4RFSB

Structure of a pantothenate energy coupling factor transporter
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
ENIISVDHLTYQYDENQAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSLDGLLPFTQGSVTVGGITLTPETVWQVREQIGMIFQNPDNQFVGATVEDDVAFGLENRQISRDEMVPRVQAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEMGLDLPFTEKLKAALRQRGITPPTTYQTAAEMEEWLWQSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Energy-coupling factor transporter ATP-binding protein EcfA2
publication title Structure of a pantothenate transporter and implications for ECF module sharing and energy coupling of group II ECF transporters.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase, transport protein
total genus 72
structure length 275
sequence length 275
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rfsB00
3UMFA 4B47A 1TF5A 3EAQA 3A4LA 2ZITA 3I1FA 3C4JA 2FH5B 3ZVRA 2J45A 4GRAA 2FFBA 1DOAA 3WBKA 1EK0A 3D3QA 2BCGY 1R8QA 1SVWA 2C96A 2OM2A 1JXOA 1KO5A 2XSZD 1WB9A 1CJVC 1KJYA 4LYFA 1ZCBA 2BVNA 1NSTA 3B1YA 1E2EA 3B9QA 1IBRA 3IDQA 4MRVA 1SZPA 1GRNA 5JHHB 3EWSA 2AFIE 3EPHA 4M1MA 1N6OA 3CRMA 3SJAA 1Y3AA 3EC2A 1U81A 3GJ8A 3K9NA 3L0SA 2RGGA 3TSWA 1X3SA 1Z6AA 4R71A 5HKKD 3ZVNA 2AHOA 3WP0A 3TVTA 4TYQA 2O5VA 4PQYA 3AEZA 3A8TA 4JS0A 4L5BA 4EQ6B 1YE8A 3RC3A 5CLLA 1YZLA 4DVGA 4IVPA 1E4YA 3FHTA 4IW3B 3KTAA 1PUIA 3CPJB 3TK1A 4B6FA 4DB2A 2ZEJA 4JJKA 3K9LA 2QP9X 3QF4B 1YZQA 2ZJ8A 4TL9A 1IHUA 1XU4A 3CONA 2ZSFA 3FMFA 2G77B 2GRJA 2G9NA 2WKQA 1VYTA 2BHRA 3PXGA 2RGEA 1L2TA 1Q1QA 3CX8A 3CH5A 1Z08A 4D4KA 3Q5DA 1Z6YA 2YKGA 3A36A 4UNRA 3THXA 3WXMA 2PT5A 3PEUA 4Q66C 4TQUS 2QUZA 1G3MA 3SQXA 1OE0A 2ECKA 2YC4C 3CB4A 1N5IA 2CNWA 4Y0VA 2X2FA 5JRZA 2Q6TA 2QN6A 1XXHB 1II8B 3B2EA 3GMTA 1CP2A 2F1RA 4IVQA 1VECA 4RD1A 5K8TA 2GXAA 1EGAA 3GEIA 2E9SA 3C5CA 4JT2A 5DO9A 4FWTA 3VU9A 4HI0E 1DO0A 2X19A 2ZANA 3RYTC 2FMXA 1T8UA 5EE9A 2ZE7A 5DI3A 3G82C 5KDOA 2BJVA 3BC1A 3ZJYA 3T61A 4DJTA 2DFLA 1KI6A 2WBLC 2NGRA 4DCSA 3CNOA 4HLDA 3WMEA 1GOTA 1FOEB 5TMPA 1N5JA 2EFCB 4C0HA 5C2JB 1J99A 1MO4A 4TN1A 2D06A 3JVUA 5BN3A 1MT0A 4P4SB 1YR7A 2B8TA 1J7KA 1DADA 1U94A 4XTRA 