4QDXA

Crystal structure of antigen 85c-c209g mutant
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
277
structure length
271
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGGNGTPNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 103
structure length 271
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qdxA00
1B41A 4MWSA 5JADA 4K2AA 4BE9A 4Q1VA 1SFRA 4O08A 4RE6A 5YASA 2O2HA 4LYEA 2WHPA 3H17A 1GPKA 4BRZA 5ALQA 1VZ2A 1CUEA 5AO9A 1AMNA 1EXWA 4H7HA 3K2IA 5CH5A 5ALEA 4FWBA 1FJ2A 1G4HA 2GBFA 4HZGA 2RHTA 2XMQA 2QM0A 1CUUA 2I3ZA 2ZSHA 5A7GA 3IB3A 1TIBA 1HQDA 1SOMA 2YXPX 4G5XA 4FLEA 1F6WA 3QH4A 2OXEA 3ZWQA 2AJLI 3GBSA 2XDWA 3AZOA 2B61A 1CQWA 2XQJA 5JYCA 4I19A 4INZA 4BE4A 4QA9A 2CMFA 2HADA 5C81A 4UFPA 4B7ZA 5JZBA 3G02A 2EDCA 5ALLA 2ZYHA 1FFEA 5FKJA 3PI6A 1A7UA 2R8BA 3STWA 3STUA 3HRHA 3C45A 3WZMA 1WM1A 5HCUA 4UHDA 1GXSA 3ZV7A 2VEOA 4U2FA 4KE6A 5HQ3B 1G42A 1K63A 3OURA 1H22A 1ODTC 3I6ZA 2J3DA 1BEEA 2XQFA 4J0JA 3G0DA 2CJPA 3ZLUA 5AKHA 3QITA 4OU5A 5AIAA 5AKKA 3RARA 3VJMA 2PBLA 3ESBA 4X90A 1BS9A 4WDRA 3AUKA 4H18A 4QDTA 5HF8A 1ACJA 4AO6A 5JAOA 1VXRA 1G66A 3R3WA 4NZZA 5HFAA 4LXHA 1W75A 4DM7A 4HXEB 1EA5A 2WM2A 1E3QA 3BJMA 4Y2XA 1H2YA 1QTRA 1TCBA 3I2KA 5JZSA 4FNGA 1W4LA 3L1HA 3WLAA 5BOVA 1E8MA 2OG1A 1GQSA 4CG1A 2O2GA 5K3FA 4L72A 4DYHA 5FPQA 3FBWA 5EI5A 2BAGA 1VA4A 5AKJA 1PJAA 2HL6A 2XQIA 4E46A 5FP0A 1P0MA 4M0FA 1YB7A 1XKLA 1QIJA 1WCYA 4A5SA 5JAUA 2QOEA 3ESAA 3BF8A 5ALDA 2RHWA 1E8NA 4QDZA 5DNUA 2B9VA 3DYIA 3WI7A 3FLBA 3B5EA 2RI6A 4HXGA 3PE6A 4NVRA 4BC0A 3N2ZB 3FAKA 1XZKA 4P93A 1ZD2P 4BBZA 1HL7A 3WKDA 1ISPA 2XT0A 3F67A 2HHAA 2W22A 2OCLA 3F98A 2WUEA 3C8HA 3R3XA 4PV7A 3NUZA 4NMWA 1JU4A 4AO8A 4QZVA 1LLFA 4B84A 5KWJA 5JIBA 2FJ0A 4X97A 3CN9A 4OB8A 3HXKA 3O4GA 4H7IA 2G63A 4K6HA 4C89A 1IMJA 3B12A 5F4ZA 1CRLA 5ALNA 4DSZA 2CKMA 2J4FA 4ITVA 4HS9A 4FFWA 2OCIA 1CUXA 4UBLA 4OD0A 3EF3A 3DCNA 3F97A 4H77A 3IIIA 2RONA 4ZRDA 3H19A 1OILA 4GDMA 3HC7A 3UMJA 3ESDA 1IUOA 4AZ0A 5ALIA 1EX9A 1KEZA 1QO9A 4GWLA 4FBMA 3LIIA 2QZPA 2JGJA 4X71A 1H23A 1EINA 4KACA 3DOIA 4BCBA 1C7JA 1BN6A 3WIOA 4CI9A 3KWJA 2WFZA 5C7YA 3ANSA 3QPAA 5EHNA 3WZLA 4AQDA 5ALRA 1O6GA 1XQYA 2JEZA 5T4FA 2GBIA 5T4HA 4AB1A 3VVMA 2PUHA 4IH1A 5AM4A 2VJBA 1BE0A 3QMVA 4FOLA 4KR0A 2OPHA 2DQZA 5EHQA 3I2FA 1JJBA 4QEKA 4UBMA 1YAHA 2WLSA 3DL7A 4Y9SA 2RIPA 5K3CA 4DMHA 3GA7A 3I28A 1DINA 1QLWA 3V1MA 1MX1A 1YA4A 3F96A 4ARAA 4UBKA 1G5FA 3H2GA 4L9AA 1ZGBA 2PM8A 3DQZA 4XVCA 3E4DA 1MNQA 2R11A 5A71A 4ZV7A 4AMZA 3FVTA 4MXDA 4F0JA 5JAHA 5DNWA 5D7BA 1MTZA 3LLCA 1RP1A 4KAFA 3PFCA 1W52X 1DT3A 1W76A 1N1MA 2HM7A 2AJCA 3UUFA 4M0MA 4MEBA 2ORYA 3M83A 5CURA 2DSNA 3AINA 1CUDA 1EDEA 2ZYIA 4FTWA 1Z68A 3WJ1A 5AIBA 1ODSA 3FOBA 3WYDA 5EHXA 3DKKA 3E1GA 1DX4A 5K3AA 5J3JA 4A16A 3BIXA 4N5IX 4MYDA 4X7BA 4BVLA 1QIEA 4TVKA 4BP8A 4MYSA 3Q0TA 3OTQA 5AKYA 2BFNA 4ZXFA 4XIIA 3PF8A 1E66A 1SCKA 1GT6A 5A2GA 1A88A 3DOHA 2BUBA 2XUAA 4WY5A 1Y7IA 2OQIA 5FLKA 1TQHA 1C4XA 3DL4A 3WIBA 4X91A 1PFQA 2XLBA 3DKRA 2ZVDA 1A8QA 1FFAA 4X85A 4EA6A 3K9BA 4RGYA 4GLBA 5LP1A 2JGIA 1BCRA 1ZI6A 1JKMA 3QVMA 3NOXA 3ICWA 1FFBA 3WK7A 1XZBA 3I6MA 2DHCA 3C6XA 2PPLA 5ALYA 5A7FA 2I78A 3DLTA 1Y37A 2QKYA 2XUHA 2QXTA 1VA5A 4EY6A 1QE3A 4ARBA 3MGAA 4EY4A 5HF5A 5JASA 4B82A 1DX6A 2XI4A 4C4XA 2VAXA 5K5EA 4QE3A 2VATA 4KAJA 2O7RA 2B4KA 5AOAA 1JT2A 1CUBA 3HEAA 2XMSA 3WWOA 1GGVA 4OYYA 1IZ7A 3RLIA 2Z3ZA 5FOQA 1EDBA 2VJAA 3T4UA 2JBWA 1DT5A 2WJ3A 1FFDA 3U1TA 3WWDA 5ALWA 2V9ZA 1WOMA 2QMQA 1Q83A 4BVKA 1Y7HA 2WKWA 4W1QA 4W1RA 1ORVA 5AK3A 3C43A 5LZ9A 1CUWA 5D6OA 1HLGA 4XJVA 5C8VA 4G4GA 5ALXA 4UFOA 5AKGA 2O2IA 3IURA 4J0IA 4FBLA 5ALKA 1YA8A 4G9EA 3O4IA 3PUIA 3WA7A 4BTLA 5A6VA 4UFNA 5DNVA 3BDIA 3BWXA 1M33A 3DJYA 5HZGA 5ALHA 4WFJA 1UKAA 2GBGA 1EB9A 1JMYA 3WKAA 1UKCA 4OB6A 1AKNA 1U4NA 3I2HA 4JNCA 1XZGA 5IVIA 1C7IA 1THGA 1X2EA 4IH4A 1N8SA 2WQZA 2PSEA 2I03A 5AM0A 5AI6A 3WMRA 2CZQA 5CH8A 2ACEA 5E4TA 4BDSA 5K3DA 2WHRA 4CCYA 1ZD3A 3VKFA 3WWCA 3FYUC 3OOSA 2QJWA 3EQ8A 4BZZA 3H0CA 1BROA 3FWHA 2XUGA 2JGLA 3V48A 5D3ZA 4H7JA 1EK1A 1ZI8A 4PO3X 2XQKA 2AJDA 4C88A 3BL8A 5ALTA 1ZGCA 1DQYA 5CT6A 3SC2A 2OCKA 1MU0A 2X76A 2WU3A 2WG0A 5ALUA 1H2XA 2BJHA 3O9VA 1MX5A 4UHFA 5AKIA 4BZWA 5CH3A 2AXEA 4Y2VA 2ZJ6A 5ALZA 2DQYA 3TGLA 3CCCA 4FLFA 1UK8A 4DMCA 1ORWA 1R9MA 4X93A 1TK3A 3C6YA 4MJ3A 5HKBA 5EIHA 1QZ3A 2V98A 1A8UA 5LZ2A 4G8BA 1DQZA 2XMGA 3KSRA 2G5PA 1R1DA 3BF7A 3I2IA 4C6HA 5IVDA 4Q3OA 1JI3A 5CXXA 1SCIA 1KU0A 2Z8ZA 4NS4A 4GHWA 3D2BA 4X00A 4U2DA 2BKLA 4OCZA 1YCDA 3G9XA 5AOBA 2WG1A 4XWGA 1XZCA 4OYLA 4QLOA 1YR2A 3GFFA 4X94A 4Q3LA 5AK6A 3WK9A 4Y2QA 2VT7A 5C8XA 3KOOA 1MNAA 3H18A 4KAAA 3JYHA 2K2QB 1IVYA 4QDXA 1DWQA 2UZ0A 1NX9A 3K6KA 4IQ4A 3WKCA 3C6BA 1CUJA 2WFLA 2EEPA 4B85A 2GBCA 4H7DA 1ACLA 1UOQA 4BYMA 4N8SA 4M0EA 2Y2UA 4UHHA 1N5RA 1YS2X 2Z8XA 4IHAA 2PSDA 1ZJ4A 4C4YA 4HRXA 3AILA 4AN1A 4RE5A 3FLEA 1EH5A 2GYWA 1EI9A 4H35A 4BAZA 4I3FA 1MAHA 3O9MA 2H9YA 4AO7A 4G9GA 1VZ3A 2PSHA 5E2IA 1QIMA 1AURA 2QTBA 3R3ZA 2VJDA 5T4EA 1VE6A 1S8OA 2DR0A 4CG2A 4EBBA 1LPPA 1GZ7A 1YSCA 1L7RA 3G0GA 4EHBA 3FSGA 3RM3A 3JWEA 