4AD8A 5JBQA 1G5RA 2C98A 4FWIB 3KB2A 3LVRE 2YINC 1XTJA 4MGYR 3QY0A 3EPKA 1E2HA 1NMZA 1GNQA 1I2MA 2WAYA 2X19A 3AV0B 4PANA 3K0AB 2EFCB 2NZ8A 4FI3C 4QNMA 3U6KA 2H1LA 1DO2A 2ZI5A 2QP3A 1OYYA 1SULA 2CJWA 5FPSA 1Z0KA 1YZQA 2PEYA 1XMIA 4NPHA 3ZZTA 3C5CA 5EP4A 5HKKD 1YJ5A 3TKLA 4XSHA 2JJ8A 2JLUA 3KKNA 4HLCA 3VU9B 2CL7X 1R8QA 1FX0B 1X8LA 4LJYA 4DLTA 1S8FA 4FMDF 3THYA 5FOWA 3X1XA 4BLQA 3MMPA 2GK7A 3ASZA 3BFXA 4Q4HA 1OH8A 3QI2A 2JLZA 4G5SA 2Z0MA 3X1ZA 1RRFA 1VCNA 4JLPA 1E94E 4D0GA 3M1IA 3RNLA 2QI9C 2A5YB 1G7SA 4PC6A 2FH5B 2UZIR 4AK9A 1AJEA 1YZUA 3PCRB 5EP2A 5LD2B 5C4MA 3BK7A 2FJUA 1TEVA 3R8CA 3V4FA 2GJ8A 2B6HA 4DCVA 2J41A 4CVNA 1ESMA 3SNHA 3REGA 1O87A 1MOZA 1T91A 4Q1DA 2IEYA 3KX2A 4EJSC 1E96A 1P2SA 1QHIA 1CEEA 5KUTA 4BLSA 1OFHA 4BECA 3CNOA 3DZ8A 4Q1FA 1N6KA 4P4SB 3B82A 2P0EA 5C1BA 4URVR 4V02A 3QJYA 4DHEA 2JA1A 4PPNA 4MUBA 3HDTA 5E95A 3C15C 5FL7A 2EWVA 4OHVA 3E1SA 4QBFA 5AJVB 2ZIAA 4U5XA 2OCBA 3R9WA 2J1LA 1RYHA 2XJ9A 4C0SA 1EGAA 1HTWA 4HAYA 2QE7D 4OJKA 3SDZA 5AR1A 4ACAA 3ZYCA 1KMHB 3X1YA 1QHGA 2ZROA 1II8B 2WPDA 2YC4C 3GD7A 4X8LA 5L8VA 1R8SA 3R9IA 3WNBA 1P2TA 3WYGA 5G41A 1XTKA 4E09A 4XVRA 4QJ4A 3GP8A 2A78A 2IWHA 3UMSA 4IDQA 3L82B 4BZQA 1BYUA 4NYJR 3TIFA 1OB2A 3RSOA 2Q3MA 5JI2E 2O8DA 3OZXA 1E0SA 1CRPA 3BJIC 2ERXA 2ZANA 1A2BA 4PC2A 3CR7A 2C9CA 2IUUA 5GVSA 2ZPTX 1M7HA 3I61A 4A92A 4MYTA 3B6EA 5L3QA 5EE0A 1WBBA 2WICA 4OHZA 1OH6A 3IILA 3WYAA 3FKSA 5JZVA 4S2EA 4TTPA 3U3OA 2NG1A 3BH6A 2CHVA 4ASUA 2PMDA 4EFMA 4PO1A 3TUIC 1IAQA 1R2QA 2VHJA 3SE0A 3SFZA 4L15A 4KXFB 1L7VC 2WMNB 1N5KA 1DAIA 1KDPA 2KJQA 4A2QA 5FUXA 1XMVA 1VIAA 3BWDD 3MUFA 1R4AA 2GILA 4BFTA 2VP9A 2ZQ5A 3CPJB 4G5QA 1SHZA 4OQXA 4JIMA 2P2LA 5KU1A 3KL4A 3FMIA 1DVRA 1PLLA 1ZRHA 4PAOA 3VR4A 3AVUA 3QVVA 4BASA 3O47A 2QNRA 4Q02A 2OE2A 5L3QB 3GJ5A 4EPYA 5E7MA 3D8BA 3QPUA 2XNDD 2O8CB 2D7CA 2ORIA 5HZHA 4BFVA 3QKSA 1JAHA 2WKRA 4FXPA 4KSCA 1U2RA 1W0JA 3ZQ6A 5JECA 2F7SA 4Q21A 2FSGA 2VTKA 3AVPA 3CBQA 4HB2A 1YR8A 1XEWX 1UBCA 2EQBA 2F3TA 4RCYA 2MSCB 2PCJA 2QBYA 2GAAA 2Q21A 3DMDA 5CM9C 5HCNA 1W2HA 2WWGA 4KFRA 3PV0A 4KLNA 4C0AC 4G5RA 4M1OA 1AK2A 2P6UA 1W44A 2ZETA 4HEJA 4R7ZA 2RB4A 1IHUA 1ZM2A 4CT5A 2GZHA 2ZM5A 4TLAA 1P61B 4MITA 1YR7A 3NBZC 4MKGA 1UKZA 4ZI3A 1NL3A 2O8EA 2FSIA 3ND8A 3W8NA 4LGMA 2AXPA 3RS7A 3MAAC 2ZJYA 1FL9A 1NKSA 2LWIA 3OIYA 3WYFA 3NBFA 3T1TA 2JGNA 3NEJA 4R2HA 1Q1EA 2BMDA 3GFOA 2KWIA 1IJFA 5GADl 5K8TA 2ZJBA 1MRNA 1RRCA 4OBEA 3LWNA 4RD0A 2WMOB 4QC2A 4PZYA 5KDOA 3BRWD 3DM5A 4GNKA 4KFTA 2ZSDA 1P3JA 3IQWA 1EFUA 1ZM3A 5DYIA 1ZM9A 2OT3B 2G1KA 1YZTA 1KSJA 1MABB 1UM8A 3CM0A 4GMXA 4FWTA 4NBSA 1G8HA 5L3VA 2ORVA 1G7TA 1M8PA 1S0UA 1IN5A 2GCOA 2FF7A 2V54A 3L2OB 4Q18A 4US0R 5FTJA 3EASA 1T3SA 2Q9BA 2Z43A 3F5FA 5G3ZA 3RHFA 1HQYE 2PX0A 2ZJZA 1U90A 3QEOA 4Z51A 4ZDWA 4LUCA 2F3RA 2OFOA 2GK6A 4DCTA 4ACBA 3AUXA 1CR0A 5DHFA 4RD6A 1E9DA 1JR3E 2IL1A 2C9YA 4Q9IA 3FE2A 1XTRA 3VKHA 2GHIA 2ATXA 2Z6VA 5IK2A 5B2ZA 1S3GA 1XTIA 1AQYA 1LS6A 2ODBA 2R65A 2ZRGA 4Q1CA 1JR6A 4Z54A 1W36C 4CEJA 1W0KA 2JCSA 4KODA 3F0TA 4DDUA 4A36A 4DIDA 4GI7A 3SS8A 1KI4A 2BKUA 1MRSA 1LY1A 2QRZA 3W9YA 5CJPA 4B44A 2ZJ8A 1GUAA 3RS2A 1EWQA 3VNVA 1N6OA 1XXHA 1WRBA 5EXTA 3SBDA 4ASUD 3BB3A 1XEXA 4M1KA 4WAUA 2PJZA 4DUGA 2EVWX 3AKYA 1AS0A 1TU3A 4Q48A 2PL3A 2LKCA 4BEJA 3KXIA 1UEIA 2V9PA 1FPMA 3VX3A 4EPTA 1DS6A 4TYNA 4A15A 2CDNA 1TADA 2ZI4A 1A4RA 2ZS8A 3KKOA 3WP1B 3KQKA 1KI2A 2E1RA 3GJ8A 4JVLA 1VHLA 2ZJAA 3X1WA 2J59A 5E4FA 2P6NA 4B76A 3EPHA 1NBMA 1SXJE 2IEZA 1OIXA 1UKYA 4XD7D 4AYTA 3QG1A 4JLOA 3WMGA 4PC3A 1KZ7B 4O3MA 5F9HA 4MYUA 4IOJA 1JEEA 1GFIA 3CF2A 3NG1A 2LKDA 1P7CA 5ELXA 2AD1A 2J0SA 3W3ZB 8OHMA 1E9RA 4OK3A 