4QC2A 1E1RD 1I2MA 3I73A 4EFNA 4R2HA 4LSGA 3K70C 1U90A 4LHYA 4QBHA 3UWOA 4HSEA 2V4ZA 5TDHA 4UXHA 3L2OB 3U44B 1AKYA 4TZ6A 4A15A 1NNEA 3U44A 1RKBA 4DXAA 3N2EA 4PX9A 1KJWA 2E1RA 1GL9B 4QHSA 3SYNA 4Y0AA 1W36B 5L3SA 1YZKA 5E3HA 4UNQA 3UWKA 3EZ6A 1KK3A 1VTKA 4BZQA 1E0AA 1U8ZA 4RCZA 1CTQA 3M1IA 1G7SA 4PZZA 5GJBA 1FX0A 2XB4A 1A7JA 1QZXA 4C7OA 1WP9A 2PCLA 5JHGB 1W2HA 4C7OB 3BFKA 2UZIR 1M1YE 1WQ1R 2TMKA 4A4DA 3B6EA 4Q9JA 5GADl 1CRPA 1K8RA 1XJ0A 4IEEA 4M0LA 3O8RA 4BGDA 1VHTA 3QOFA 4EPYA 3V4FA 1VPLA 2JCSA 3ZLJA 5K8IA 3BIFA 4KBGA 1KDPA 1R4AA 2I3BA 1XCGB 2ZAMA 4KYIB 1W44A 5TARA 3H1TA 1R0YA 4Q7MB 4UJ5A 5KDLA 3AF4A 3GFPA 1H8ED 4Q1EA 4URZR 2ZJBA 3KKPA 1IM2A 1Q1BA 3LRPA 3VU9B 4B3DA 3KFXA 4Q1BA 1D2MA 2YOGA 1AIPA 3KXLA 4MKGA 4C30A 5FUXA 2O8DB 1AS0A 3O8BA 2D2FA 4F91B 3PEYA 1UJ2A 3PR1A 1ZUIA 4M8NE 2YHSA 5L3QB 4NCHA 2Z0MA 1KSGA 1W4CA 1NIJA 1FTNA 4P4SA 2WWGA 4QKQA 5ANRB 5BQ5A 1RRFA 2V7QD 1TF7A 3K0CC 3A1WA 3K0CA 4Q4JA 4C0LA 4YXWD 2B8WA 4MDFA 1YQTA 1OHHA 4KYUA 3DMDA 3LLUA 3QPUA 5JS7A 3GD7A 1EWQA 2DWOA 3GP8A 4HLCA 4PAQA 2P2LA 1Z3IX 4HAUA 3LDAA 3AVVA 1F2UB 5F3WB 1SHKA 5A4JA 4TTPA 5EUQB 3U3MA 2O8DA 1G19A 4KODA 2XEXA 4U00A 2YINC 3DPUA 4FIDA 2IYSA 3IQWA 3GLGA 1GG2A 3NH6A 2OXCA 3QE0A 5EXTA 1CIPA 3QENA 1X8KA 3OIYA 1CJTC 4DZZA 5J4HA 4MYUA 3C15C 2Q21A 5JJIA 4RD6A 3KQUA 4Q1CA 1RRCA 1GFIA 4GOJA 4OQFA 621PA 3TRFA 4AKIA 4UNSA 1IY2A 5TB5A 3TSOA 4AI6A 4RD0A 1A1VA 4DUGD 5KSYA 3UG6A 1NVWQ 2WJGA 4UJ3A 2Q3MA 5CDFE 1V43A 4FN5A 3RRMA 2DY1A 3EIHA 1NY5A 4F7WA 1EESA 5DYGA 1Z8FA 1Z0AA 2QTFA 4ZKDA 4GPTA 5JEDA 1UKYA 1CR4A 5FL7D 3GLIA 2CBZA 4QBGB 1TAGA 5A0FA 2IYZA 3AGPA 2FX3A 2W0MA 4HUQA 3L0IB 3WYFA 2NPIA 2ZRKA 3QEJA 3PUYA 1AQUA 5AWFC 4F4CA 1Z63A 4EPVA 1OIXA 1EWRA 2GZHA 5EE3A 1YRBA 3MSXA 1E1QA 3B7GA 3X1ZA 4OJKA 5GJCA 2CHGA 1OF1A 1GSIA 1HUQA 2C03A 3IIJA 3HWSA 2FOLA 1L7VC 2IC5A 3L82B 5FPTA 4CF7A 3PJRA 3AM1A 2FNAA 1XPRA 4PC7A 1FUUA 2C78A 3PIRA 4Q9LA 1QHGA 2VP0A 3IHWA 4B35A 3UPUA 2H18A 5H70A 2FEMA 1U0LA 4DUGA 1DTSA 2FPLA 1X6VA 3W6NA 3NWJA 2NQ2C 4EFMA 1XZPA 2QP3A 2WJHA 4NH0A 2PZEA 4ACAA 4OI0A 1WF3A 2QY9A 5CYPA 2DB3A 1TPZA 1YZNA 3CBQA 2O0KA 5FL7A 4DCUA 2IS4A 3NEJA 