4JEIA 4DMFA 3O4JA 2YH2A 4FFVA 5HF6A 4BRSA 3GROA 4HXFB 3OC0A 1WB4A 2WG2A 1IUPA 3ZI7A 3QPCA 2J3QA 1WPXA 3BDVA 3LS2A 1RYYA 4Y2RA 4B81A 2RGUA 3D7RA 3E3AA 2WUGA 1WPRA 1ZIXA 3VJLA 1J07A 1T4MA 4H7EA 3WA6A 3T52A 1R9NA 2WFMA 3G9UA 4G4IA 4C4ZA 3W2TA 5AM2A 1XRNA 5CT9A 2OGZA 4B83A 2PKYX 5AI8A 1CUZA 4QDOA 4X95A 1EHYA 2HFJA 3FCYA 1CUCA 4YK7A 2WUFA 4YX9A 3BXPA 4CCWA 2XQGA 5IKXA 3FLAA 5D3KA 3G7NA 1CUYA 4H0CA 1XRQA 4KE8A 3W9UA 1XQVA 4H7FA 5A62A 3FSGD 5ESRA 3G0BA 4B0PA 1LPOA 2X5XA 4G4JA 4J0GA 4J0CA 2G4LA 3IUQA 5T4BA 1U65A 4L3WA 2PSFA 4WFKA 2D5LA 1MJ5A 3OPMA 3A2LA 1USWA 3TRDA 2JGMA 3STTA 1CR6A 3QBJA 3RKSA 2WIJA 2C0QA 1P0PA 2JGKA 4Y2SA 5SYNA 4P08A 1R50A 4JYMA 4ETWA 3M81A 1K6EA 3U0VA 1LZKA 3WWPA 4DGQA 1XQXA 3R3VA 2WTNA 5LZ7A 3SK0A 4FNMA 2WHPB 4WCVA 4U2CA 1J1IA 1XQWA 4Q05A 4GI1A 2V96A 4X3CA 1TCCA 4V2IA 4LXGA 2ECFA 3D3NA 3WL6A 3NWOA 3R41A 4PNZA 5JANA 1UK6A 1LPMA 1MN6A 3DDUA 1F0NA 3DS8A 4Q3KA 3WK8A 1QFSA 1UOPA 5AKZA 5FDFA 2VTVA 4E14A 1CIJA 4X92A 1FSSA 3V1KA 2V97A 1LNSA 3W04A 4G1FA 1XZHA 4Y2TA 1XLWA 5ALFA 5CT4A 3G0IA 4JH0A 4WFIA 1X2BA 3BJRA 1CV2A 2C5FA 3C87A 4TGLA 5AM1A 3G8YA 5JZ9A 4B6GA 5HK9A 5DYYA 3VJKA 4EZIA 2BCEA 4EUSA 2Q0XA 2DCMA 1JU3A 2XUIA 2ROQA 3ZPXA 5ALGA 2HA6A 4BVJA 5KBYA 3WQHA 4LIPD 4EY8A 2C0PA 1UZAA 2OCGA 1JMKC 4J03A 2QR5A 5SYMA 3MUNA 4DNQA 1EVEA 4DIUA 1UXOA 4C87A 1QIHA 1CUIA 2QJRA 2VAVA 4YPVA 1XKTA 4X6UA 3PICA 5AKEA 1DWOA 3WL8A 1XZJA 3HZOA 5AHXA 4W1PA 4DNFA 2Y1KA 5K3BA 1RWQA 4AN0A 1L7QA 1AGYA 3WL7A 4AZ3A 1NU8A 1ZJ5A 2BUCA 3B3QA 3CCBA 5I9IA 1CUGA 1UWCA 3IA2A 1XRPA 3EQ7A 5CMLA 4Y2UA 3ESCA 2PU5A 3MVEA 4EY7A 1VE7A 4LHEA 3W06A 2JGFA 4FLMA 1AC5A 3D0KA 2IX9A 3H2KA 3H1BA 3GZJA 2GZRA 1EVQA 3PF9A 1GKLA 4GECA 5K3EA 4LYDA 5EIEA 5CT5A 1LBTA 5AI9A 2OQVA 1WB5A 3OG9A 5E4JA 4ZI5A 4Y2YA 1SCQA 5LIPA 4RNCA 1GKKA 5HF9A 1W1IA 1HKHA 3C5VA 1LPSA 3GELA 3HABA 2G5TA 2QVBA 1QGED 4U2GA 1JJFA 1BN7A 3QM1A 5LKRA 4PSCA 1K8QA 5ALPA 3DEAA 2HU5A 5KWIA 4UHBA 4J0HA 4JUIA 3W9BA 3ANTA 1CUSA 4F5ZA 1XROA 1IZ8A 1WHSA 1R3DA 2YYSA 3SWWA 2H7CA 4BTVA 4Y2JA 2CUTA 2I3DA 1QOZA 3EBLA 1AUOA 3H1AA 1MT3A 2ZJFA 3FNBA 3KXPA 2XLCA 3FYUA 2C5GA 4J0DA 4UPDA 3LIPA 3G9TA 2LIPA 2WJ6A 3IDAA 3WWEA 2QS9A 1XLUA 3W05A 5IVHA 5JD5A 1ODCA 4Y7DA 4GXNA 2H1IA 4DTCA 2XUPA 4BAUA 2HA5A 1EDDA 4OPMA 4B9EA 4LXIA 1JFRA 4BCDA 3A2MA 4WY8A 4TPKA 4OSEA 3OM8A 2HRQA 4OUKX 1YAJA 1QIKA 1QIFA 5AJHA 3EIOA 5CBKA 1BEZA 3A70A 4P92A 1ZICA 3AZPA 3O95A 1I6WA 2XUQA 1DU4A 1THTA 1L7AA 3R0VA 4MWTA 3R3YA 2FJPA 1VXOA 2HFKA 3V1LA 4PW0A 1UT6A 4LKOA 4F21A 2HA0A 2FX5A 2QUBA 5JAPA 4ZWNA 3FVRA 3ZLTA 4KEAA 3ZLVA 5ALMA 5LYYA 2XUJA 1ETHA 5H3HA 1K5PA 1CUVA 1HPLA 1VKHA 4I4CA 1LBSA 3IUNA 4RPCA 1QIDA 4F60A 4GBGA 3STVA 1HDEA 3AIOA 4GW3A 4E11A 4OB7A 4WJLA 4KE7A 1XZMA 5IVKA 2PVSA 4QWWA 5DWDA 1TCAA 1P0QA 4UBOA 3L1IA 5AM5A 1CEXA 1ZOIA 4A23A 5AM3A 1EK2A 1XZAA 4ZGBA 3MUOA 3KD2A 2H7XA 4B0OA 2VA9A 3NGMA 5CW2A 4L0CA 1AQLA 1WHTA 5ALVA 4G8DA 2QUAA 2J4CA 2OGTA 4HVTA 1YASA 1D07A 3H2JA 1F8UA 4UHCA 5JD4A 1JJIA 3QYJA 2NW6A 5CRIA 3H2IA 1E89A 1R4ZA 1R88A 3V1NA 1CFJA 2HDWA 1T2NA 1YS1X 2PL5A 1TRHA 3QZUA 4ZREA 2ONCA 3I2JA 1ZD5A 4KRYA 2C4HA 2JGEA 2C58A 5LZ8A 2CBGA 3BE8A 2HU7A 5CT8A 3TJMA 5FUMA 4WDQA 2DHDA 5BWBA 5FV4A 2AJBA 4BC1A 1LPAB 1ZI9A 4Q82A 1O6FA 5I8PA 5FXMA 4DNOA 4FKBA 3WKEA 2E3JA 5C8ZA 3FYUB 3VXKA 3I6YA 4N8EA 3P2MA 2XMZA 1CUAA 7YASA 1MX9A 2XUKA 4H7KA 4PSDA 1XRLA 4ROTA 3HSSA 4K6KA 1K4YA 2ZSIA 3WK5A 5I7UA 2ZYSA 2OAGA 3TEJA 5DJ5A 1XRMA 5HK8A 4MQLA 2GZSA 1H2ZA 2XE4A 3A6ZA 4E15A 3DNMA 5AOCA 5EFZA 3QMWA 6YASA 1AZWA 2XMRA 3WJ2A 1XRRA 3D4LA 4P9NA 4K5QA 3LP5A 1H2WA 2WUDA 5LZ4A 1F0PA 2BGNA 2HU8A 1VLQA 1P0IA 3G9ZA 4DLNA 3D5EA 3AJAA 2X8BA 5DYTA 2WIFA 3Q8WA 4W1SA 2EDAA 5DYWA 5A7HA 2Y6VA 1GPNA 2Y6UA 1FFCA 5KREA 3FYTA 5AKXA 5ALJA 2OGSA 2XMDA 1BCSA 2XMCA 3M3DA 5JATA 3ICVA 4BP9A 5JARA 5EGNA 4PF1A 5HKAA 3HACA 2QXUA 1BRTA 3CXUA 2XMBA 5FPPA 4BAGA 4YASA 4FHZA 5DLPA 1XZLA 1ZIYA 4KRXA 4Z49A 2JIDA 5AI4A 1XFDA 2ACKA 5LLSA 2C7BA 2IITA 1Q0ZA 3EQ9A 1DWPA 1J2EA 3SX4A 1XLVA 5AKLA 3C6ZA 5BWCA 3GUUA 4J7AA 1PV1A 3IULA 4HAIA 2CB9A 4DSAA 3O4HA 3V9AA 5AI0A 4Y2PA 3WK4A 3IUMA 3X3HA 1B6GA 2WSLA 5DTIA 3PUHA 2HA3A 2QRUA 2BUAA 1MO2A 1QTIA 4QDUA 1MAAA 2PSJA 4X6XA 1WB6A 2VSQA 3QMMA 4PSUA 5AK5A 3ILSA 5ISMA 1GPLA 4MQMA 3WKBA 5EIAA 3AZQA 2AJ8A 1DTEA 3D59A 5CTAA 2QT9A 3VDXA 4X6YA 5ALSA 1X70A 4BATA 1U8EA 3D2AA 4MEAA 3PDCA 3PFBA 2XUDA 2B20A 3IVMA 4OU4A 4QLAA 4U2EA 5FRDA 1OCEA 1ZD4A 3FCXA 5ALOA 4HTAA 4Q34A 1LPNA 3STYA 1IUNA 2WJ4A 1UK9A 1NU6A 2YASA 3I1YA 4G8CA 1OXMA 3AFIA 1N5MA 2VT6A 1EB8A 3DD5A 2JEYA 1LZLA 2H7YA 1QO7A 3L1JA 4N8DA 3R3UA 4XX1A 1BU8A 2W6CX 1CPYA 2VJCA 3H2HA 1VJ5A 4W63A 1GQRA 5AH0A 1QIIA 3WK6A 1Q84A 4CIAA 1QIGA 5AI5A 4K6GA 2XB6A 3G0CA 1VOTA 3CN7A 4FMPA 1SC9A 3WYNA 3I1IA 1MPXA 3HLKA 2HA7A 2HIHA 2ZYRA 2RAUA 5LKAA 1XZFA 3F9CA 5BV7A 3RK4A 5K3FB 2OAEA 2WFLB 2HA4A 4BDTA 4IO0A 4UUQA 3C5WP 4N5HX 5AICA 3HJUA 2Y2VA 4DMKA 2D0DA 1XZIA 4J3JA 3S2ZA 5AK4A 2PUJA 4FDMA 2XUFA 2WIKA 3C8DA 2WIGA 2HA2A 1CUHA 3STXA 1E5TA 2OLEA 2DHEA 2ZJ7A 1HBJA 4S0XA 1J06A 4PQEA 5E4YA 4CFSA 4IH9A 2CEKA 2PX6A 3QPDA 4JYPA 3KDAA 1UFOA 4CG3A 1CLEA 3I2GA 1QJ4A 3M82A 1W6RA 3DYVA 1LPBB 2WILA 4B80A 4QWMA 2VF2A 1QFMA 2O7VA 1U2EA 4W9RA 4KYVA 2GYUA 3BIWA 3C70A 2VQ6A 3HYSA 4CCYB 4EB0A 4ZV9A 5LZ5A 5DTJA 5HQ3A 1UOOA 4UBNA 2ES4A 5HFNA 2HRRA 3D2CA 4D9JA 2PU7A 5JD6A 4UBIA 4B9AA 2Z5GA 4HRYA 1LGYA 1UK7A 3JW8A 4J0KA 4UBJA 3LCRA 4BCCA 1CQZA 1E8DA 3WL5A 3HI4A 1AX9A 2DFPA 2IIVA 2WTMA 3AIKA 5IH7A 1QONA 3IUJA 4EY5A 3A2NA 5JALA 3AIMA 4AMYA 4AXBA 3S8YA 1TKRA 1XZEA 3UUEA 1TAHA 2BGRA 4CIBA 3ED1A 3YASA 1A8SA 4BB0A 3N0TA 3KWFA 4C01A 4U2BA 1CUFA 2XUOA 3VISA 3IBTA 1CVLA 3F8SA 2JF0A 4DNPA 2Z3WA 4GEGA 2P8SA 1YB6A 5EHZA 4AX4A 4KJXA 2FUKA 1UKBA 3E0XA 3R40A 3O0DA 2WHQA 4UHEA 3VVLA 4QNNA 3H04A 4KE9A 2WU4A 2WIDA 5CXUA 1XZDA 1KU6A 2GYVA 5AP9A 1Q0RA