4XTCS 2IYRA 1N6PA 2RGDA 1CJUC 1CLUA 5IRCD 3RABA 2Q3FA 1UJ2A 4LV5B 1NIPA 4ZIRB 2PBRA 2FZ4A 3K0FB 3IBYA 2D06A 3LLMA 3ZVNA 2ZE8A 3AUYA 5H8WA 3I3SR 2QT1A 1VG0B 2ZSBA 3D31A 4RY2A 4URZR 3TR0A 3QSYA 1I4DD 3E5HA 1XEFA 2V7QA 2P5TB 2XSZD 5HPYB 3H86A 3H84A 4L16A 1CJKC 1OIVA 2AK3A 5KSZA 4WZAE 1FZQA 1A82A 1KAOA 4AY2A 2V55B 3K53A 3TAHA 3KUDA 3SQWA 1OPXA 2H5EA 2O0JA 2JDID 2BMJA 3K9GA 1NJGA 1YRAA 2AWNA 2PLFA 2D2FA 3K0EA 3KJGA 3G5UA 4F91B 3C5HA 1K6MA 1OHHD 5CM8B 1Z0FA 1RFLA 1OSNA 3U2QA 3AM1A 3EC2A 3LBHA 4GZLA 1XXHB 3GJ6A 3PJRA 1NN1A 1XEWY 2IYWA 5SZKB 2ANBA 3LY5A 1P2UA 4KVAA 4WZBE 3K09C 3CX8A 2ZTSA 1KMQA 1BS1A 1ZYUA 2GEUA 4CEJB 5JJIA 4FIDA 4M1TA 3TUZC 2X2EA 5ANRB 3FMOB 4TT3A 3AP2A 2L0XA 2VO1A 1T8TA 2XZOA 1KK2A 1QF9A 1UBGA 3UATA 1GRRA 2QEQA 4OQFA 1IM2A 4Q7KA 1E1QA 2BKEA 4XVUA 3X2SA 4EKDA 4B73A 5J4KA 1SVKA 4JLKA 4L5BA 3ADKA 3IHWA 4URWR 1JPJA 4OK6A 1N0VC 4LRWA 2F1JA 3K70D 5EUMA 3C14C 4OYHA 5EQTA 2XAUA 4EQ6B 1UADA 3E70C 1F2TA 4IVPA 4QG7A 3BERA 5CK4A 1OXXK 2ZI9A 4FN5A 4JVSB 2FDCA 2VHTA 3TSWA 4RZUA 4TLEA 2CE2X 5AJZA 4DDVA 3GLFE 1HUQA 4PXAA 3IHLA 4UXJA 5IDVA 4B34A 3OF5A 4LY6A 4US2R 3BGWA 2CNWA 4NHOA 5E7JA 4II7A 3Q3JB 3T06B 2C03A 4Q1BA 4D6PA 4JL8A 4MQBA 2IYYA 2J45A 3IKJA 3AGQA 3L0IB 3TVDA 2NOAA 1KI3A 1G3IA 1JALA 1DAGA 4NH0A 1XTQA 2ZVPX 3DPUA 521PA 1KKLA 2GXSA 2I4IA 3LO5A 4X8OA 3FB4A 3T1VA 4F7WA 4M8NE 4DT1B 2C2HA 4PR0A 5AUPB 2VSFA 4LOAA 4RJLA 1VCOA 1XB2A 4AKGA 1RYFA 1AZSC 4A6PA 4CZ2A 1CKEA 1MH1A 4DLVA 3GLHA 2XGJA 4JLAA 4IRUB 2VIIA 3B78A 3FWYA 1MR3F 2OCAA 3EPLA 5F98A 1KNQA 2C9OA 1P9WA 2NPFA 5BWMA 4PO9A 2ZRBA 1OXSC 4HZUA 5JSZA 4IDPA 3GFTA 3KXKA 2CE7A 2CK3A 1Q57A 4A82A 1KDRA 3GJ0A 3SJBA 3FHOA 1U98A 3NDPA 2BOVA 1BOFA 2RMKA 2AKYA 1SVIA 4QFMA 2N46A 2WZQA 1XRJA 4DZZA 3CRW1 2FPLA 3F8TA 4XD7A 3Q9LA 4DLZA 5B64A 1TNDA 1D6JA 5AUNB 1V5WA 3R9XA 4HB0A 1U0HC 4G5GA 2IF2A 2IYSA 3H4MA 4G01B 4BZPA 4KV9A 1HT2E 3UXMA 4B3BA 2XXAA 1E99A 4GP7A 1BO6A 4Y0VA 3HJNA 2OFWA 2EYUA 3DEFA 3Q5DA 4ZPXA 1WB9A 2P5SA 1COWA 1U81A 2ZYWX 5KSOA 4AURA 1GIAA 1G1MA 2HEIA 3HU2A 3I1FA 1G8YA 1U9IA 2OFXA 3C7KA 3IQXA 1OFUX 3WXMA 1D9ZA 4JBXA 4B3DA 3LVQE 1JI0A 1GAJA 4LYFA 2REXB 3NXSA 2W58A 2IK8A 3GCGA 1D2EA 2OESA 3U3MA 5CLQA 4ZDKA 1E2EA 1G8GA 3CR8A 2A2ZA 4QJ5A 1LF0A 1II0A 4IVQA 3TE6A 3R7WA 2HCBA 1E4YA 1ANKA 1H8ED 1JJVA 3ZGXA 5GVRA 4YMUA 2XZLA 2RGEA 3TVTA 4B2PA 1KZGB 4TMWA 2H8KA 4A9AA 4C4PA 2CCGA 3I8XA 3AGPA 1GOTA 2EFEB 4PQYA 3B7GA 2OBNA 4CF7A 3TGPA 1E2MA 5DGXA 3MJHA 4LHXA 2W2TA 3LV8A 3R7WB 2BBSA 4E03A 2CCKA 3LRPA 3CNLA 4KBFA 3AH8A 3HR7A 4I81A 2OBMA 1HY3A 4HAUA 2ZITA 3EPJA 2JATA 1NG1A 3K1JA 4US1R 5EP1A 4LYJA 3L8ZA 2GZAA 3KJEA 2RGAA 2GKSA 5CB6A 2WBLC 2VLIA 3QNUA 2GVDC 1BIFA 4TL7A 4N1AA 1X3SA 1NN5A 1KI7A 1SVMA 1MKYA 5FUYA 1TPZA 1GILA 4MGKR 1CJVC 5IF9A 4DB2A 2P67A 1U94A 1UF9A 1GVNB 5AK0A 3DDCA 2C04A 4KHZA 3L8YA 4K46A 1NY5A 2G88A 2O5VA 3HWSA 2ONJA 3VR5A 3K70C 3DOFA 2GF0A 3VR2A 5TXGA 2ZSEA 1IN7A 4TT3D 4LV6A 3LA6A 2O8DB 5B57C 4C0QC 2OXRA 3B5JA 1XMSA 2HXSA 3OESA 3OEEA 2XXAB 1E1RA 2BCGY 2ZRCA 4AIIA 3QPVA 4P4TA 1NI3A 1P9NA 4ZCIA 1H8HD 3VAAA 3ETLA 2B8TA 1LVGA 2JJ2A 1RW4A 3AQ4A 4NP6A 4Q4JA 1XD2A 3ADDA 4B3XA 4KO8A 1U9IC 2W6ID 3QF7A 5HE8A 1D9XA 4JYCA 2GJSA 4NCHA 2AN9A 2ECKA 2RH5A 3LFUA 2ZU6A 4M1YA 2KB0A 4DEXA 1O3YA 2FFBA 4LI0A 4MGIR 3FDIA 1BMFD 4LJ5A 5DHAA 1E2LA 2GTPA 1NSFA 3M4YA 1Z3IX 4MRVA 2PLRA 3RVBA 2ZI3A 3THOA 3VU9A 3EZ7A 1P72A 1F2TB 1BH2A 1G18A 2QZ4A 1KKMA 1M7GA 3A4NA 2AWOA 3A37A 4D0NA 4Q03A 2ZSFA 4UXIA 1J99A 2I1VB 4CGZA 3AVWA 4G0NA 5KHOC 2H18A 4WZ6A 5HZKA 4QBGB 2GVZC 4HUQA 2C95A 2X1VA 4XOIA 5H70A 4LC0A 4W5WA 1NVVQ 3B1XA 4PFSA 2EW1A 1EXMA 1SZPA 2XTNA 5IK2D 