2W6JA 2JASA 2FPKA 2FF7A 4K81B 1E32A 2I4IA 4DC9A 4S35A 3THYB 4MRRA 4HZUB 1D2EA 3CM0A 2NTYC 1TADA 3Q3JB 3VFDA 5E7IA 4Z1MA 3P32A 3IO5A 4CGZA 4BPBA 2AN9A 2R6CA 4YMSA 1SXJE 4A2WA 4LPKA 1HY3A 4B48A 4G5SA 3QEOA 4YONB 1W48A 1DAIA 2JA1A 3IBYA 4QXAA 3SNHA 2CMKA 3TNFA 2GF0A 5IF9A 3V9PA 4HZIA 5HCIA 2IW3A 3TW8B 4BASA 3EZ7A 1ZC4A 1TU4A 3KXKA 4NCNA 3VKWA 5JMTA 2GNOA 1LB1B 2YVUA 5FTJA 3THOA 3U7EB 2IHBA 2IYRA 2V1UA 3CLVA 4B33A 1HT2E 4HB2A 4LZZA 3K09A 3QF7A 2IS2A 2YWEA 4D6PA 2QBYB 5EXPA 2GBLA 3KQHA 2FE4A 2JLYA 1N0UA 3LBIA 4KSBA 5AJXA 1L4UA 4PZYA 1KY3A 2ZM5A 2KB0A 4C0AC 4A8JC 2FSFA 2BKUA 3HPRA 4W5JA 3NXSA 1NN0A 1RW4A 3DL0A 3U60B 1KDTA 2NOAA 4ARZB 1G18A 4HAZA 5FI1B 2H1LA 4FINA 1GDDA 3VR1A 1OH6A 1IJFA 5FFMA 4GZMA 5JECA 4IDHA 3ZQJA 1XTJA 1T4GA 1NMYA 2EVWX 3HU3A 3WRXC 2A5DA 4RJLA 5FPYA 4HYYA 4TSFD 4ESVA 1II8A 5JEEA 2O8EA 4DB4A 2ZRNA 4X8OA 5DHAA 4B34A 3FOZA 2IL1A 4TMWA 4DLTA 2B6HA 1E6CA 1NVVR 2DWQA 5CJ2A 2PMDA 4IXMA 2JIZA 3DKVA 1E96A 2G0NA 2BC9A 5BN4A 4W5HA 2FSIA 4DLSA 4ERNA 1VKJA 1CU1A 2WJVA 4U5XA 4YMTA 2XAUA 5TY0A 1QHHB 2HYDA 3LQQA 1XF9A 3ZIAA 2C99A 2REOA 4NP6A 1NL3A 5HE9A 1KSFX 3FPAA 3X2SA 3WRYC 1RZ3A 1NMXA 3VR4A 5G40A 5HZHA 3IBGA 2IHYA 1F2TB 1IXZA 3VKGA 2KSQA 4WA7A 3I3SR 1XTSA 2QENA 2ZS8A 3MCAA 4LJ9A 4QBIA 4IFEA 1IONA 2D7DA 4PHGA 4TSFA 5CM9C 2CLDX 5K8UA 1JJVA 3BOSA 1U8AA 2QAGA 2QTVB 3ECCA 5TVKA 2IK8A 4Q01A 4TLCA 1XMSA 4ZPXA 3UK6A 5EXXA 2ZI3A 3NBFA 4TMVA 4GL2A 4DDUA 4L8GA 1E69A 4GNKA 3T5DA 4RD3A 3SBDA 3G5UA 2VEDA 1NN3A 3IKJA 3JZAA 1UF9A 2AX4A 4I1OA 2YWHA 4KSCA 5AUPB 4LBYA 2VA8A 1GILA 1NI3A 2BEJA 2ZR0A 2R6FA 5DIFA 2GJ9A 2R2AA 5FTMA 4R9UC 3ZZUA 4EJSA 3KQNA 2AL7A 3AVXA 4GOXA 1RIFA 2P5SA 3BAFA 1YR8A 1H8HD 2BWJA 5J4VA 4WXRA 5LB2A 2OFWA 1YZTA 3T5GA 3BB3A 4MGKR 3KX2A 1CR2A 4JLNA 1KYIA 4EPRA 2MSCB 5JJKA 3M4YA 1KI1A 1E2QA 3DHWC 3IHLA 4ZI2A 4AIIA 1IXSB 3CF2A 2QSYA 3QKTA 3KJHA 5HCNA 5IK2A 5JZVA 1E2LA 4AKEA 1XNJA 4CIDA 2NO6A 2QE7D 1LS1A 2C04A 2BMFA 4P3YA 4JYBA 2ZRHA 5JBQA 3HJNA 1DAGA 3AKYA 1ZW6A 5FR1A 3RLFA 2IYQA 5AR1A 4BFSA 3NEYA 3GJ0A 4GI7A 2HCJB 2YC2C 1JR3E 2XITA 4XD7D 3U3RA 4TL7A 1Q0UA 4D0GA 3IO3A 1OXSC 1TQ4A 2WHXA 2ATVA 5C46F 