chains in the Genus database with same CATH superfamily
3ANMA 4MYUA 5CJ2A 1MQ9A 3ZS8A 2OVFA 4R69A 3R9IA 4ER7A 1OYOA 3EFOB 1X7XA 4MV7A 4YH1A 1SCDA 2BEUA 4K2AA 1EUDB 4NAVA 4ZK6A 3VJMA 1T3LA 1OFIA 2JB9A 2Y76A 4YCJA 3N7AA 3IT1A 3TQQA 4KLZA 4JC0A 3LOUA 4RE6A 5CVJA 3JD0A 3BAZA 4LHZA 4CUJA 1OI7A 1S9HA 2BN4A 2OYRA 3TRKA 4E70A 3VKHA 4LDPA 1GAEO 4BRZA 3UKOA 5ALQA 3UC5A 1N7GA 5HQJA 2VZEA 5FOVA 1A71A 1EXWA 3P2IA 4FZ5A 1G8SA 3K2IA 4MVJE 4X65B 1ZYUA 3LH5A 2O2JA 4REQB 3DLBA 1LQ2A 1GAJA 2OSVA 4G0XA 2ASEA 1EJ0A 4XCVA 1FJ2A 2C5HA 5TJHA 5AVVA 2W2LA 3ZJ4A 3KVOA 1D2HA 5BR7A 1SUEA 4O63O 4BECA 1HWYA 2ZRBA 2XMQA 4HZGA 2DGDA 2JRLA 5I7WA 2EBHX 4OMCA 4LF8B 1D2AA 2QM0A 1CUUA 4J94A 3IB3A 3M9WA 2XA9A 1DLJA 5JR3A 2P0EA 4YA6A 3R9XA 3ADBA 2YXPX 2YZMA 4G5XA 2Q07A 3MWDA 1XE3A 3RVRA 1PG0A 1JHMA 3GEGA 1JMVA 3WQRA 4BMVA 2OZPA 2WICA 4ES6A 1X42A 4OQMA 3ZNPA 2Q5CA 5EIXA 2W2KB 5E6SB 1T5OA 4XPIB 2B7CA 1MEEA 1BHSA 2BW0A 2XQJA 4BKQA 2FUG6 4D92A 4AQ7A 3AL0C 1WUKS 1G19A 2PLFA 2VP4A 3JWJA 1M1YA 1BFKA 3L93A 4JLDA 3I5MA 1LVUA 2J32A 4QA9A 2OP0A 1FSGA 1VJCA 4UM7A 5C5EA 2NQ2C 4BNKA 4Z4GA 1UBEA 2PMBA 2DPLA 1ISIA 4M1WA 3I9OA 2C5AA 3IQXA 4KXVA 4BBPA 4F4HA 1RJ9B 4V0ME 3PLAE 1E9EA 2MTBA 3KJZA 3L41A 4L2IB 2HF9A 3Q6NA 3FETA 3ONEA 4OMUA 1AM4D 2EDCA 2ZXFA 1BXRB 3QKUA 5IZCA 121PA 2YJTD 4OBXA 5AJTA 5FKJA 3L4KA 3PI6A 1K8ZB 1LY1A 1PYGA 1SC6A 2R1VA 4U02A 2BGGA 2OL4A 4KLCA 3V4ZA 3IDQA 4V1CI 1NC3A 4HEHA 4HDRA 1JB1A 2IDZA 1JBEA 3B9PA 4XIFA 5EQFA 4ZEWA 2AXPA 4J2TA 3T7AA 3WZMA 2O1XA 4FYIA 4LDAA 4MROA 4UAVA 4UEWA 4UHDA 5HCUA 2IQIA 4PYLA 2EYQA 4R7ZA 2IUYA 3ZV7A 1KVRA 1VL8A 3WGQA 1JTFA 1VRWA 3L9WA 3S1AB 2G1UA 4HDSB 4DM3A 2QT0A 5COBA 4KV9A 3LX6A 3OURA 2PTHA 4Q4DA 3WRYA 2Z2ZA 4LSWA 3LGAA 2AX3A 1BEEA 2BKEA 2J3DA 3PC8A 4EUHA 4I50B 2RJ3A 2CVOA 1N2XA 1VBNA 4RH1A 4W8GA 4EFNA 4BO7A 2X2OA 3ZLUA 3N2EA 4HG2A 4I4NA 3KB8A 4OU5A 4G4SO 4PXSA 5AIAA 1AKWA 4R8KA 2PV7A 3TIFA 5L4NA 3QXJA 3NIFB 4RCYA 2PL3A 3U40A 4MV3A 2VP5A 2WA1A 2RK6A 1N9KA 1ULSA 4GDFA 4NOJA 3RGGA 3I58A 2VP9A 3E7FA 5HF8A 1T4DA 3VR6H 5TPWB 10MHA 1GTSA 1EP2B 1U8TA 2BSXA 5GWXA 1KFCB 3CWCA 3M89A 4BZPA 1B26A 5IABA 4G9BA 1HE3A 4ASUA 2FFRA 4WCDA 5HIKA 3D2LA 4KFTA 3K0FA 1AS0A 3R3WA 1C3OB 1SVIA 1WABA 3ACBA 4MVJP 3TDNA 5CK5A 2GD1O 3MWLA 2QN2A 3DDCA 4ECAA 4GI2A 4UVEA 1PT6A 3UPUA 3DCIA 2Q2OA 3G5LA 4MI9A 5AW6A 4BQPA 1RHJA 4UTXA 4DM7A 3QEAZ 1NBIA 1CP2A 1VSUA 3AERB 2UAGA 3LX5A 2XCTB 2IHVA 2ICAA 1VG0B 3AF5A 1J20A 3F0TA 1QTRA 1TCBA 3MOIA 4YWHA 1F60A 4HADA 5FQNA 1C4OA 1NW4A 3I2KA 4F3TA 2XODA 3ZVMA 1MT0A 4FNGA 2YWRA 4LHVA 5BPFA 3CRNA 4MGKR 4NH4A 3WLAA 2FW6A 3CEPB 3A2KA 4J1TA 2HIMA 1GQFA 1B8UA 5LQUA 1E8MA 1P1BA 1L5HB 4G5QA 1JDBB 3N86A 1GQSA 4MV6A 4YV7A 3ZLJA 4JBYA 1YK0A 2RC6A 2M1XA 4WGGA 1RSZA 4UZSA 4F8JA 2XB2A 2P9BA 3KKMA 2E6UX 1YQEA 3PQ5A 4JX9A 4LHSA 4L72A 3HDVA 1UBKS 5K3FA 5JNSA 2VXBA 5IJ0A 5EI5A 1ZOSA 1YZVA 3O8RA 3UCEA 4A10A 2P9TA 1LBHA 1R4NA 1LB1B 5AKJA 3VZRA 4D8WA 4ZZ0A 1UC4B 1JRLA 4IV8A 1WG8A 1NXOA 1TM7E 1H8HA 1R0CA 3KALA 5IBPA 4CQLA 4M0FA 3ZE1B 4AUEA 3KEQA 4WSOA 2Z1DA 1QIJA 4KLAA 2ZI5A 1V3UA 1NVKA 1WQ1R 1Y8RB 2WVJA 1Y4ZA 4QBIA 4A5SA 2YFKA 1YS6A 4TV8F 2BBOA 4G01B 4A2CA 3M1IA 3ISJA 1K88A 2W5UA 5E8JA 3I37X 2WD9A 4BN5A 2P9CA 1WU7A 3BF8A 5JQGB 2RHWA 3E8SA 2ZYTX 1C0EA 1T9GS 1O6ZA 3H99A 2Q1WA 1C2TA 4YUXA 1Y33E 1OREA 2FEWB 3MCUA 1ULUA 3OEWA 2ZBFA 3OZVA 4J7XA 2XRFA 4K3UA 5LP6B 1G64A 2SKDA 1YB2A 3PE6A 4J16C 4TM7A 5JD3A 4O2AB 3HLTA 1QHNA 1O2DA 4RD2A 3ZZUA 3BWBA 1JKJA 4BC0A 2GHIA 2DBRA 2H07A 1FW6A 3BIFA 4WE3A 4BWVA 4DR2B 2A92A 3LPMA 3FAKA 2Z2IA 2B0JA 1YGPA 2PCJA 4P93A 2JD0A 4QD3A 2CNNA 4BX8A 1ISPA 1NR5A 1P45A 4EI9A 5FLYA 3F67A 4CZ2A 3NBZC 3FHTA 2OCLA 3QLEA 2CDAA 1M3SA 3W5IA 2WUEA 3C8HA 2AD1A 4NMWA 1Q3TA 2KX7A 2R4QA 3GLSA 4JBXA 3UM9A 4AO8A 4Z3KA 2CCJA 1Q0SA 3SU8A 1VE5A 4A03A 4CR7A 5HOEA 4RDCA 3TE6A 3WDLA 3OM9A 5KWJA 5E6RB 3S40A 1DS6A 1QAQA 4Q1EA 4BO1A 3FPCA 3GJYA 2GCEA 3TX6A 3RS4A 2BRUC 2XOKA 1ZLYA 3S8MA 2VJOA 4RCVA 1U5BB 1KDTA 1W34A 3HXKA 3O4GA 1HT0A 3NHLA 3C5EA 2PWAA 4D8UA 1YK1A 3B12A 2PLNA 5G4LA 1CRLA 3CX6A 4DDKA 1FFYA 4U7DA 2FZVA 3HS3A 1X7WA 3VSAA 2WHYA 4OIFA 3W1EA 3D3WA 4F8EA 2VR1A 1RYEA 5FNVA 4EG1A 4KPGA 2Q7OE 2DLCX 2OCIA 5DHQA 3ZY4A 3MLAA 1QVWA 4DC9A 4LOJA 1DSSG 3LYAA 2CMKA 4RGVA 3ND8A 4PQRA 2V7BA 2QIOA 2RONA 1S8FA 3FPFA 3ONNA 2A9KA 3DDOA 4L7QA 3G1TA 4GEKA 