2GCOB 2B7BA 4TMVA 4YXWD 3NWJA 5FI1B 3CRRA 1MABA 2QBYB 3AF1A 4TLBA 3IBGA 4PZZA 3UG6A 4MA4A 4U00A 1LTQA 4Q7LA 5DI3B 1OT3A 3DZDA 2HF8A 2YOGA 5G53C 2V4ZA 4HDQB 4IDOA 1MO6A 2BMFA 1SHKA 1K8RA 4LBZA 2ZRFA 1FMJA 4CEIB 2IT1A 2ZUDA 1E3MA 4MKFA 4NDZA 2ZYVX 4IFEA 2CBZA 2FOLA 1P62B 3SR0A 4IOKA 1VPLA 3MWKA 2YHSA 2WSSD 1R0WA 2R6FA 2ZI7A 4OHXA 5FBRB 4L8GA 1XU4A 2BVNA 1DPFA 4C30A 2QMOA 3QUSA 4D0LB 2WPDD 2QP4A 4NONA 4C3ZA 2QL6A 3TBKA 3RS3A 2RGNA 3OAAA 4RKEA 1VTKA 2J0UA 2PZFA 4IVRA 1M74A 1LB1B 2QG6A 4GSYA 4RCZA 3TUJC 3HP1A 1Z29A 4E07A 3THXA 4IXNA 4OI2A 1W48A 1NN3A 5FL7D 1NLFA 1YZKA 2NO7A 3ZZUA 3W8RA 5B30A 2Z4SA 3UIEA 2V3CC 3RLFA 3D3QA 1H8EA 1QHHB 2V1XA 3GLGA 1HT1E 3W6OA 5FI0B 3QXHA 4DKXA 2R9VA 1SVWA 2GJKA 3SOPA 1E2FA 2W83A 1ZD9A 3MRSA 4GFDA 1E2KA 1XD8A 1G41A 2IA5A 3TQFA 2YKGA 5JEDA 3FMFA 2OCPA 2RGCA 1XPUA 1T4GA 3LQQA 1MO3A 3GJ7A 2HYIC 4C0KA 3TH5A 3SBEA 2FMXA 1B23P 2J87A 4JBWA 2YOFA 3RS0A 3ZIAA 2Q3HA 3THXB 4FW9A 3OAAD 1NIJA 2REOA 4TYQA 4I1OA 3ZD6A 5BN3A 3PEWA 1Z6YA 1KMHA 1X1RA 2ZUBA 3SU8A 4W7SA 4ZV4A 2A9KA 2ZUCA 1PJRA 2CL0X 2AXNA 1KO1A 3NC1C 3P27A 1AZTA 2QROA 1NKTA 4AWXA 1YQTA 4OQMA 5IT5A 3B1ZA 3MLEA 3V9PA 3AVTA 1GTVA 2HYDA 2GDJA 4ZCLA 2A7QA 2BDTA 2FGKA 3IO3A 1JQLB 3KKMA 4M9QA 2CXXA 1TX4B 4YMSA 2VHQA 3U3JA 3RRZA 4Q7MB 3QXCA 1RKBA 4BLRA 4DB4A 4EAQA 1N0WA 4GT1A 4F4CA 2EU8A 3IGFA 1E0KA 1W1WA 4U02A 4JLNA 5DO9A 1U8YA 3VFDA 4NYIQ 2JLXA 4RKFA 2QRNA 1N6IA 2YNMA 2HT1A 2IYLD 4MYHA 4C0BA 3SJZA 2ZYTX 4Q66C 1G8PA 4CIDA 4DSTA 1FTNA 3VR6A 4V0LA 1N5IA 4BRUA 4AYWA 1GRQA 1P4SA 4P33A 4DDTA 1F48A 3ZH9B 1N6NA 2EFDB 1KO7A 3VQTA 2WTUA 5DYGA 2V6JA 5EXSA 4DSNA 4HB3A 4M9ZA 3T5GA 4TN1A 3SFVA 1E79A 2TMKA 1KI6B 2GJ9A 4Q4HB 2GAOA 3LW7A 1BMFA 3FHTA 4AI6A 2C96A 3HYTA 4HSEA 4HZUB 3J81k 3WNDA 4XWKA 2VH5R 4EUNA 3W5IA 3K70B 5A4JA 4R71A 2WIBA 2EWWA 2QT0A 2W00A 3DMNA 4KCGA 4QKQA 1FNMA 3U3RA 3T1OA 1IY2A 2V8OA 2ASEA 4LPKA 4O2LA 1J2JA 1T0HB 2GCNA 3GLIA 5K8IA 2EFGA 3V00A 2IUTA 5FPHA 1ZD8A 3NHBA 2JJ2D 4JLMA 4JMPA 3QKRA 1U8ZA 1DO0A 1G64A 4MRNA 3QENA 5DH9A 4DLXA 4QXAA 4LJ9A 4NCIA 2WWXA 3OEED 3GJ3A 4DT1A 4BFYA 2QGZA 5E3HA 5FBVB 3IIJA 3FKSD 3W5JA 1S4QA 4EPXA 1PZNA 5KYKA 3EA0A 4KVGA 1CP2A 5EXXA 1FTSA 3B1YA 4QL3A 1Z28A 1TQDA 1L4UA 4TSFA 1Q3HA 5JFGA 5EUQB 1ZIPA 4EPRA 4FCTA 2LCFA 4HAXA 5FTNA 4YMWA 3DOEA 3THWA 1NLZA 3W3AA 3TJZA 2RGBA 1P73A 4TLDA 2OLKA 3ZJYA 1NNEA 2NO1A 3U7HB 2CLDX 5E7IA 2JLWA 4D4JA 2F1RA 3U6BA 1M34E 2PT5A 3AVXA 1SVSA 4U7DA 3GFPA 4EQ6A 3U7FB 3VX4A 2BM1A 4M22A 1A2KC 3P4XA 1YKSA 3D6TB 1OV4A 1NF3A 4TMTA 1NP6A 1F3OA 1OE0A 4M2LA 1DADA 3UG7A 4YC7A 1JJ7A 4TSFD 2R44A 2CHGA 3A1TA 1N5JA 1Z2CA 2VYFA 4TYYA 3CRQA 2VRWA 5FOVA 5GJVC 3S1AB 2ZR0A 1GNRA 3NC0C 1RJ9A 1KJWA 2ZSAA 4NE2A 4DSUA 1E9SA 3B1WA 1IXZA 4RFSB 4JT2A 4WA7A 5KO2A 1XCGB 4TLCA 5FOSA 2F9LA 4BLPA 2JLYA 1XF9A 1YU9A 2YWEA 1C4OA 3PXGA 2PT7A 4TYPA 2XSZA 4LYAA 4XWOA 1BYIA 3ADCA 3ICQB 1SXJA 1C9KA 5J47A 2GRJA 2F6RA 4HUTA 4ABYA 2ANCA 1R6BX 2BJWA 2PH1A 2O8FB 5FUVA 1Q20A 2HXYA 1GDDA 2IS2A 2CHQA 3JZAA 5KNDA 1W5SA 4ERNA 5C18A 1UFQA 2W2XA 5AJXA 1VHTA 1VYVA 2ZRKA 4NZYA 1ZM4A 1QZXA 3S1AA 2J0UB 5CDFE 1OH7A 2GEDA 1FUKA 2AX4A 4F4JA 4LJ7A 1RE0A 3K0SA 2BWJA 2WKQA 5K8LA 1OFIA 4UQOA 3K0FA 2V7QD 1E9AA 1VG9B 3I8SA 5JWOA 5LBIA 3GEHA 2O8BA 2ZRHA 1N3BA 3C16C 1E2IA 1VMAA 4JLBA 3EG5A 4Q9LA 5FTKA 2QY9A 3EC1A 5D3QA 3U3KA 4W5HA 1TEXA 2WKPA 3EAQA 2FG5A 2OXCA 4NCNA 3CF0A 5J4VA 1T9HA 3UMRA 2ZRAA 4CEIA 1WE2A 5DISB 1YVDA 4OK5A 3SHFA 4P4UA 3A36A 3T35A 5KSYA 2DWQA 2JASA 4EJSA 1KTVA 4HDOB 3L0OA 1HA3A 2QUZA 1XJ0A 1T3LA 1G6HA 2QMUA 2QQEA 4ILEA 5J5CA 5LDDC 5H68A 3U7EB 2FSFA 2WJIA 4Z8XA 1ZJ6A 2R2AA 3FVQA 3MG9A 2QPOA 1QHHA 3CWZA 1VCMA 3MGCA 4Z8YA 3RC3A 3CKLA 1S9DA 2JEOA 5P21A 3B2EA 4HUQB 3C8UA 3CB4A 1AS3A 1ZC3A 2ZJ2A 5JSZB 2J7PA 4RD1A 3BB4A 5DI9A 2A5JA 2ZS7A 1KGDA 1Z6GA 1F2UA 2RGNC 4RZ3A 2ZE6A 5KDDA 3U60B 5HTKA 4PPQA 4C7OB 1E98A 1UDWA 1ZU4A 2GETA 4E5UA 3NEYA 4HLUC 4IDHA 3GLHB 1DOAA 3U44B 3N2EA 4FD2A 4HATA 3QE0A 1OLOA 4TYWA
chains in the Genus database with same CATH superfamily
3BL5A 3G5LA 2QUIA 1HC7A 3UJBA 5HQ3B 2YWHA 4B3HA 4MVJG 2RAVA 3GLFA 4FW8A 3T9AA 3W6ZA 3JQ7A 3PGKA 4PZLA 4ZVKA 4L2IB 3V9AA 3N76A 4DQLA 3G0OA 4EF6A 4P4SA 1TJ3A 1UKCA 3L43A 1SU7A 1DSSG 3KYDA 1ENZA 1XD2B 1MXFA 1ZS9A 2XD4A 3H9UA 1H4SA 4XGNA 3RD5A 1R0RE 4M9CA 4OOFA 3Q3EA 4YUWA 2HLDD 1U2QA 5DWVA 1FF9A 1R0BA 1G3UA 2CL6X 4GI2A 4GXNA 4L51A 2HIAA 1T0UA 4NOMA 4PSVA 1KRXA 2QKYA 4UD6A 4YK7A 5G40A 4LYHA 1IOVA 2GHQA 2XB2A 4J3FA 4Q4AA 4MMXB 4X7RA 5JWHA 2DLDA 4UMDA 1AGRA 1TUBB 2D1FA 4OI4A 5AKLA 3SXUA 2YBDA 2EC5A 3UT5B 3KDSE 4BV8A 5ABPA 3TLYA 5M5BA 4TWIA 1EHYA 2QU8A 3Q7TA 4B5LA 1J2RA 3PDWA 4BYMA 4RM3A 3VHQA 1DIGA 4A92A 1ZMBA 4JELA 3PFIA 5EJAA 3JQ8A 4HR7A 4LBYA 5K01A 1JJAA 3LBIA 1UXHA 2GCPA 5K20A 1XKLA 1GSOA 3MTIA 4Y0AA 1E6MA 2YUIA 4V0ME 1WBDA 1CUXA 4BNHA 1SPBS 1UXIA 4INAA 3EX7C 5DK4A 5IJ9A 4RPLA 3BE5A 3C3WA 4DIBA 2HDWA 2IXTA 2VBCA 1FQWA 1VDMA 2A9PA 4F45A 1EDBA 2VHCA 2BISA 3FHJA 4WZAB 5DLQC 5I51A 2W2VA 1ZQ9A 2ZXFA 1YO6A 2ADFA 4J94A 4WVFA 4AG6A 3FNBA 1YVRA 5T41A 1VDZA 1IXRC 3K5PA 1RRPA 3WLMA 3KXPA 1TECE 1P19A 4AKIA 4HDCA 5CYGA 5KTRA 4I8DA 4QVKA 4ZGBA 3KZMA 3KS9A 2IBMA 5TQ2B 1ISPA 4FN4A 5JVDB 4CRWB 1ICIA 3CMCO 2IV3A 4C9BA 5K0ZA 1QTQA 1DIOB 1LF5A 4WDQA 5HEKA 3BMQB 3NEAA 2FKNA 2ZATA 2E9SA 2QRUA 2ZYIA 3P1JA 3PYMA 4YRCA 1E8MA 1M2VA 2N47A 1D3AA 3K5IA 4YXWA 4GOKA 1LVUA 4D57A 1CU1A 1HFEL 1LWOA 3Q8WA 2E5FA 2WM9B 5DWQA 3EZ9A 3NVAA 4D97A 4ZYXA 1G4AE 1HSOA 2HB6A 3RVQA 4CM9D 1SXJC 5AXAA 2OQRA 2I6GA 4BGDA 4B47A 1NWCA 3A9UA 1C9DB 3GC6A 4HX2A 5FKJA 3G8CA 4BX3A 5JBIA 1V11B 2Q3JA 3KUKA 2MINB 2Y2VA 4BVGA 4D96A 3W90A 2Z3ZA 4IV5A 3HABA 2HA3A 4EO9A 1CR1A 3WGUA 4H1WA 4KITB 3GEEA 3PQ8A 3O9ZA 3BMOB 4P0TA 4BWYA 4RD3A 1ZD5A 3E9EA 4X8HA 3K8QA 3IFSA 3BILA 2YCBA 3AR2A 1YCDA 1HE2A 2O1WA 1DU4A 1L1EA 1TMYA 3C3EA 3MLBA 3QBTA 3EWNA 3KZNA 1HK7A 3RUDA 4BKRA 5IKPA 1AHIA 3A2LA 4KBGA 2ZWPA 4TXJA 3Q85A 2PRSA 1TYZA 1WF3A 3UQZA 2J9XB 4F72A 1WCXA 3A32A 3HUFA 5ALEA 4B48A 4C7KA 3O74A 5K3DA 4PN3A 4QJ3A 1MC1A 2D4AA 5C1DA 3C8ZA 1WSDA 3C8HA 3AEXA 4QQRA 4DS3A 5IMSA 2I7TA 1BD3A 2GWHA 3GWZA 4XCVA 4XQGA 4Y6OA 4QYIB 5F51A 2O3SA 4WWHA 2DAPA 3AESA 4G4SP 5AJYA 4HI0E 2F59A 1CY0A 3GMIA 2ACWA 2DY0A 2JBAB 4GP6A 3UWKA 5C52B 1I10A 1FLDA 1V0JA 2CNKA 4R9NA 5I7WA 3ONDA 3JU3A 3C39A 3QOYA 3HYRA 4Z9FA 5F77A 1Q22A 3CJTA 3RBXA 4AKEA 1GLNA 1DJOA 3A10A 5EP3A 4FYVA 3CNQS 1LNZA 4R0NA 5FD8A 2BGRA 1V1MA 1UFKA 2NGRA 2X41A 3RUHA 3KOMA 3DLHA 2GB4A 2YV2A 4WI1A 3WSVA 3RVSA 821PA 2Q46A 5IU6A 3N7UA 2ILTA 3AUSA 5JQGA 5IM4A 1LFAA 1NJFA 3MJTA 3O8OB 1OKKD 3BDVA 4XLTA 4LDZA 3TZBA 4JI6B 1WXDA 2G28A 1GV0A 4CNBA 3DEYX 4LG1A 5TPZD 5KOHA 4U8GA 3I5UA 1KQ3A 1QUFA 2WHQA 4ND1A 5CX1B 1SUDA 1BE0A 3OWXA 3TTUA 2O1EA 3E4CA 4IRXA 4GPTA 1XZ8A 2ZRMA 4BUZA 2BMWA 3GPDG 3KHUA 2I6FA 5H1YA 1I9CA 1NVVR 1PUJA 2UUBB 3Q7RA 4YCBA 2WAOA 4Q47A 9MHTA 3JS5A 1H0SA 1AUPA 3BB1A 1DEHA 1E6UA 1MB2A 1IZYA 4FNGA 3IURA 3D7NA 2JLRA 4JCOA 3AWIA 2AYZA 3BZUA 1KJQA 3MINA 2EKQA 4CT0A 2D4HA 3TRKA 3WYCA 1U2DC 3HNPA 3W5UA 4MDFA 3UAYA 2ZBVA 4MS1A 2LDXA 2FLWA 3CJRA 3R0ZA 3GG9A 5IJ9B 1KL7A 3GLHE 3FNQA 4R1NA 3Q8XB 4MQEB 4V03A 5CT6A 2E4XA 2D59A 2BONA 3AI1A 1H8HA 3EIUA 1IAVA 3ZOKA 3KQYA 5JSYA 5KOYA 3FOWA 5MN5A 4L07A 3OLXA 2REQA 1J0EA 5BVGA 3GGSA 4I55B 3PDIA 4YXFA 2AOWA 2AGVA 1HMPA 3INGA 