2P4UA 3N2LA 4JT9A 4GDMA 1W6UA 4Q12A 2PZGA 3H83A 4AY3A 4E51A 2AG5A 3BIOA 1SOWA 4FD3A 3EH2A 4BNXA 2Y0BA 3UC9A 4E4RA 3NOQA 3LIIA 2EFCB 4GL4A 4UZFA 5DWVA 5IKOA 1Z18A 2QZPA 1CCWA 4HLUA 3GAAA 2JH9A 4A26A 3KUCA 1FP1D 4JXZA 3PXEA 3PLRA 5FR2A 1N2CB 3HY4A 4OI1A 3ZX5A 5IU6A 3FJYA 3U61B 4KBGA 4JELA 3QVXA 2YZKA 4TM8A 1ABBA 3T0IA 4L78A 2WA2A 1P44A 3CRW1 3OJCA 3OX4A 4NE7A 3OZDA 1C7JA 1BN6A 3WIOA 5A9SB 3KWJA 2WFZA 2D2IA 1Z07A 2P2YA 5DM1A 4JSRA 3QPAA 3SICE 4AD8A 5IN4A 2NO5A 1QGAA 1CRZA 3IE1A 1V2GA 2FSSA 3DA8A 1SBIA 4IDDA 2MSCB 1XQYA 2JEZA 2FKAA 3BEOA 2YJNA 4F2HA 4LJYA 2P69A 1HT3A 2B92A 1M8FA 3MTEA 3SC4A 4QTYA 2KBFA 1G21E 5AM4A 1R18A 2VJBA 1FFXA 3QVGA 1NLFA 5CTJA 5IG2A 1PKXA 1Z17A 3QNMA 1DEHA 5BN3A 3QMVA 2GK3A 4QXPA 2WOOA 3K6RA 1OH8A 2WDZA 3D54D 1TVKA 1FDUA 4JLMA 4KUEA 2PZAA 1HG1A 1Z5ZA 4QEKA 1Z39A 3PIDA 4J4HA 4U2KA 3T3HA 3UCXA 4B40A 4BFLA 1KYTA 1ZRHA 2FXVA 3BERA 3G2JA 2A6PA 4YJ3B 3GG2A 3Q7SA 3CC8A 3D43A 3EFHA 3TMAA 3BS4A 2RC5A 4AICA 5FPKA 3FHCB 1EP1B 3D7NA 3S70A 4DMHA 5BNFA 2ZJ8A 3RSGA 3ZDZB 3PPWA 4M22A 1DINA 3GD5A 1QLWA 4R6XA 3V1MA 3EPKA 2O5EA 1Y1PA 2VQSA 2QQ5A 1U98A 1MA3A 2EBFX 4WD3A 4CKCA 2H1CA 1T2UA 3JALB 1U0JA 3KWMA 5DCYA 4AK9A 2I0FA 2WHXA 3IVRA 3CZQA 2H1VA 3OX3A 4GO1A 5IAJA 5A3RA 4R8SA 3PGMA 4HR7A 2DERA 4QYMA 4U3JA 1AHPA 2CSXA 4BFWA 3SZLA 2IYPA 2X15A 4D57A 4BY9E 5T64A 4GC9A 3WQSB 4ZMSA 2GFIA 1FQOA 3V8PA 3DQZA 4OI4A 1QU2A 4PZPA 3LRXA 4G5OA 1MNQA 2R11A 5A71A 2FSPA 2VHUA 3TK1A 3FOZA 1NJ5A 3U4AA 3PSAA 4D9BA 4EHHA 3R5SA 3RC9A 1UPUA 1R4AA 2H4FA 2W6PA 1RYFA 3T4PA 3INNA 3HR8A 4ZV7A 4AMZA 2BISA 4HVCA 5JEEA 4F0JA 2P62A 2C4NA 3O82A 5K6AA 2VHZA 4NMXB 4YMWA 1ZK2A 5DNWA 2Y0DA 3LLCA 2NPIA 4FFBB 3AY0A 1W52X 4PIMA 5GM2A 4XQEA 2O8CA 1N1MA 4P0TA 4QQRA 1NN1A 3TSWA 1CY8A 1I2MA 1SCAA 3GMDA 4HWGA 1T3SA 3GARA 3O4RA 4AMBA 1PSWA 3UUFA 2QTRA 4MEBA 5DGHA 3DLPX 4G36A 4IFTA 1BVUA 3N8IA 3T5BA 8ABPA 2IIQA 3HKDB 4Q6BA 2WHEA 4B6FA 2XYPA 3M83A 1W4RA 2O3TA 5E0KB 5HGJA 4A8JA 1RRVA 3I61A 1G8FA 4D8XA 5D3QA 3TO5A 4F5WA 1EDEA 1JDPA 2R7KA 4WKBA 4DUZB 2ZSKA 3CEAA 3EUAA 4OHUA 4CT0A 3WJ1A 4EJSB 1ODSA 4LXTA 4RYDA 1I4LD 3MCWA 3UJBA 1EGVB 4EFDA 2V7PA 4AUKA 3OCZA 1E3WB 2IA5A 3DKKA 3E1GA 3EVFA 3L7LA 4IHJB 3ELWA 4AW9A 5B2EA 3UANA 4CKYA 3I32A 2B8TA 3DR3A 3TEFA 2QRVB 5ILGA 2W6QA 1JQ3A 1PUXA 3C3MA 1WP9A 1YR3A 1IEWA 2ADFA 4MYSA 5I9BA 1U3GA 3FUVA 1AT1A 4R7GA 5K2OA 2IY8A 1NXXA 2VAPA 4FEEA 3AH8A 3U60B 5BQXA 2Q2VA 4EHJA 2PIDA 2XH8A 1ZM9A 4F3RA 2R47A 1ZK3A 5BUQA 2CD7A 3F9RA 4NFYA 3FNFA 3OY2A 4FINA 3HJNA 2Y9PB 3UBMA 1WQ3A 3PF8A 5BUCA 1E66A 2GI4A 4DIOA 2Q1TA 1XTRA 1CDDA 5G02A 5B1DA 1RLTA 5A2GA 3C14C 3R7BA 1XBTA 1JQDA 1KZ1A 2JFUA 1QKJA 2BUBA 5B36A 2XUAA 5B7QA 2FX3A 1YNOA 4FYVA 2IOHA 3ZWAA 2J3MA 5KCMA 4JXJA 2VSOA 1V47A 1EIWA 1TQHA 1SIOA 2HCJB 2NOAA 3TLGB 2O6LA 5DCWA 2VRCD 3B6IA 4M0DA 4OI2A 4OKNA 2ZU6A 2ZKIA 2QTGA 3IS3A 4BO3A 4RJTA 1XDWA 3M4JA 3TCNA 1B1CA 3FOWA 4NCKA 5HPYB 3E27A 4ZAYA 2JEOA 3CLUD 4IIJA 5DNEA 1NJ8A 1RFGE 2C5LA 4ENPA 1FFAA 4YMLA 1ZUNB 2J9YB 1Y0BA 1E7MA 1V8DA 4PC6A 2J3LA 2QSJA 3M49A 4XM0A 1LTQA 4QYWA 2CLDX 1Q0TA 4KIJA 5D84A 3PXAA 3GRCA 2HPVA 1ESEA 2Z83A 2CNDA 3RTCA 3DE5X 2AQHA 4RGYA 4CR6A 3GLVA 2P4QA 4GLBA 4HLQB 5KO2A 3WGOA 5FD8A 2RHOA 1BCRA 1GPDG 2NU9A 3N0VA 3PRJA 4I55B 3QVJA 1XJCA 1NW7A 2VBCA 1J21A 4ESEA 4R83A 5CR9A 1EX7A 3AEQB 3C3EA 4B48A 5ICMA 4IDNA 4ZTZB 1RBYA 1XEXA 2A94A 4XE5A 4ND6A 4QJ4A 5ALYA 1OTHA 2YXNA 4TT8A 5CGQB 4DCSA 4UPVA 5A0FA 4X9XA 3KEGA 4H9GA 1P5ZB 3WLMA 2JIRA 1E4YA 5AJVB 1R10A 1TE2A 4RV9A 1GCOA 4RESA 3SQXA 4U7WA 1NL3A 3FMIA 5AVRA 4KNWA 1PDWA 3DEKA 4I50A 3V4VB 4AYXA 2WJAA 3K05A 3V00A 3QKWA 5HF5A 4JGGA 3ROFA 5JASA 1DX6A 1A5AB 1YTLA 3BXGA 3D3JA 1KK1A 2WAYA 1KRXA 1E0KA 2GPNA 4COOA 5K5EA 1QHHA 4QE3A 3M6XA 3GJTA 3PUVA 5AOAA 3FNHA 4KO4S 3UO8B 1CUBA 4XW2A 3RHFA 2SCUA 4BO4A 2JLRA 1ARZA 1J00A 2W2NA 5C18A 3QOXA 4YRIA 2VSFA 3NTQA 4TMWA 4ZC1A 4JEMA 1IZ7A 1PFYA 4F4JA 4UTVA 2Z3ZA 2FWRA 1UBGA 3KQMA 1ZJZA 1OZGA 2QN3A 4JBNA 5LC1A 3SC3A 4ATNA 3A6GA 3K5PA 4TV9B 1L3CA 4HT3B 1EE9A 3Q8KA 1CR4A 2GZDA 1DT5A 2ZI3A 1O89A 3D8HA 4BQSA 1MHTA 4PS0A 4LJ4A 5FUBA 5JECA 3KIPA 4KUHA 1FFDA 1H6CA 2XE6A 3GGDA 2BPOA 4ID3A 2B25A 3LFTA 3U1TA 4CNQA 1FMTA 3HWWA 3MWEB 1EA7A 4LV6A 4TWRA 1JPUA 2GN1A 2RDMA 3E9EA 1SHTX 2AMJA 1Q19A 1ZRMA 2OOSA 3ZH2A 1J24A 3EMBA 3FZEA 3GMSA 5TB5A 4C0LA 3M34A 4D3FA 1Y7HA 1WW2A 1JLSA 5HJ2A 2V0NA 3GJ4A 4C5AA 3DUWA 1FJHA 1ORVA 2EQ5A 2QW0X 4N7RA 4RD4A 3RUHA 3L8GA 1JE0A 4GZ3A 3ZHTA 1XCMA 4H3KB 3KYIB 1DRJA 3AETB 3C43A 5TARA 5TE9A 1K5HA 1YIAA 1Z5OA 1MORA 1UJCA 3K0BA 1L7OA 3KQYA 1CY6A 3AM5A 5CLIA 4XJVA 5CYGA 3X2EA 3I3OA 1PG5A 2ZBPA 5A04A 2Q5OA 3TS1A 2FQYA 3WB2A 3WFZA 4O4LF 3IURA 3KKPA 5ALKA 5C8YF 1GN8A 3FOFC 4G9EA 2PUAA 4E2XA 2ZCUA 1ZNYA 4QGBA 1L1EA 2H9AA 2K7ZA 1DKUA 3H6KA 4BO6A 4BNVA 4BTLA 1AOXA 2YWGA 4UFNA 2A35A 1JQLB 4AX8A 3IMKA 1V6AA 3S2EA 4US0R 5C1PA 2OQ2A 1WXIA 1FDWA 4YREA 1ISHA 1OV6A 2Y92A 2GZ2A 5FHRA 2GOYA 5FYQA 3DJYA 1DTWA 5KQPA 4LZZA 5JV5A 2IHNA 3DPIA 5ALHA 4UARA 4NYIR 3NAGA 4UXIA 3ZGXA 3ICQB 2FEAA 2AE1A 4CETA 3FH0A 3BT7A 2AF3C 4CDRA 4EFLA 2ZB2A 3O38A 4UZEA 2AW3A 