3KCQA 3O83A 5DXJA 2A5GA 4G3XA 5A9TA 1JTVA 1TM1E 1U0SY 1FW6A 1Z0UA 3R3UA 1AV7A 4FHGA 3IIKA 3QBEA 1SMKA 3EVDA 3C8MA 4PY2A 1LVHA 1Z4QA 5LP1A 3K09A 4II2A 2VPPA 4LCEA 1P7PA 5BV1A 1C81A 2HLPA 1YZNA 3JASA 1A9SA 1XNGA 3K6RA 1V6AA 3GEDA 5SZJA 4CQNA 4OKIA 3V4ZA 3DDWA 1I5OA 1ZUWA 3FPKA 4ZOLF 2GXUA 4YAJA 2XQFA 1OAOC 3KEQA 2AH5A 1QP4A 1OC2A 1PJCA 1BWPA 1FFCA 4QXQA 2PGXA 1HYQA 1D2RA 2G36A 3K0HA 2OGSA 3QKRB 4ZQEA 1PG0A 1VJ1A 4C88A 4EB8A 1QVZA 2A1IA 2ECPA 3EGDB 4Z7OB 1Y5LA 5HUJA 3SYLA 1J9ZA 2O0HA 3B52X 3G1WA 3DM9B 5EHIA 5FPPA 3ZQJA 4NZZA 2P2GA 5P8WA 3GNTA 2HTEA 4FOTA 5IULC 2PAFA 3OCCA 1OU4A 2WSMA 4CMEC 3DVLA 3QPWA 4BZXA 1GP2A 3P0HA 2RHJA 3K73O 1Q1ZA 4RPIA 2V59A 5DSZA 1SKQA 4O2AB 2DYKA 1TCCA 3DKKA 4ESEA 1FFHA 4JC4A 3L07A 5K0CA 4IEIA 3W79A 4I3HA 1M72A 1T5LA 2HA0A 3CZQA 4PAQA 4CLOB 3FGNA 1J8VA 1Z73A 1XX6A 4UUQA 5EG5A 4N40A 4MV9A 4RZ2A 3AMVA 3LLVA 4JKIA 4G84A 3KWLA 2BTOA 2FWIA 1UH5A 4MKHA 3C5WP 2JAQA 3ETDA 3PXEA 3QUCA 3GFSA 2HF7A 5BQXA 6Q21A 3N2YA 3C24A 5FAKA 2OV2A 2VF8A 4FDMA 2A4MA 4WN3A 4GKJB 1DCKA 2QAGA 2WWIA 2AZ4A 2NU8A 1BHSA 3FAKA 1R6XA 3CW2A 1OWLA 4LE0A 1JLMA 4JEHA 1QGOA 5D84A 2PGAA 4K03A 4MQUA 4ZJZA 6GPBA 1BQ4A 1Q0ZA 1ZU5A 4UBLA 4AWBA 4AS3A 3SYNA 3LSYA 2P9JA 3AEYA 2VXYA 4GWGA 3SM9A 2XY4A 1P1FA 2Z58A 3PEVA 1T2VA 3Q3IA 2AYXA 4I5DA 4NBNA 1Z6QA 2Q5IA 2QRLA 4XGIA 4Y2UA 3RC9A 2VP6A 3DAGA 1LBEA 2AW5A 3L7YA 3ND6A 5I9NA 4B6SA 4ZU6X 5JZMA 1T4DA 2UDPA 3NKVA 4OYYA 4X97A 1H2EA 4ZO8A 1E2DA 1VQ1A 4BBZA 4F9TA 2R751 1C9EA 2QPTA 4J16C 1J33A 5JFOA 3D0KA 4I4TB 1G3MA 4Z1MD 1UKBA 2I5PO 3C48A 4DYDA 4DSZA 1BEZA 4RDXA 2FXIA 3A4TA 4LPSA 2IS4A 2VTEA 1G3RA 1RIFA 3OQ1A 3LLCA 1UFOA 4L0QA 2G9QA 4MX8A 4Q9KA 3SYKA 5GINE 3OTGA 2ZCJA 1VG8A 2QLLA 5K2MA 4F38A 3LM8A 3ZTTA 4B2IA 2VSXA 1Z4JA 3P2EA 2QRVA 2OLJA 1A96A 4GR9A 4EBBA 4HC4A 1CXZA 2C5FA 1J21A 2F9MA 2JH8A 3DOOA 2VWQA 3LBAA 4G0YA 1NZDA 4IUBS 4KK4A 4R51A 5JZSA 3C3CA 1U8FO 2QIOA 1W2GA 2QM8A 4BQIA 1EVJA 3EDQA 1SXJB 2AOVA 1QBGA 3K2EA 3MTDA 4PYKA 4JUDX 3JYPA 4UCFA 4OXYA 1UFVA 4ZKDA 3UOGA 4YRLA 3AF2A 4URHA 4G2NA 1RNLA 1ISIA 5ALDA 4WLUA 2FWNA 3ESAA 4A27A 1ONBA 3GRFA 4P31A 1B6RA 1CR4A 1U63A 2G0TA 2WKWA 3WRYC 2B5VA 4BE7B 1D4OA 4PG4A 5GGYA 3RREA 3ABOB 1F5SA 1N1EA 1AKMA 5ER6A 1IQPA 4GOOD 4JQCA 3BT7A 3OJLA 3B8EA 1FNNA 3A1EA 4KIGA 4PWYA 1UOOA 5MF6A 3TI9A 4R1UA 1CIJA 1C3EA 1SIOA 2I71A 2J6CA 3EMBA 3VZCA 4F5DA 5G4KB 3B38A 5JRJA 2B1GA 4IJQA 4LN1A 4OB6A 3FTPA 1BN7A 2A0UA 2XYHA 3OTOB 2E0IA 4Q00A 2OG2A 3SGLA 2CCJA 3QFHA 1D0SA 4NFYA 3CIFA 4XTRA 3EUAA 1DGQA 3FNFA 4KBFA 5ITSA 1ECFA 2OCYC 3KCNA 2BDEA 4LJ4A 1AKWA 1KRHA 4PPFA 1HLDA 2KM1A 2I76A 4M54A 3LXRA 3WIOA 4KQFA 1LSUA 2H9AA 5JO0A 3EEFA 2H7CA 4EYOA 2YXLA 4D80A 1RZ3A 3RHZA 2GAIA 2ORYA 2UZ4A 1L7BA 2FR0A 4DCOA 2G8NA 8ATCA 3KOOA 5SYAA 1KH2A 4HP8A 2HN9A 2QYOA 1L5VA 2WUWE 4IXWA 1YS7A 3DKVA 4TL8A 3C3AA 3PR2B 4QXPA 1EG7A 4GPZA 1AGPA 3S5JA 1QDLB 3WVNA 4B85A 5BRJA 1YRHA 2DOKA 2IEAA 2QIPA 1QQ7A 5BNIA 1X19A 2PX3A 2ZK7A 3MCUA 3CUEF 3Q5GA 2JLSA 1BH6A 5I7OA 2UXCB 4C14A 1PJAA 3BTVA 1PR6A 1WD5A 3DEKA 4A6DA 1Y63A 4BEBA 3JVIA 4RLSA 1W4BA 3LAWA 5AVOA 5GONF 4FYKA 2IV2X 3U3DA 1A88A 4EA9A 1H65A 1H3NA 3NUGA 2WE8A 4ALKA 3FDXA 1AB5A 3V4PB 3AVYA 3Q0IA 4ZU3A 2Z4RA 2J4DA 1S2OA 2FU5C 1Y0BA 3W2IA 4FM9A 4ZT7A 2OXFA 5FL3A 4EGAA 2QTFA 2Y0PA 2IPNA 2PJDA 2R79A 4ICIA 4OXRA 3GLIB 5LC1A 1CNFA 2FR1A 4BJ1A 3KQMA 1U3FA 2R8BA 2PX8A 3H0CA 3C6QA 3MILA 4FDTA 4JUAA 2FYTA 1GFWA 2JLBA 5DTMA 3I92A 3Q7PA 5KQMA 1GGKA 4YI5A 1WPQA 2OM2A 1G59A 2EP7A 4NU8X 3R5XA 2H16A 3H5TA 4R3WA 4JZKA 3U4QB 4HD8A 4NKRA 1F60A 3W5HA 3OFKA 5KOHB 2NTVA 2W4QA 5DK6A 5DZSA 3SYTA 2YCLA 2OEPA 4XJXA 3SZUA 4C22A 2D6FA 3O8OA 6CHYA 2II6A 2Z8YA 1Q7BA 1N2HA 4RS4A 4UVHA 4M0PA 4L8FA 4R8KA 5A4MS 2YN0A 4BFWA 4P81A 5LR6A 4PHTA 3K0BA 2ORWA 5A9SB 1B00A 1SIUA 4P8RA 1I51A 1MT0A 3ZGLA 3GGJA 4NXMB 3BBLA 3VO9A 4D3YA 2BGGA 4N03A 3VOAA 5BSFA 1KI8A 2V0GA 2WUFA 4I50A 3CNHA 4Y1RB 3SQXA 1P1JA 2HWXA 4UPDA 1U7UA 5AQEA 1YK1A 5E9QA 3RFUA 3AJEA 4CMBA 2R7KA 2V6BA 3P20A 3SPXA 1GZ4A 4IHJA 4XVQA 4C01A 5ITVA 2XJ4A 5DBHX 4DRXB 4K9SA 1K0UA 3NQ41 4G0UA 3WYBA 2A9RA 2Q4EA 4QOSA 3LY8A 2BM8A 1Z0ZA 3HWWA 1HDIA 4MS1B 2RK4A 3HVUA 1BKDR 4M0MA 4REMA 5EZ5A 1J90A 5DE3A 1KEPA 4MB2A 4DWVA 1XJ5A 1MLDA 5FV4A 1SOUA 3PNVA 2ZYRA 4Q5IA 2D8MA 3IEXA 4B43A 3Q0TA 5KDLA 1Y8QA 3R9KA 1ZUIA 1JRLA 7REQB 2Y77A 5THXA 5BN4A 4OJTA 1P3Y1 4V0SA 3H1GA 3UWSA 4E1BA 3OJXA 1UQUA 2GHRA 3F5MA 3MSXA 1ESCA 4WNIA 2OO5A 3WL3A 1QHSA 5BYJA 2C0QA 2BGMA 4PW0A 4NHEA 2H52A 1RM4A 1UAAA 5BW4A 2XBMA 3OHPA 1R5OA 3U4DA 4AP6A 4D99A 2B7CA 1BMDA 1XZGA 2J4CA 4K9KA 2IQIA 3DHEA 1YKFA 1LV7A 2KE5A 3K94A 3MK31 2P0YA 1O95A 4KTTE 1DBRA 1UJBA 4BGEA 3NTRA 1OLUB 3ESCA 5KPDA 3LH5A 2WTMA 2Y1GA 3QKWA 1N2ZA 1YT5A 4FFNA 2JIPA 4YGXB 1OYWA 4TQ9A 4ZGWA 1H2YA 3B1FA 1IZ8A 5IM5A 2PD6A 2Z57A 1IPFA 1CJBA 3H9GA 1CDOA 2R8ZA 1UBSB 1OJLA 4OAOA 4W6QA 4K6HA 1JR3A 1T3HA 1TD9A 3K8ZA 2R6AA 4GI1A 3WV5A 3FBTA 2CZCA 1OW3B 2QE7A 1WZNA 3B1VA 1WUYA 3WJ2A 4QXOA 5E6UB 1CNEA 2PS9A 3SSMA 4FFMA 4CYMA 3ROZA 2QTRA 3EZ2A 3E8SA 1NLUA 1GG9A 1W93A 1T25A 1Y1TA 2VOEA 3KJIA 5TV2A 3TBHA 3GT7A 3UT6A 3WLLA 3S4YA 2ZVJA 3O0TA 4JGGA 3FLAA 4IDFA 2IYFA 2R5NA 4TSRA 3OOWA 3AETA 1QQTA 3M6LA 1N33B 5I9MA 2I1QA 3SC2B 3PHGA 2CKMA 3MELA 2HU7A 4HAVA 2Z09A 2WAMA 3IH5A 3VMFA 3ZKAA 2VPQA 1AX9A 4BO1A 2IHBA 3IAHA 2PUDA 5CA1A 3W4IA 2HQRA 1P7ZA 2Q2QA 4DYHA 4O0MA 3FCEA 4L5AA 3IO5A 3PNSA 4X1KA 3SIXA 2ZTMA 3FOZA 1VLQA 5HBRA 5E6SA 3FCUB 4E5SA 1GTG1 5J2TA 3CYFA 5ALQA 2YJGA 3KVVA 3BDAA 4R81A 2ASVA 2Q6TA 1ZGCA 4N6NA 4UNPA 2IS6A 3BF7A 2I78A 3ND9A 4G26A 3OM1A 1Q6YA 2QTVA 4TS1A 1O95C 1JFTA 2PVSA 4BVEA 1SVOA 1RTTA 4KZKA 1K5DA 1NVFA 1E2UA 1O8CA 2P9EA 5C5EA 1LFDB 2CVHA 4FR2A 4QTUB 1PFQA 5E1MA 4BNYA 1RR6A 1ZJJA 2H4ZA 1YDEA 4G1UC 4IDEA 4O4HB 4BC0A 1FFXB 1GPDG 3KQUA 3VH1A 4DCCA 5TPZA 1DAKA 1FP6A 1EFTA 3EA5A 4WD3A 4BVAA 2QD5A 1ZICA 2X8JB 3QNMA 4L4UA 4B8ZA 1CJTC 4AULA 3WAJA 4NEGA 2Y1CA 2WU4A 1ZHOA 4ZEOA 1VL2A 1C3OB 1X80B 3CLVA 4EEKA 1JBKA 1B42A 2BHRA 1NPTO 4LWZA 5EHNA 3TJRA 4EELA 5HRUA 2ZYUX 2QXYA 1OJ7A 1RAFA 4MQEA 3UK7A 2A9QA 1ACMA 1W49A 3KFXA 1U9JA 2GLUA 4MR7B 1Y1RA 2DR3A 3WLHA 4D9KA 1OB5A 1A0OA 1YRBA 2RG7A 3EBLA 2EBUA 3Q5EA 4BFXA 1EDOA 1S3SA 2FNAA 4BLOA 1DBVO 1GKUB 2CD7A 2X7JA 3L6BA 4HLDA 2JA2A 1W47A 4K6MA 3OX4A 2Z2ZA 2QX6A 4MULA 4B84A 5BN5A 2O8EB 2HH9A 1MW9X 1YL6A 2C8VA 4N39A 1ZCZA 3QMMA 2QENA 1SGWA 3P32A 2EKZA 4WGFA 2K5UA 2FP3A 4J0HA 3LU1A 4KAJA 3QELB 4LQ4A 5K0TA 1J2EA 1I7PA 1TAGA 1V7QA 1XQWA 3IAFA 4YNBA 2FPIA 2PA0A 3N28A 1EDZA 1A1SA 1PUIA 3ANSA 4NMMA 4OKNA 2FEMA 1ETUA 4GUDA 4HT3B 3OSZA 2SHKA 1G17A 1QVAA 3CISA 4HS4A 5TJHA 4F3TA 1YB1A 2WJ4A 2QMYA 3ILHA 5TF4A 2C7QA 3WB1A 2GSDA 1E62A 1FXWA 2ZUTA 1WDTA 1K3UB 3LRTA 3MWGA 2XRMA 3W4JA 3UGJA 2BEVA 2X8AA 4BDTA 4PVCA 2CLLB 3F6PA 2BFMA 3FDJA 4JDPA 1WQ3A 4RD4A 4RIHA 4NCAA 4B6FA 1I80A 2KSQA 4IIVA 2DHEA 1JZQA 1XNJA 2A30A 4MUFA 4G8CA 4EI2A 3BXXA 4JBYA 4V0NA 3CX4A 4DWJA 4QM6A 2DT8A 4DWWA 4EATA 2WYOA 4GPD1 3MRXA 3OUUA 4G36A 2QTVB 1T4CA 2EERA 1QAMA 3ZGVA 5JSKA 3VHRA 1BAPA 1QVRA 4R8VA 2O8BB 2H5JA 1B73A 1I7SB 2P2YA 4M4SA 3IAXA 3QVWA 1BD4A 4HFMA 1NBME 2HKIA 4RWZA 3WL8A 3G2KA 3ZI0A 2EGUA 3CVUA 5BOVA 3TLZA 5E2AA 4ZVNA 4O5OA 5LYJA 3RS4A 1GKIA 3ACDA 1Z6AA 3T1QA 2HNKA 4WTOA 4NH4A 1MPTA 1V3UA 4RIIA 4MWBA 1IL0A 1QRAA 3UOWA 4KSBA 3WGLA 2HK8A 4WJLA 3DVSX 