1USUA 1T5HX 4LOAA 5BN5A 3TSYA 1I01A 3NJRA 3I2HA 4FMDB 4EPRA 4U5QA 1U8UA 4CQMB 4RA9A 2C7OA 4KPYA 4P32A 1KYIA 1TUBA 1XZGA 4DPKA 5H59A 2XW6A 5AUPB 3RNLA 2VRNA 1PNOA 2YRFA 2JIOA 1T2CA 3ABOB 1RTKA 3HXLA 3IFSA 2JCSA 1RZVA 3LSTA 5AW9A 2OYCA 3FDXA 2WQZA 1Z33A 2HJWA 2I03A 1R3UA 2NZJA 3FPKA 4KQIA 3UGTA 1JIVA 2JCVA 2JIPA 4LI0A 1ORRA 3WMRA 4CTMA 1IC6A 4GMDA 4HWTA 1F4PA 1KZYC 1Y4AE 3LLVA 3I12A 3ZDCA 2X8LA 1U2GC 5GAJA 4OHYA 1TPZA 1P3Y1 1TF5A 2F1HA 2QTVB 5K3DA 5PNTA 4EHIA 5CYPA 5LA6B 2GPWA 1VKJA 1I1HA 2PAAA 4BJ1A 1Z6QA 1L5SA 3G2OA 5LCXA 3WHLA 5CFLA 4G0QA 3HCBA 3TJRA 4IIGA 2QVCA 3WWCA 3OOSA 3EFEA 1OFUA 4D98A 3QHPA 4NQZA 1LD3A 1MVOA 4BZZA 1T9KA 3V4FA 4M0UA 3FUXA 1BROA 1E9VA 4L08A 5AQEA 2OFPA 3LCUA 5ESXA 2ANBA 4DJAA 1YDMA 2RI1A 1EK1A 3PVZA 2F43A 3CRMA 2WWTA 3FWKA 2D4AA 4JLAA 7MHTA 1BXGA 3I5AA 4LHWA 5B3LA 1WZEA 3D1JA 4NK5A 5K45A 4DQDA 1V3VA 1SHZA 2AJDA 3COYA 2O2EA 3KQOA 3K1JA 5EJ6A 5IFKA 4S04A 1D0VA 2CFOA 2YOHA 5AQ1A 4NCAA 1G63A 1W85A 2O48X 4PYNA 3WSVA 3OEEA 5ALTA 3GLQA 1SK8A 5CT6A 2A59A 3NT2A 3C4JA 2F00A 3EEFA 2AV6A 3K8QA 4IGIA 2HWYA 3KNZA 3VKWA 1OBHA 1VIDA 2WU3A 3JVEA 2BJHA 1ONNA 3O9VA 4UHFA 2UYYA 3U3XA 4UOZA 5F9HA 3CT6A 1BE1A 2H2WA 3UBTA 3IKTA 3U3JA 3LL4A 5F5XA 3TW4A 3H4IA 3ZTWA 3AGQA 3D3EA 3PUKA 2XDYA 1X87A 2G07A 2D5AA 3CURA 3DQPA 2OT3B 2VHYA 1NNI1 3PNKA 5B3JA 3CCCA 4YRZA 3KDSE 3MELA 4AAYA 1VIVA 2FUNB 1UK8A 1WKCA 3E1KA 3JPWA 4FLFA 4HATA 1USVA 5CPBA 4B71A 4DMCA 5KDDA 1Q14A 1U28A 2WJYA 3EIXA 3HGMA 3VSEA 4GLOA 2Q5FA 4C0SA 4ZVRA 4KNVA 1YQQA 1ORWA 3V5NA 4Q4JB 5CA1B 3DFIA 1UBLS 3B9BA 5A9SA 1SKBA 4MJ3A 3W6OA 2IYWA 3P9PA 2C9ZA 4YTEA 1TK9A 5C1IA 4JYAB 1GGFA 4QX6A 1ISFA 2ZQYA 1A8UA 4MQUA 2ODAA 4B82A 3DVAB 5FA5A 3UUWA 1CLUA 2P3OA 2VCEA 5KOYA 2VJYA 1V8ZA 2A5YB 2P7HA 4TWIA 3UJCA 3B89A 3VH4A 2XMGA 3KSRA 4JI1B 3C39A 4WNYA 1J8YF 3IYLW 2VSYA 2EZ4A 4YJ2F 4F5DA 1KORA 3AI7A 1EZZA 1NYQA 4BNZA 5F77A 5JRDS 2ZRHA 1M8GA 4NQRA 4BS9A 1PFGA 3ST7A 5IVDA 1XPJA 4LCJA 4OHKA 4C7JA 2X86A 1KMNA 1NRJB 2JGRA 4GKVA 5CXXA 4RBNA 1IBLB 3NCHA 4MUJA 1NIJA 3TH5A 5TEWA 4GHWA 1B00A 1MENA 2Q5HA 3HDHA 4R2XA 3WG9A 2B7BA 1N2BA 1B43A 2WTEA 3QBVA 1KJYA 2BKLA 2C9OA 4MWDA 4XWKA 2IYAA 8AT1A 2YVUA 5KNDH 4DR1B 3OJEA 3WHKA 4Q4LA 5BSRA 1N3YA 4AZ3B 2HMAA 3BMCA 4RF4A 4JCCA 3EA0A 3JALA 3GW8A 3HPQA 2OVBA 3T7EA 1GZ5A 4OLBA 3M6IA 4UU8A 4BNLA 1JEAA 1DKPA 1I1NA 5LLTA 4ND3A 5FBVB 5H9WA 3GFFA 3L92A 3P0HA 2W4IA 1TLTA 4RD1A 1Q44A 3E48A 1RQGA 1I0LA 3FPGA 1P9NA 4LVUA 3EGWA 4LY3A 4EGQA 4BV2A 1JEQA 4J1NA 4DJ5X 2C61A 3L6BA 3P0JA 3MUFA 3QUSA 4X8HA 2PT9A 3DKPA 3I8OA 3JTMA 4U6QA 2P2NA 1L5GB 3W5UA 2B69A 2VUUA 4AF8A 3NH6A 4KAAA 2FN7A 1LSOA 1GG2A 5IT0A 4OQZA 4RJJA 1TEXA 4OK3A 4DLBA 4DR7B 4OQNA 3HPRA 4DR4B 3PTLA 3TQSA 1DWQA 1L8AA 1HH4A 4HGQA 4UUMA 3VHLB 4EARA 4L4RA 1YC2A 4RHUA 3SYNA 4DYDA 1LDBA 1IM8A 2GCNA 1UZNA 1BMDA 3MBIA 3KPYA 3WGHA 1PUIA 1ATIA 4UC0A 4IIBA 1N5OX 2EEPA 1A04A 4FGKA 2F62A 3NTVA 1KQGA 4B85A 2BI4A 2FXIA 3W2FA 3WQQA 4DG9A 1KI6A 1T3HA 2WYWA 1PV4A 2PR2A 1EG7A 2QRJA 2ZSUA 4RIEA 3WMXA 1CTQA 5KU7A 1UOQA 3PJFA 3VU1A 2O05A 3LHSA 2VBFA 1Y5LA 4W8HA 5TQ0B 4BYMA 1UZUA 4LRYA 1OTXA 1ZGGA 4ZI7F 4NV1A 1SU4A 3NI2A 2IY9A 3FTNA 4EW1A 4HDQB 5JSQA 4JI0B 4UHHA 1N5RA 5C8DA 1DKOA 1TLLA 2M6SA 2IDKA 4ARZA 4OQQA 3RFCA 3E3LA 5JNLA 4J8PA 4OM7A 4OXXA 4N12A 4TMXA 1KRWA 4C4YA 1ZGJA 1R6TA 2OZKA 1ZW1A 3GOQA 2X0RA 4KXFB 3CVXA 4D3DA 5EVJA 3FY4A 1TMOA 5HR5A 2YQ4A 2ZRAA 3AILA 2P2LA 1BO6A 1JU9A 3IP6A 1GL6A 1YJCA 1NAIA 1NMXA 1PIWA 2B99A 4XGRA 4ANFA 2W4QA 4C3VA 4EABA 5SZJA 2GYWA 4K1XA 2PWYA 3F7OA 4FE4A 3UPDA 4E33A 3BCUA 1JQ5A 1MOSA 2G88A 3HU5A 4R54A 2LPMA 5JTTA 4E2WA 1NFRA 4YDSA 2ZRGA 2ZUSA 3KZOA 3R74A 3V7FA 1RC0A 2H9YA 4G9GA 3C15C 2YWEA 1FX0A 3UKDA 5E2IA 4Y9TA 1CDEA 4ND4A 4CIWA 3RWBA 2VSNA 1FVHA 1OHHA 5CD9A 4HN2A 1QRTA 2J5QA 2Y77A 1JLLA 1S8OA 2WB2A 3L7NA 4EF5A 1LVHA 1CZNA 3B5JA 4I6JA 1P39A 1GZ7A 3P9KA 4Y30A 3HYRA 1YSCA 1J99A 4QOSA 3G0GA 4Z1OA 5EQDA 4E7OA 3DCJA 1CS0B 2JLCA 1OXXK 2P0YA 4WOBA 2WV9A 1WNTA 2HQRA 4WUVA 1BMQA 4HX2A 1LA2A 3QSYA 1XTBA 1ZP6A 3ZDQA 4JQYA 2H2GA 3JWEA 1M0WA 3ZDYB 1MO6A 3GRUA 3O4JA 3A3NA 3SEAA 5JALA 2YH2A 4R2IA 5HF6A 5ITZB 2NACA 1Q95A 5CUQA 2QROA 4TRRA 3W5DA 4LZWA 4LZOA 4OX9B 2VQ3A 2WG2A 2X7XA 4URFA 3JZFA 5FH9A 4TWBA 1U2DA 4LOKA 3GA5A 4OREX 3KJHA 5EJAA 1TOAA 3BDVA 2CL0X 2CLEB 2J3IA 2GZAA 3KUDA 1DUIA 1YI8A 3L01A 4IZHA 3TNFA 4EF6A 1FYXA 2GPSA 4RVOA 4TKUA 4B7XA 1GGEA 1RYYA 1E7RA 4OHOA 4Y2RA 1G6KA 2EWWA 5HE9A 3T95A 2HW8A 1D6NA 3D7RA 3AEQA 3L06A 3ZY3A 4MLPA 4QVGA 4HVLA 3K9LA 3HLYA 1NE7A 2FEKA 4BP3A 2VAMA 4CM6A 4CF7A 3VJLA 4KHPB 1OW3B 1T4MA 2JK0A 2VLIA 3ED5A 3FUUA 3LQKA 4NZOA 1DELA 2DULA 1Q1AA 3WYCA 4B4KA 4BUCA 1CZOA 4BQNA 4YP1A 3I4CA 1L7DA 1DO0A 1E4OA 2A9OA 1A2QA 3GEHA 3B3JA 4ITRC 5G0UA 2FLVA 4K03A 2V7VA 2C2YA 1Z6GA 3SXPA 3X44A 4DS3A 3DC7A 2HZBA 3G9UA 3MRSA 4HNGA 4ZMBA 2NYAA 1SXJC 3U4GA 2QD1A 2RGDA 2V45A 4WVLA 2CUKA 2OKGA 4KXYA 2GSWA 3BFPA 5CFOA 4ZDIA 1RI2A 2OR3A 3DKVA 4MVJF 2J3JA 3BGVA 1DG9A 1A2OA 4A82A 1IK4A 4EJ6A 2YHAA 4I14A 1RP7A 2OGZA 3OVMA 3WLPA 3T3NA 4BLOA 2PKYX 3IHWA 4CDMA 1AJEA 2P65A 3CB2A 1H1DA 5F98A 2NP6A 1XRSB 4PN7A 3GLIE 2ZI6A 3UB2A 1V4BA 3C7DB 3KQWA 4AP5A 5AXDA 4LRUA 2FAXA 3AI3A 1Z36A 3TTXA 4XD7D 3BMNA 4LYYA 3P9RA 3I39X 2XTAA 4NPAA 5CDFA 3FLAA 4TYYA 6ABPA 3G7NA 4A6DA 4H0CA 5DX1A 1GRCA 2N1MA 3MTQA 4Z54A 2PEYA 5BNWA 3S8YA 1FIUA 1JIKA 3L8CA 4MLDA 3W9UA 4MAAA 4MUNA 4BQFA 3NBFA 2AFIA 2XKKA 2IEYA 2WYUA 3AUUA 3K53A 3ERCA 3ORQA 4MICA 1SM4A 4RVUA 1JNXX 1Z45A 4FZ3A 4LHYA 4O3MA 4C14A 3PC8C 3AY7A 3OUZA 2V9PA 4XGIA 2D4HA 1FL9A 5TV2A 4CHTA 3LZ6A 5HX7A 3OMXA 1H3FA 5P8WA 4EB6B 1LPOA 1UM9A 3KBOA 1YGYA 4G5YA 2X5XA 3NKVA 2FRDC 3CW8X 4MPRA 4IEFB 3KQUA 4KREA 1QLHA 2JH8A 3UXHA 3O91A 3CLTC 4EBFA 5T4BA 1N5IA 1GNSA 5KSPA 1U65A 4K8RB 4L3WA 4M0KA 1LBIA 4WFKA 5ENZA 3MYRA 1VGQA 4K9OA 1TUGA 4PSVA 4YCDA 1P6XA 1EXNA 3A2LA 4RQBA 4F7DA 2FWNA 3GLGB 2A1UB 4MVJA 1GRRA 1OFTA 2JGMA 5CW1A 5FO0A 3VU9A 4GP6A 5AVJA 5EXSA 1F8FA 4JOQA 3D8BA 3RKSA 2IF0A 2O0KA 3MTIA 4BVGA 1AG9A 2QR2A 4CL8A 4Y7CA 5KTSA 1RYMA 1UP7A 3EAQA 3VGPA 5IYZB 3UFXA 2JGKA 3DFUA 4U7HA 4P08A 2AL7A 2WJZB 3SHFA 3GFPA 1J0EA 3M81A 4M7OA 2C8VA 2FWIA 4O2BA 3OCVA 2NU7A 2PYZA 5ERGB 2CLIB 1CJVC 5BQPA 5C31A 3U0VA 2ZJOA 1DNPA 4DGQA 1PNQA 2C31A 3R3VA 2A2ZA 1NP3A 3O83A 2WTNA 3SK0A 4RSRA 1JIQA 4PGMA 3WB9A 4X8LA 5GONB 4K0RA 4R1TA 3LKBA 4IEEA 4U2CA 3TAHA 3PEVA 1XTUA 3F90A 5K2MA 1AXGA 2JJ1A 4FE3A 2EFGA 2Q3EA 3TDMA 1MA0A 1CJSA 2V96A 4NIMA 3ICCA 2O14A 4X3CA 4JBHA 4V2IA 1Z88A 1P9WA 2JDID 3DXFA 5CM9C 1IY0A 1HDIA 2LV8A 2DYKA 4KO1S 1EFVB 3JQ9C 3R20A 2JGDB 3WL6A 3ZE9A 1N7HA 4ZVPA 4DCOA 5AUOB 1D7AA 3IEUA 5DHSA 3AKZA 3EIEA 1YV9A 1GDHA 2DH6A 1S5PA 1RCFA 4JXKA 5IRCD 2IYLD 1LPMA 2ZFUA 1HFJA 4KQ9A 5B2ZA 4XD7A 3HCRA 3GIWA 2HEIA 1WSDA 3NWPA 2EJBA 4ZCLA 1CEQA 1UOPA 3EXHC 1NKTA 3N8GA 4XLZA 4GOJA 4XDHA 5ARCA 3S1LA 3TVTA 1W29A 3PDIA 1TMYA 2Q3JA 4HGRA 2VXOA 1WXGA 1ZBDA 3OE1A 4PRKA 4E14A 3JQAA 2B1IA 2QYOA 3KHKA 1ZNXA 2C8JA 1KMMA 2BRUA 4LCEA 1FSSA 4HQLA 2ZTVA 4QJIA 1XPUA 1PVOA 4LGYA 3GUCA 3F6BX 3BZWA 3EVAA 4PX2A 3UV7A 5L3VA 1QRUA 2HK7A 4Z2YA 4AZWA 4F85A 1CD5A 4PYQA 1XZHA 3GLHA 4ZT7A 4Y2TA 5GINE 2QSYA 3B85A 4D9FA 3PGKA 5I5EA 3EYAA 3SPXA 4LXYA 7REQA 4R0VA 4DR5B 1TVMA 3QVOA 3ZLTA 1KH1A 1QC5B 1SHLA 5CIYA 4UEJA 1Q7GA 2GA9A 1SU7A 2IBMA 1DBWA 3I52A 1F2DA 2HWXA 4HAUA 3NGLA 4JH0A 1X2BA 2R48A 4X7RA 1P5RA 3BJRA 4MB0A 1XL0A 3P2YA 3FB4A 4MR7B 4YDRA 4C4PA 2R6DA 4DT1B 6CHYA 5JS8A 3NBQA 3ZWXA 1M2GA 3A4NA 3GT3A 4DMKA 1QVAA 2F64A 5HK9A 4PFQA 1WUYA 2P3LA 3NV9A 2QYTA 5EP2A 2G9UA 3HVJA 2Z1MA 3FYDA 1RVV1 4ALIA 5KYGA 4EZIA 4TXNA 2ET6A 2Q0XA 4NBTA 2DBVO 4NYJQ 1UJ6A 5JDCA 1JU3A 2C7QA 4L5YA 1TA9A 2AG0A 2C42A 2QNRA 4UVIA 2MWMA 2ROQA 3QX3A 2ZQ5A 3COJA 5ALGA 2Q6OA 5H68A 1FNDA 4ON9A 2HA6A 4OGFA 5JHHB 2PY6A 4MHTA 3BAFA 1AKEA 1TZBA 1UBRS 2ST1A 2D1FA 5IT4A 1KAQA 4RFVA 1GTVA 1E60A 1G291 2QBYA 2OCYC 1G2IA 4MVWA 2C0PA 1OGIA 2OCGA 1HX7A 1JMKC 1J56A 3IR6A 4RV4A 1NNSA 1CIVA 1VYUA 1E2NA 3JQ9A 4RMGA 2VDWA 3PXUA 5P21A 5SYMA 1WUHS 5FFNA 2H63A 4IMJB 1G8GA 4DV6B 4MS4B 2HQ1A 4JR1A 4A0QA 5EL0A 3TQOA 1BGVA 4DA6A 2YOFA 1ECFA 2WB4A 3WMFA 5GIOE 1UXOA 2DECA 1ZA1A 5LR6A 3LPDA 5DM70 2Z6VA 1CUIA 2QJRA 3IHKA 3OPXA 3PQ6A 1JB9A 4FONA 4G2NA 5JISA 3W90A 3ASYA 4HAZA 2AG1A 2J6CA 2WZBA 4NESA 4X6UA 4XJTA 4NZMA 5CIWA 5F7ZA 1OAAA 3Q40A 1KMHB 4ZZ2A 1Y80A 3JSAA 1V2HE 4KXWA 3I8SA 3UIEA 1K3UB 2ZRIA 1XZJA 4X8OA 1UKEA 5ER6A 1K86A 1VJDA 1YDWA 5EIBD 4QOGA 2OFOA 2O9JA 5AHXA 5EZYB 1B8NA 3A3KA 5HE8A 1JIJA 3BH6A 1DC6A 3IQFA 2Y1KA 4KXUA 3ZZ0A 1EE1A 1U0RA 1RWQA 3B51X 3KEMA 4TLMB 4AZ3A 5F7OA 4DXDA 2Z9CA 2V03A 1HNWB 4B4UA 1NU8A 2BFOA 5LBIA 1JX6A 3C3YA 3IUYA 3PNBA 3AI1A 5K0LA 1TC1A 1E6UA 1YZFA 2N3ZA 1E9AA 3VKGA 1Z3CA 4MCHA 4UEKA 1AUXA 3IA2A 4L4XA 2FR8A 5THXA 2XOEA 4B6SA 1KDOA 4K26A 2IS6A 3EQ7A 3OPYA 4PN3A 2PU5A 5DHFA 3TI7A 2LP4Y 3DE6X 3EDOA 4TMTA 1FNSA 1VE7A 1H85A 2FPGA 4FGUA 4H31A 4I6EA 2H7VA 3JD3A 4RJLA 4TKLA 1JEJA 1AC5A 3D0KA 3I5UA 2NT3A 3QA9A 5FFMA 2A86A 5KNDD 1X7GA 1TTTA 4OG2A 3IOBA 2E48A 3KR1A 5LU9A 3GZJA 3SF0A 5BN1A 1MLDA 1FYEA 2NZVG 3TQIA 1YUMA 5IVPA 1G5IA 2NSJA 1ZR2A 4M0CA 3BD8A 4D9MA 1Z6YA 1L4GA 1QORA 1SC4A 1BNCA 3ZEAA 1GG9A 1LW7A 1SCBA 2ZSBA 1W5SA 3U31A 5K3EA 1RPJA 4V03A 4M6WA 2C4WA 1E77A 4L16A 3B8EA 4WN9A 2IRWA 4D9KA 1J0CA 3CUSA 4ZOEA 3TQFA 5E7QA 1TJYA 1LF5A 3F6PA 1JFFB 3NASA 4MP6A 2I8AA 3GRYA 3JAKA 1MAVA 4QUIA 3BH7A 2CXUA 3DZGA 1IXRC 2R00C 2ZAMA 4ZI5A 2BJVA 2Q4TA 2ZJZA 4G67A 4UCQA 3OIWA 4UEQA 2B94A 5LIPA 3MPOA 3T5MA 5HF9A 1W1IA 1E0JA 1HKHA 1O95D 3C5VA 4ZPXA 4ZEXA 5BYJA 3LV8A 4B3RB 1Q1NA 5DP2A 5KEIA 2QVBA 4B6QA 1YZYA 1RM3A 4FGSA 1E2PA 3LSYA 2XGMA 4Q3CA 3C5CA 3IVCA 4BO2A 3OQJA 1KO8A 4JJAA 2GJ8A 4ZU6X 3PQDA 1AD2A 2J45A 4UMEA 5CCXA 2D0OB 3VAZA 1E64A 1N3IA 4MZXA 5HCIA 3H2BA 4IBOA 4ARIA 1PT8A 4Q7LA 1V41E 2QG4A 1HT2E 3KXDA 1FSFA 4IYJA 3O9ZA 3SR0A 4FSDA 4J0HA 1EFRD 4JUIA 1BW9A 1Y3FE 1M7GA 1CUSA 2P1ZA 1HA3A 1XA3A 3ZV5A 3GDFA 5C9ZA 5ICEA 4IHQA 1IZ8A 1YJ8A 2XKBA 2R7AA 4AY6A 4TYPA 2P75A 3BTUA 3LP6A 5J9FA 2XEXA 4IJVA 3RCBA 2ETVA 2JFBA 4MWGA 3QRWA 3QIVA 1PQYA 4CMAA 2I3DA 1L5VA 1T35A 3A4MA 3LD9A 4MYCA 1EUCA 3AOEC 1VG8A 3H1AA 3SI7A 4D9IA 1ZQ9A 5IDYA 2XLCA 1EXMA 1ML3A 3OKCA 2C5GA 1ESNA 2C95A 