1R4MB 4HWPA 3DFIA 1L5LA 4IG4A 1CUEA 3NUZA 1TF2A 4E2WA 5IN4A 1QX3A 1TDJA 3WGGA 5J2UF 2I99A 1UAYA 2P3LA 4JS0A 4LXHA 4GKAA 3H87A 4ZREA 2EX4A 1UEXC 3EIOA 2G5TA 3UYLA 1D2GA 2IVFA 4DQVA 5FJJA 1L1QA 4C0WA 4ZHSA 5KKAA 4ENRA 1F12A 1THTA 5EN4A 1ZXXA 4LZJA 4DKJA 2PZKA 4LF9B 4H7FA 5CB4A 1WZ2A 1ML3A 1QGAA 1U04A 1V1MB 1YULA 2C1EA 1VIMA 3LPNA 5FI3A 3PITA 4B7AA 4LF8B 1AHNA 5DM4A 2ZIGA 4D3FA 2CLFB 2GXQA 1FFYA 4F04A 1I2ZA 3KB1A 1V3TA 3NNNA 3UTDA 1EP2B 3V97A 4IUYA 3UPTA 3MOGA 5IFLA 4LFAB 3W04A 1XEAA 3BIJA 4A2CA 5HWSA 1HEYA 1GPUA 3ZX4A 4CQMB 3DZIA 5CW1A 3BH0A 4YRBA 3KTDA 3HXOA 1XFAA 4HRYA 1A9XA 4L4ZA 2AJBA 4E5DA 3QKUA 2N75A 1FEZA 2QM7A 2Q5QA 1BZYA 2G0AA 3OFSA 3LQ2A 4AZTA 3W34A 4POOA 2VPIA 3AUJB 3EIEA 1RQ7A 3K1AB 2AEMA 1FFWA 1M5UA 1Z08A 3DEAA 2ZYGA 3OFVA 1DTWA 1W25A 4YUYA 1IOZA 4FFRA 4LMBA 2P9CA 2XT6A 1FSPA 2VZ0A 2X42A 1KK0A 4WX2B 5EKUA 3O1HB 5HQJA 4I9UA 4C87A 5DM60 2B8WA 3I32A 3IHTA 3ITNA 3CRZA 1O5TA 5FFMA 4FZ5A 1P31A 4NBUA 5HDQA 2V7UA 1BROA 2V96A 3JQAA 5TPWA 5HOEA 3N8HA 1T4CB 4H4EA 3TJMA 3LYAA 3ZY6A 3MS2A 4W5OA 4W7IA 5IEJA 1I4TD 3QMPA 1RZVA 1H2AS 1JPNA 2EATA 2Q07A 3B89A 4OAPA 1AK1A 4OPMA 4LGYA 1S2MA 2I8LA 3JPYA 4PHGA 5ALKA 3ZVKA 4UCQA 4LNHA 5CT5A 4X7PA 5BMVF 3FTFA 4PGMA 4HNUA 2I8AA 3RAJA 3GEIA 3GQBA 3IALA 4YECA 3IEKA 4ZZ1A 3ZS9A 2JLVA 2B3DA 5A71A 3MRTA 3H65A 3WK5A 5I7FA 1YUNA 1I3NA 1SA0B 2H6EA 5TSDA 2VG8A 1T8UA 2WA2A 3QLVA 4UMEA 4V0OA 3FNRA 4HCJA 5EGNA 5HVNA 1LPOA 1MQ8B 2RCYA 1TZCA 1UK8A 3OFNA 1EWKA 4MI1A 3WDSA 3ZG6A 1P75A 2VNSA 3CZPA 5KWSA 4O1MA 5MFPA 1F6BA 5AP9A 4HFJA 5IH3A 1DLJA 4EG0A 2QAJA 4IJMA 3TOZA 3CX6A 3Q1LA 1QOPB 3JYOA 4QHYA 3YASA 1FVXA 1NTRA 4BGVA 1ZA1A 3MB8A 1U3TA 4PGFA 4WCFA 3FLBA 2ARKA 2ZCUA 2I9PA 3AJAA 2IVZA 4RLHA 2WM2A 3WL6A 4B81A 1Z0DA 2QLNA 3AXSA 3L6RA 4LVOA 3CZCA 5B1SA 4L2IA 2IV7A 3U4QA 3MWYW 4HYYA 4QDJA 1AXRA 3F67A 4BFUA 3BAFA 2QUAA 1E3JA 2E2WA 2Z3WA 2NU9B 3NVMB 1GITA 3PWZA 4LZZA 1HEIA 3W2FA 1K89A 1KI6A 1Z2AA 3ME5A 2BLNA 3WGQA 1VBKA 2OY0A 5CDSA 5J3JA 5K8UA 3E2IA 2WAXA 2AZXA 3I2KA 4P92A 4R3UC 4LNUB 3IIMA 3RKSA 3EQ7A 3Q3HA 1QVWA 5TMPA 2PZJA 3F6BX 1YK0A 2TMGA 3HXLA 1Z62A 1G2IA 3KQQA 3IT0A 3LD9A 3BFKA 4UCXA 5E8JA 1LLDA 1VYUA 4A8JB 4BEWA 4AVYA 2GYYA 3QK7A 2D3TA 2XBLA 1F38A 5T64A 1PYGA 3K1YA 3LWDA 4ZOBA 3G1TA 3DO8A 2IU3A 5JS7A 3GAFA 4ZYYA 2YV5A 2V5VA 1DRVA 4OYRA 4X6LA 4FDLA 2MSEB 3SWWA 2EZ9A 1HI9A 2XZPA 3FLMA 4NC9A 5BQOA 3ZDYB 4CQJA 2PJRA 5F3WB 3JVUA 5GY7A 2F8SA 3D7MA 4UOEA 5D5HA 4D7AA 1C1XB 2CEKA 3L18A 4GBJA 4JSRA 2AT1A 4JCCA 4LBVA 3GDGA 1PS9A 3PXDA 1I7NA 4UJ5A 1JT2A 5EJEA 2JH9A 3LIIA 1JDTA 2I66A 3T7IA 4FS3A 1G7CA 3T7RA 4ESHA 1VE7A 2PCLA 2AFHE 3WWPA 3DHVA 1FDVA 2CB0A 4FDVA 2V7VA 3VSEA 1E9FA 2IPOA 2ET6A 2FWPA 4R5MA 3TQQA 3ZDBA 4ZMRA 2HPHA 2V7PA 3T3GA 1F2UB 2I7XA 3NAMA 3GLSA 1B0UA 3EXG2 3JZIA 2DPHA 2W0MA 4DLUA 1E9EA 1K4YA 2WJJA 3FMVA 4OMFG 3V6MA 3V7FA 5I7VA 1T0IA 1L8XA 2DFLA 3IUEA 1NSYA 2DFNA 5DXAA 5EIWA 3DE4X 4EM6A 1F9AA 1MEOA 1U3DA 2IZZA 2XIJA 3REQA 2G5PA 3U9LA 4KYIB 1PAUA 5E6UA 3DBHA 4DMCA 4ZGGA 4JJAA 5M3BA 4XJVA 2XYVA 5CEEA 3QLVC 4MLPA 1FFBA 4NCBA 1AKYA 1O4WA 2R6HA 4MRAA 5B6PA 2ZP1A 4B3GA 4BB9A 1EE9A 1P0MA 1VHQA 4E31A 2YJTD 2XUHA 3Q15C 4KU4A 1Q0QA 4X6UA 3ZS8A 2HU8A 3I2JA 3B1JA 4G1VA 1C7EA 4PRZA 1HRKA 3EOBI 2DWOA 1U8EA 2RHMA 1GTMA 3H75A 4O8CA 4AZSA 3ST7A 1VI6A 2MU1A 3UJPA 4ZZIA 3QWFA 2MSNA 3P0FA 3QEMA 4H6XA 3TNFA 3WHKA 1UDBA 4YCSA 3CX3A 1PZMA 3EGCA 5JAHA 1WWKA 1IYZA 1WUHS 2FK7A 4MV0A 2Q5HA 1HOTA 3K0CC 3O7MA 1UZNA 3A6ZA 3H5VA 4NULA 1I4OA 5K4HA 1W5EA 4M0LA 1XVAA 1ADJA 3NGXA 3L7AA 5FF9A 2JJYA 2NQ8A 3IBTA 3U56A 3QYFA 5DVZA 5CPBA 2Q3BA 4XDGA 7REQA 5U9CA 1Z25A 2MDTA 1H9CA 2MYNA 2WWFA 1CZNA 3Q4GA 4L5YA 2R0QC 1Z7EA 1MDFA 2Y1EA 2OQIA 1M6NA 2PZGA 1S2GA 2XCUA 3AUUA 4CMCA 1L5KA 1U0JA 1NZFA 4JYMA 2PHZA 5TGTA 1WA5A 4UE6A 3G8AA 3KSMA 4PSKA 4KJZA 3R3JA 2Q7XA 3F98A 1JDBC 3MGAA 4QNRA 1VE1A 4TWAA 3IEIA 3T3PB 3W1VA 1NWHA 1VP3A 4YDSA 1ODSA 3RJTA 3V7YA 2YHUA 3RUFA 3SMVA 1NDHA 4RMGA 4YMVA 1UWVA 1XZLA 4GMDA 5AW8A 4QBHA 1ISMA 4BNLA 2E55A 4WLFA 5B1IA 2DWUA 4BNZA 3WK4A 1W581 3GLIE 1FFSA 4AX4A 5LWHA 2WWHA 2Q0HA 2HO5A 1AH2A 2XXBA 3U3ZA 5DI3A 1R66A 3PSAA 5MGBA 3L0YA 3HSYA 4RANA 4FYHA 2C94A 4B7XA 1A9ZA 2PE5A 4P0QB 2RG1A 3E53A 2CDRA 2IXGA 1SN7A 4DA7A 3QVXA 2FK8A 1U80A 2OZEA 4EVSA 1Q1NA 4MQLA 5ER9A 4AD8A 5JBQA 2B37A 4UM9D 2ZYAA 1L4BA 2C98A 3KB2A 5J1TB 5NLLA 1FP4B 2O7RA 3OPNA 4FEYA 1U5CA 4QDZA 3EPKA 1RPAA 1GNQA 1I2MA 1WY5A 2H0QA 2Z1NA 2Q3EA 4RK0A 2PJUA 4CTKA 4QNMA 3QNWA 2H1LA 4GLJA 4FD3A 1I0IA 1ZEJA 4DILA 3W1WA 2B5WA 2CJWA 4G1FA 1Z0KA 4X63A 5FPSA 3O75A 4NPHA 3IBSA 3A31A 5IVKA 1QE5A 4UVGA 2O2DA 1NGSA 1GARA 1YR3A 1I7LA 1RFGE 2AR9A 2R8PA 1CUWA 4KQJA 2QVGA 1YS4A 4KXYA 1QKJA 4KBYA 3GA5A 3GHHA 3EULA 3OCXA 1FX0B 3HYNA 5JS6A 4NECA 5LZ2A 2C8KA 3H11B 1FUEA 2RAFA 2FN3A 3THYA 2B4TO 4YQZA 3WJ7A 1RHJA 3HY4A 1ND5A 3ASZA 3IP6A 3BFXA 1OH8A 5ED0A 3V7WA 3QUQA 3TSAA 3X1JA 1F6WA 1GGHA 4LDAA 5I6DA 1HNXB 2C88A 1K88A 5ELLA 1E94E 4IF4A 4IEFB 4D0GA 3S7TA 3M1IA 4I1RA 4YMGA 5KMGB 1P91A 1U3VA 2C0PA 2R7AA 1G7SA 1GNSA 4PC6A 2P3QA 2UZIR 3P9IA 4IAOA 3VO8A 4YBRA 5JMPA 2XRYA 5KYUA 4AK9A 1X70A 4WOBA 2DU8A 3DC7A 2G71A 2PN1A 3VOBA 1TEVA 3KT6A 3V4FA 1IFXA 2X4DA 3V33A 1Z9BA 2W48A 3NJRA 4IIJB 4A3SA 4X65B 1JYSA 4BTEA 2EXXA 3E2PA 3N2ZB 4Q1DA 1M1YB 5FWXB 1Z5PA 1OCEA 3WIEA 4X1YA 4ZICA 4PQEA 3GDOA 1M1ZA 5AM2A 4BLSA 2D0OB 4K6FA 4X6XA 2XCRB 2YHIA 3PEWA 3BEDA 4Q1FA 4B6RA 4HFNA 2RHTA 5IZCC 1QWOA 4GM4A 4UDNA 3FUTA 3LGXA 3L7OA 2JFQA 5B4UA 1GGNA 4OHVA 5FTWA 3K71B 2PKXA 3KOYA 5K09A 2KW5A 2WF6A 4MCAA 1X7YB 2XJ9A 4TKUA 3ZGYA 1XHEA 3N2GB 4HAYA 4OJKA 3H8VA 3GFFA 5E1OA 4IUDS 3OTHA 1Y89A 3KU4A 3MVEA 4HAIA 1VSTA 5CP8A 4W1PA 5DT2A 3SHOA 1UJ4A 5DM70 3RT9A 1I6MA 2YC4C 3GD7A 4X8LA 5TQJA 2PXHA 2X23A 5K4GA 3T1HB 2PWPA 1Z35A 3O8LA 5CT9A 4LJRA 4HN2A 2G08A 5G41A 1NDQA 1XTKA 2ON6A 4XVRA 3HO8A 4MGEA 3ZI7A 2A78A 1T2NA 2IWHA 4IDQA 1QH8B 2NO4A 1OB2A 4IFTA 4PLWA 3HJBA 2Q3MA 5L7YA 3PC2A 4EGSA 4AY6A 5BQPA 3IDAA 3OZXA 4DMMA 3GL9A 3I45A 2DQZA 4PC2A 1EUCB 1IBKB 4UHEA 1B74A 1Y6FA 1OFGA 1SOMA 3CR7A 4UTVA 2FXVA 3B5IA 4BN5A 2ZPTX 4R0MA 5GVSA 2ADOA 5JDCC 1HG0A 1Q19A 3EVTA 3EQ6A 4FQ8A 3B6EA 4MYTA 3T5TA 2DKFA 4TS9A 1VZ2A 3V42A 1OH6A 4UQPA 1GAQA 5HKOA 5DSTA 3JQAB 5TPWB 3DZKA 3HKCA 5C8YF 3CLKA 4S2EA 5SY4A 3RGGA 1TZMA 4N3GA 3USCS 2JD2A 1DC5A 1JHDA 2A4KA 2WFLA 4HQ0A 2BT4A 3MJVA 5LOVF 1IXKA 1PJZA 5JCOA 2J6BA 2VDNB 2AA3A 1QFYA 1XF1A 3DO5A 4GPEA 4TS4A 3WLEA 3CWCA 1HEUA 2EX0A 2CYBA 4QUKA 4RELA 5FI5A 1JXQA 2NUTB 1DAIA 1OI2A 5B7PA 5K3FB 1V41E 3IJEB 3B9BA 3ZK9A 3BWDD 2RIRA 4BFTA 4ER5A 4M3NA 2VP9A 4G5QA 1L4KA 3ZK7A 4J07A 2WF8A 5C3MA 4JIMA 1YQUA 2IH2A 2P2LA 3BE6A 3FCSB 3DTVB 4OL9A 5T3YA 3MJDA 3AVUA 2CVOA 1QH0A 3QVVA 4AW9A 5I4IA 4BASA 4Q02A 3U48A 1PJBA 4M86A 4PG5A 4RV4A 1N1GA 2J3MA 3C3JA 3N0WA 4H1HA 1KDZA 2ZSUA 3I37X 3M9LA 4L95C 5KKCA 3QPUA 2D0IA 4QGBA 5HK9A 2QRPA 3OEWA 1V7CA 3L7IA 4D0SA 3L7JA 2VDJA 4FXPA 1REQB 1SURA 1VGRA 1KZ6A 3TOVA 2F7SA 3ZQ6A 1N4DA 2HGSA 2FSGA 2ZBQA 3BJRA 4Q4CA 4HB2A 4U8HA 1J23A 3F74A 3PF8A 2W2KB 1UBCA 2X7XA 2A0KA 4AZWA 3OC6A 4RV5A 5ESWA 3D4PA 4WN9B 4ERXA 5CA0B 1KPHA 2GAAA 2Q21A 2OSVA 3ZY2A 4TVSA 5CM9C 4M7RA 2J48A 1PGNA 4KB5A 4KLNA 1XNRB 3ABRB 4LTMA 3VYUB 4M1OA 3QU7A 1M83A 4DJDC 3TZEA 3RU9A 3WICA 3DUWA 4K0RA 2VUTA 5JXHA 1I7QB 3PGXA 1JHUA 2PIAA 4EVQA 1YR7A