3KEOA 2B8EA 3Q15C 4EK9A 2BKUA 4M76B 3WWEA 3UCFA 3B1KA 1Y48E 2FF5A 1E3DA 3R7NA 9LDBA 8GPBA 4G4SP 1K7YA 5JAZA 1P2BA 1N34B 2IBTA 2VDQB 2XE8A 2WJ6A 4AKTA 1UBSB 1OC4A 2BFFA 3UXYA 4M0PA 2Y1XA 4TKUB 2Y1EA 2G28A 5FI3A 4LF6B 1FXSA 4L73A 2HR1A 4HWOA 2XAAA 4MQBA 3R2JA 1V7QA 5HVNA 3KQKA 3LUDA 3QF4A 1TDJA 2COEA 3DF7A 4DTCA 4R81A 5JROA 2XUPA 4JJFA 2HA5A 1EDDA 2YMMA 4UE3S 2WDPA 1X9HA 3AW8A 2WF8A 1KKMA 2RGCA 2EZUA 1DMRA 3CV3A 4PE5B 3W2EA 5I4IA 2F2TA 3A2MA 2FOXA 4WY8A 3ZY5A 1KL7A 2OQRA 1G21A 5HEKA 1FRZA 1NPYA 1E7QA 4HH1A 1F4VA 4XD2A 2VG8A 5JO9A 2R79A 1DHTA 1IUKA 4JZKA 5JNTA 1E0SA 3DLCA 5KTNA 2VOEA 4Z6KA 4YS6A 2R9VA 1RZRD 1YAJA 2FVXA 1KSGA 1XDGA 4R8VA 2F9MA 4D4GA 4LAFA 1QIKA 3DVRX 5DLDA 4P53A 1JXQA 4DAOA 2D1SA 1S2OA 5LBTA 1PLLA 1VB5A 3HNRA 1N3BA 1ZICA 2G4VA 3QXHA 1L3IA 1ECJA 4XSVA 4FJ1A 3OQVA 5K4HA 3FWPA 1IN5A 1KSFX 3PBKA 4PPQA 1E63A 5L3SB 4F1WA 2AI1A 2JI6A 1GRQA 4KVZA 5L6LB 5HJ7A 1NVFA 3VPGA 1ZHOA 1THTA 1VI2A 2NSYA 4Z9XA 5HIAA 3B2QA 1DC5A 3BB3A 4MB2A 2JLUA 4MS3B 5LXTA 4MWTA 1M0EA 4EMBA 3F3MA 3S2YA 3OFJA 5AW4A 3IXLA 1QP7A 4DV2B 1L8XA 1P4GA 5HZMA 4FFSA 4QU9A 5BWNA 4MQFB 2WJWA 4ZYZA 4QPJC 1TZKA 4M9XA 3M9LA 2BEVA 3I05A 2D0PB 4YRKA 1U2DC 4MYTA 3QVTA 2FX5A 2MDTA 2YY6A 1JG1A 3OZRA 4GRIA 3K6JA 5HA5A 3ROXA 3DEHA 1AIPA 4KN9S 3A7DA 4WESA 2AIRA 2IDMA 1PX0A 2XUJA 1T3ZA 2XHEA 4NU0A 5H3HA 1H9CA 1RLMA 1CUVA 3E3NA 4N3NA 4NATA 1F06A 2PAFA 3EJ6A 1HPLA 2W2MA 4OSOA 3R76A 3OD1A 4AWXA 2EP7A 5EXTA 2DR2A 1IEQA 5TY0A 1AA6A 1LRLA 1R8XA 3GJQA 1LBSA 4ZU1X 3DBLA 2QK4A 2HGZA 4P31A 4Z9BA 4F60A 2O54A 3ZLBA 1EQAA 1DKQA 1JN0A 4CLEA 3K9HA 5LYJF 1DRWA 4WBXC 1ECPA 4W99A 4GSKA 4Z9YA 2RGXA 1RQ7A 2ZRDA 2WVAA 3KYCB 5EFOA 2O8EB 1CG6A 1G2QA 2A1TR 1OD6A 3OQIA 5E95A 4MV1A 5M7EA 2VZLA 4KE7A 4YP7A 4J1TC 3WV5A 1XZMA 2G9NA 3WRXA 4ZC8A 1ODFA 5T3UA 5TSDA 1REQA 2GB4A 1DBPA 3P26A 2C7PA 3FGZA 1ADJA 5KCZA 4WW0A 2J0EA 5TEVA 1DEAA 3SS8A 4RORA 1VKZA 1B8VA 1SHUX 3KRTA 2Z2YA 3VOAA 2OA0A 2YWHA 1KQNA 1CXZA 1G20E 1CEXA 3K0AB 1A4RA 5A5VA 3ANLA 4IUBS 3ZEIA 3UGKA 1ZOIA 5EKXA 2PT6A 3ACCA 1J1ZA 3HDGA 2XF8A 2OHJA 3VPBA 4ZGBA 4NNOA 5C80A 1WULS 2H7XA 3PA6A 2TMGA 2AZDA 4RWEA 2B6NA 1A9RA 2R7LA 4XJXA 1U3CA 5CW2A 4B8ZA 5BY2A 1AK1A 1CX9B 1IZ9A 2QRZA 1AQLA 1CE8B 2C98A 3TVYA 1JQEA 2ADMA 2Q0SA 2QUAA 2VRBA 3P2EA 1BAPA 2VXYA 2P5SA 4UAUA 5FOTA 1ZX1A 2J4CA 3BQNB 5BWLA 4HO1X 3GOHA 4D02A 4RZUA 3BUSA 3L0PA 3MJCA 1XJQA 1YHZA 3R4CA 4GOND 4RENA 1H1TA 2ECQA 2WBLC 2E21A 3CGWA 1PQ4A 3CA8A 3FNRA 3E7DA 3AKDA 1R0XA 3WGNA 1KY3A 3NYWA 4BQEA 1F8UA 1PR3A 1XMJA 2I9PA 2CE7A 1QHEA 2ZGVA 3QPUA 4HH4A 3S2GA 5HTOA 2PMFA 4L1KA 4DMRA 1RPNA 1GILA 2IXBA 1PWHA 2QZSA 3ZE7A 1UBJS 2I7CA 2Q3FA 2VDOB 4PGFA 5C1BA 4LF5B 4M1TA 5E6SA 3UEOA 2HLHA 3NDBB 2Z9BA 5BXYA 3H2IA 1R4ZA 4EG6A 2H0QA 1PEAA 4ZVMA 3ZXUB 3DV0B 1GFSA 2W0MA 3PRYA 5KDOA 3QZUA 4RTMA 3H6GA 2F67A 4ZAZA 3X43A 3OF3A 1KC3A 1M74A 3BBLA 1NLYA 4PFSA 4AKIA 2GEFA 1TT5B 3PR3A 3I2JA 4GLJA 3IMCA 4QDKA 3ZZMA 4TT3D 3DMFA 4XUEA 2JGEA 1SY7A 1TGYA 1P4SA 2JLAA 1O94C 4LMAA 1M6VA 2E1RA 3B1YA 1E96A 1FEZA 2CV1A 1CEYA 3MEQA 4HYYA 4JZYA 1YBVA 3SVTA 4XLTA 2A7XA 3IP3A 5A5EA 1IZ0A 1U7OA 1VKOA 2C7VA 3E0QA 2O3SA 1UDWA 3CO5A 4OH1A 3NXSA 1P5HA 3KUKA 3L0YA 5FV4A 4ZQIA 3OCXA 3IPCA 1EP9A 4WFQA 3SAJA 4RVHA 4FYMA 4FKBA 3FFWA 3RBAA 1ZOOA 3OTOB 1RE1A 5C8ZA 3VXKA 1ZUIA 2UYQA 4JODA 1WXWA 3GUYA 1L9KA 4HAWA 1UAYA 4ZDWA 3H5VA 3P2MA 2YHIA 2BGKA 3VHQA 3JASB 4DKJA 4IYRA 1E2QA 4QHTA 3FFBA 1ULAA 3QPWA 4Q15A 1JE1A 1MX9A 3GFOA 3T94A 4EENA 3OQMA 2XUKA 2PZJA 4IUDS 2R60A 4EAQA 4F9GA 1UH5A 2VCHA 1NI4B 1GQQA 3GP3A 2GHTA 4IJUA 4YPOA 4PSDA 2D2VA 1XRLA 3SX0A 1JYFA 5LA6F 3X1DA 2J4DA 5JZMA 5K99A 4HDMB 3T7TA 5CVCA 3WK5A 1ZJYA 4DWWA 2QE7A 2ZYSA 3EARA 5I7UA 2OAGA 2RHLA 2R44A 1DDGA 5REQB 1DWUA 3BICA 2WF5A 2ZT5A 5TPWA 2GH1A 4L8YA 1DCKA 5CK4A 1KDPA 1UMBB 4BMYA 1XNJA 1N2GA 5B57C 2W8BA 1KKLA 4KZPA 1GRVA 2FP4A 2O8DB 2NVUA 3L0SA 4OA5A 5J5AA 3I1JA 3TZLA 3QHQA 5GGYA 4P80A 4HNHA 3WWZA 2PE5A 1X8XA 2G9QA 1V16B 3QVSA 2NV2B 1ZSYA 4LJAA 3PD1A 4DDWA 2AEFA 2AE2A 2MYPA 3IEIA 4F3CA 3LK6A 3NJ8A 4FILA 1EDZA 3ZZ1A 3SFTA 1XTTA 3AERA 3CVVA 4UUPA 4EKGA 1JEDA 4G0VA 4FYWA 1ZH4A 4BMXA 3RS5A 1AZTA 2J1LA 5EFZA 5L6MB 2F1IA 2FSHA 4AZVA 3UJNA 1AZWA 4WA7A 2XMRA 3AOEA 1V96A 2I34A 2QLLA 4O4HB 3EQ6A 3HB0A 3O3OB 4M1ZA 3NM4A 1N3LA 4B44A 4JBGA 4P9NA 3GAMA 2G77B 3K32A 4UDNA 4Y6PA 1EQUA 1A5SB 4IFEA 2BF4A 4K5QA 4WECA 5EXDA 3S81A 4D5GA 1D3AA 5F21A 1F0PA 2A58A 2BGNA 4EG4A 3DB1A 2ZB8A 1EGAA 3P5SA 3DGEC 4HB0A 3AR9A 4DLNA 2HO4A 4QTXA 3WIVA 2XR1A 5D85A 4ZZ1A 5IJ9A 4LY9A 2FMFA 3AR3A 2BE9A 3AJAA 1HF3A 3KSDO 5JE8A 3URMA 2JS7A 4PZ0A 4IDPA 1M6HA 3VH3A 5FUYA 1C41A 3VUFA 2QGZA 2ZRMA 3F78A 1Q7BA 1GPNA 4MA4A 4L3OA 4TQAA 1FP2A 3JRNA 4U0JA 1IDN1 3U7GA 2RARA 1K89A 1ENZA 4BLSA 2PWPA 4JC4A 2VF5X 1YFJA 3FYTA 3L7MA 1XEAA 3KCNA 4NU5A 3MFYA 2QUKA 4KR7A 4Q6WA 2W70A 1GYPA 1BCSA 1MB4A 3VHXA 4CIDA 5KHOC 5CM2Z 2NO1A 3QNUA 1DZ3A 3JAKB 1FYFA 3E9QA 1A4UA 3EZLA 2LGJA 2NYRA 4H6XA 2JI4A 5DB4A 5I8WA 3QBDA 1Y6FA 4OI0A 1FUKA 3WB1A 3LQ4A 5J4VA 1SXQA 2F4VB 2ZLBA 2FCRA 1WY5A 4K6FA 1BMFD 5CLGA 4CUZA 5KQMA 2H1WA 3L8HA 3DMNA 3L1UA 4DG8A 5C7IO 1QB7A 4KDEA 4KQWA 4MWEA 4YASA 1C8LA 1FUUA 3I0NA 3UOWA 4FHZA 3GT0A 5DLPA 3TNYA 1PVVA 4Z49A 2FY8A 2JIDA 3Q5DA 4ARUA 4CKBB 3QSGA 1EM8B 3KEFA 2GXSA 4KBFA 4EMSA 3PU6A 3QNWA 1KY2A 2ACKA 1V9LA 4G0PA 5F1YA 3OZ7A 3RS0A 1P1KA 4EWLA 2PUEA 5JMWA 3Q1LA 2AZXA 1PGPA 4G65A 1NLUA 1Q0ZA 1OLSB 1WR8A 2J7KA 3RVPA 1BE6A 2GCOA 5HUQA 1J2EA 1PJBA 3SX4A 5LU8A 3O2SB 4N0DA 1UBCA 2AUTA 1VIYA 1JNYA 1IG0A 1KVTA 1PV1A 3L40A 5GOZA 3UTCA 3H8WA 3PFNA 3BRCA 1C29B 4UMDA 4Z7QB 1O95C 5JMOA 4WI1A 4AJLA 1O7JA 2ZRKA 2ZIFA 5DCLA 4KCGA 4BLUA 1G4UR 2B2XA 1FB5A 3O4HA 4A2QA 5HFJA 4V1CB 1ZLXA 5LMUB 3HDJA 2WWIA 3GQVA 1J4AA 1M1NB 2JLBA 5AI0A 4CLHA 4H1WA 1K0UA 2B4RO 2OECA 2B6HA 3IUMA 3O75A 4WZ6A 1JSXA 4RL6A 1PYDA 1EP3B 1RHUA 2P6UA 4F11A 2WSLA 1GDTA 1X1AA 2PZEA 3U2QA 4Q48A 4E07A 5I9SA 5BQ3A 3I4LA 3PUHA 4C07A 5IZCC 3OIDA 4XFDA 5LQSA 3U19A 2QRUA 1Z5NA 4FDLA 1Z2AA 1XTJA 1UADA 2WC1A 5J40A 1QKKA 3HM9A 2A9FA 2BUAA 3RRNA 3IAHA 1O87A 1GA4A 4HGZA 4MVYA 3ZHSA 1AB6A 2O2DA 1KKUA 4F96A 5CB4A 2CDBA 1B6RA 1IU9A 4WJKB 3VNAA 2CK3A 4FD2A 5F2KA 2XVAA 2QQ0A 4X6XA 3BSSA 4L4SA 3RABA 2VSQA 2YNMC 3QMMA 4N0PA 5AK5A 2NWQA 4DSOA 2RMKA 3JAWA 3V6LA 4ZDJA 3K7EA 1ISRA 2GESA 3GP5A 4Q39A 1EFUA 4ZCPA 5JDIA 5IBCA 3WLHA 3A6DA 4W7HA 3W6ZA 2QT1A 2VDLB 2DF8A 4G56A 2Y71A 1KO4A 1VKRA 1VGRA 3U9LA 2IYVA 2PA0A 2ZAIA 3PFKA 3ZKWA 2CYCA 2QD2A 3OO1A 4CM1A 2AC4A 4GF5A 1YB1A 3AEZA 2QWXA 3UA3A 2I99A 2QT9A 3DC2A 1KMCA 1KSJA 2ORVA 2XYGA 3IIMA 3DUFB 3E23A 4X41A 4F38A 4MEAA 2QP3A 3HFGA 2DH5A 3QK7A 5AJYA 2PMCA 2XUDA 4HJXA 2UUAB 1BWRA 1JVSA 4OU4A 5IULC 3B1JA 2GMWA 4H17A 3GLRA 4P84A 5E9AA 3QEJA 4G0ZA 1Z6TA 5FBQB 1U80A 2FN4A 5FRDA 5CEJA 2CNKA 3DTTA 5ALOA 1FS6A 2OCAA 3OQ1A 4TTAA 3QHAA 1Y82A 4Y1GA 5LQMA 4PC3A 3J7AC 4M3NA 4O4JF 3EISA 3L4BA 1KYXA 2H48A 3RVBA 1OXKB 1FNMA 2JD2A 4EHNA 1IUNA 2I8LA 1UK9A 1NW8A 2QY9A 2WJ4A 2YASA 2Z5FA 4H3HB 4WNAB 3DG9A 2GDZA 5LP6C 5C8YA 2Z8YM 2BKAA 2WUWE 3UN1A 4ARSA 3OJFA 4CT5A 2RK3A 3M6MD 3SSOA 1EWVA 1Q50A 2YVKA 1YHNA 1N2OA 3JVUA 4LWZA 4R1NA 4RTKA 4EVQA 2FR0A 4UPEA 1OT5A 1NNEA 3HA2A 2QI9F 3S2IA 1EB8A 1I7LA 2ZVPX 4R1QA 4DA0A 3C3KA 1C4WA 3Q3JB 4ZV4A 2I3BA 1TYCA 4RVSA 4TLLB 3L1JA 4N8DA 4V38A 5F9FA 4LQ4A 2HNAA 5IF9A 2OP1A 2PS1A 1SBTA 1VCHA 3JYOA 4EY3A 5K0NA 1VBFA 3WLTA 1IE3A 3PWTA 3DZKA 3GEDA 2QVZX 1MRZA 3W8NA 1XOIA 2W6CX 4XX0A 2F3SA 1VJ5A 1JR3D 3ZOKA 5BOSA 3C98A 2JGNA 4KH1A 1ZL0A 4BO0A 4CEJA 3O3MB 4Q02A 4CIVA 3VO1A 3TRJA 1P4AA 3P97A 3H4VA 1WY7A 1N6NA 4CIAA 2WKQA 4ZQGA 4U63A 1JDBC 1QIGA 2XKAA 2YWXA 4K6GA 3R8FA 5FBHA 2I2FA 2XB6A 3G0CA 3U5ZB 3RIEA 1QZZA 3DBHA 3WYNA 4PG8A 5J2UF 4BXOB 3JWPA 3I1IA 4FE7A 1IY1A 2ZETA 4F72A 4YBRA 2M32A 4UAJA 4I5DA 4OQEA 3HLKA 3L6DA 2OG2A 3EDMA 3UHOA 4PLYA 1T9HA 2I6XA 2P79A 3AFGA 1S89A 4W4TA 3E35A 3UGQA 2ZRNA 3MTBA 1MC4A 1Y9EA 3H7AA 5EPOA 3IELA 3V8RA 3EF1A 5LKAA 4WA8A 3FLMA 3F9CA 3T35A 1Q1QA 4HWKA 1KEEA 1GPYA 2X3FA 2QRKA 1XAJA 4BDTA 1ZEMA 3MILA 3AV0B 4JB0A 1JG2A 4C2TA 4LJKA 3PGA1 4YN3A 1YFKA 1T15A 2ZBQA 3COSA 2W83A 5TQVA 3U3KA 3SP1A 4QPZA 4QLBA 4L50A 1GFZA 2GILA 2YW2A 1W5TA 2D0DA 1MDBA 1PJ8A 4M7WA 1KYWA 1JHDA 1TLFA 5CFMA 2V6JA 4J3JA 5IJAA 4IW3B 3VR1A 1WOYA 5ADUS 5IKEA 3UHJA 1P6UA 4AMUA 4CTOA 1AZLA 3RSHA 2WRZA 1QTQA 1FDOA 5F1KA 3AVPA 1KI8A 2E85A 3CPJB 3EASA 1VRCA 5EMMA 1NSYA 2WIBA 4A0GA 4YXFA 4MDFA 2WIGA 4QM7A 5CA1F 2HA2A 4CKWA 3DT8A 4GBJA 4ZJYA 1MJGM 2G6TA 3DOUA 5KJFA 2JFZA 2WWFA 1WMBA 5FR1A 1J06A 1DEXA 1JEOA 3Q7QA 4KO3S 3GPCA 3K4HA 1SG9A 3ABIA 1PBNA 3L7YA 3T1TA 2PX6A 2G1JA 3L2OB 3H4TA 4WN3A 3RSOA 4HUQA 4JYPA 4D3XA 3QV2A 4IX9A 5EKTA 3WLEA 5BYAA 1J49A 4TZTA 5ENDA 3LLMA 4G85A 1V39A 1UPFA 2AZ4A 3OA2A 3D81A 5DWQA 4DQXA 1QJ4A 3K92A 4P36A 1SHJA 3M82A 5I3CA 2G3YA 2CJWA 1S4MA 1G6HA 1VL2A 3R0IA 1KQPA 1UXKA 1T1JA 1T36B 4HH3C 3CNNA 3EODA 1QFMA 3AHGA 4PHFA 2OSBA 2D62A 1OBVA 3NRCA 3EULA 1F8GA 2YICA 1CY2A 3M3PA 2H16A 4CM9D 3LZDA 1U2EA 2VIIA 4DMUB 4E13A 3QEBZ 2AA3A 3U7RA 2P30A 3TZEA 4YFVA 1A9OA 3BIWA 4QM6A 4UTPA 3QLTA 1W48A 1C9KA 4I4IA 3ND6A 2HNKA 4U9IS 4CQJA 2EW1A 1YZ3A 4YCLA 1E62A 3BX1A 3HCAA 1BCRB 4QAJA 5KQRA 1GG5A 3HYSA 3U81A 5ICGA 1Y98A 5TMBA 1F5SA 1ZN2A 4ZTBA 4RS3A 4QYIA 3THWB 1GG8A 2ZPTX 3C85A 2FOLA 1FU8A 3QI2A 5B37A 1K2WA 2JBAA 4KGVA 4W5HA 5EJ7A 3F5FA 1L7PA 4UMFA 5HFNA 3PNPA 4RD3A 4A36A 5I01A 4ZO6A 4LECA 3L8EA 3R6DA 2QDXA 2GEVA 5JD6A 5KTMA 1FXWF 4UBIA 2AXNA 3TAXA 3WBFA 4B9AA 2D1QA 3KK0A 4TTRA 5F1OA 2HK9A 2GX6A 1LKZA 2LDXA 2XTMA 1LFAA 4EW2A 3A04A 1UK7A 4QIHA 4TRNA 5AJZA 3USCS 5AW2A 3FFAA 3LZCA 5DO9A 2DT5A 4AJKA 2WJHA 3FVQA 2L18A 4YUAA 1T1EA 3NHFA 2GXAA 1V8OA 1WPQA 1SMKA 2BYTA 2UZ4A 4XVRA 4UBJA 3UMFA 1TF7A 3GB9A 3SC2B 1QGOA 2PIAA 2GM4A 4I6GA 3TZ6A 4EGJA 1XCGB 2N47A 2OZVA 2G40A 1UEJA 4MV4A 5JFOA 3K4QA 3K0FB 4HMOA 1C3OA 2IIVA 3VBEA 2XMPA 4TV9A 2I2BA 3AIKA 3GUHA 2XQVA 3ANXA 3OM0A 5AVWA 4RGQA 1JG6A 4L5AA 5DLYA 4I55F 3K9CA 3GV0A 5C32A 3QTLA 2A84A 4R9VA 3ZDXB 4AMYA 4AXBA 4Q7MB 4WZBA 4U1RA 4N3AA 1MV8A 4B35A 4JLNA 4EPVA 3X1KA 1JKIA 4C1NA 1TKRA 2DPGA 1OWOA 1EEHA 1XZEA 2ACWA 2X4DA 4IDFA 2PXAA 3UK0A 4BGVA 4C4AA 4PBTA 3A8TA 1FF9A 4NJOA 4PLHA 4BB0A 1F38A 4RPHA 1E7WA 4P5PA