2GK7A 4C0QC 1EX6A 1HE1C 3VMFA 3SI7A 5FPKA 1S0UA 3QXHA 3VAAA 4O3MA 1IJEA 4NONA 3SE0A 2OT3B 3VR2A 2WTUA 2I1VB 1XTQA 2VPPA 4TLBA 1ETUA 4IXNA 4PSVA 3IILA 1N6HA 2IEYA 1MO6A 4Q48A 2QPOA 3TIFA 2N1BA 2CHQA 2SHKA 4XSGA 4UQOA 4C2UA 4B3XA 2DWPA 4NDZA 2Q9CA 1R0XA 1TX4B 3KJIA 4RKEA 4N1AA 3L8ZA 4JVMA 3KTAB 1CULC 4OYHA 3FTQA 4DCVA 1Q57A 4FI3C 2HT6A 3DKPA 3CR8A 2ZUBA 4PSAA 2PT7A 1YZUA 4E5UA 1NG9A 4PC2A 3EIEA 3X1WA 4IOJA 1T9HA 1X1RA 2VP4A 4Q18A 1DAEA 1Z47A 2VHCA 1PV4A 1UADA 4KAXA 1WBBA 2FFAA 1UKVY 5DGXA 3K70B 1BO6A 2PX0A 5BW8A 2CDNA 2DR3A 1CLUA 4OL0A 1S96A 1UAAA 2PZFA 4KO8A 4AD8A 3P26A 1G3IA 4HAYA 4ZKEA 1VIYA 1W0KD 3D7MA 4DSTA 4IFBA 2Y8EA 4B74A 1E94E 1NVUQ 4DDTA 3QBVA 4N0EA 1L8QA 4JVNA 5G53C 4CT5A 1O87A 1NN1A 1KAOA 4F4IA 1QG4A 2KBEA 2XOKA 4GMXA 2AK3A 2GCOA 3DMNA 5HPYB 1YKSA 1BH2A 2VQSA 4DIDA 3K0FA 1GITA 1OB2A 5FUVA 3BFXA 2CNWD 4PHTA 3B1VA 5UKDA 4DKXA 4ZDKA 2OFOA 3T1TA 1VYUA 4CT4B 4ZI3A 4JYCA 1IAQA 3TQCA 2ZUDA 5DYIA 3RC8A 2D2EA 2A30A 1RVDA 1ZD1A 4UKDA 1JAIA 2GCOB 3GCGA 4PC1A 3SHWA 4V0OA 4LOAA 5CK5A 1T0JB 3OESA 4WW0A 3WHKA 5JCZA 4HDQB 1E9BA 2W83A 3Q7QA 1NKSA 4JLPA 4W9MC 3TAUA 3AVTA 2W0SA 1E2GA 3PUZA 1SXJC 4OQLA 121PA 3K53A 3QKUA 3C14C 1YU9A 3GLHA 2QG6A 3SHFA 1LW7A 1SVSA 1EFCA 1T5LA 1DELA 3EWAA 2X77A 4Q9KA 1NJGA 2RGBA 1DARA 4JVSB 4M21A 4A82A 4GP7A 4AKHA 2IXFA 1W4AA 2A78A 3BB1A 1P61B 3VR6A 4C0BA 2OEPA 5LDDC 2VH5R 4HAVA 1MRNA 3EZFA 4CEJA 3REGA 4GOKA 3ZIAD 4MRPA 3SZRA 1YZGA 4P4TA 4ZV4A 1ELOA 2CJWB 1FTSA 2CCJA 2GVZC 3ZYCA 4JZKA 3EPJA 3ICQB 4XOIA 2QT1A 2PCJA 2NIPA 1P3JA 2R6GA 3ZH9B 3EX7C 1COWA 2ZPTX 4OK5A 2X1VA 1Z0DA 1GTVA 5D3MB 5SZIA 1CS4C 3N70A 2R6AA 4URWR 3NHBA 4V03A 3B82A 2QEQA 3EZ9A 1IN5A 4JLAA 3WY9A 2CL6X 2HEIA 4HDOB 4HAWA 3VHXA 3CRQA 3MRSA 1P60A 2NO9A 2ZJ5A 1MO5A 4A2QA 2DYKA 1KY2A 2FN4A 3GQBA 3QXCA 4KU4A 3NVAA 4MA4A 4PQFA 3Q9LA 4RVCA 1TU3A 3TUZC 1Q1ZA 3CRVA 1QHHA 5DI3B 5GVRA 2QL6A 4LHVA 2ZE8A 1FQJA 5DE3A 3GPLA 1W49A 5KSPA 5FBQB 3P4XA 2AXNA 2YOHA 4FW9A 2C5LA 2JEOA 4JSTA 4NL4H 1KO4A 1VG0B 4AURA 4KVGA 3E5HA 3WHLA 2VTKA 3U5ZB 2GCPA 3TH5A 1MH1A 2RGNC 3C5HA 3A4NA 5CITA 5DHFA 1F6BA 1IOZA 2AFHE 1HA3A 3KJGA 2OG2A 1AQYA 2QQEA 1Z83A 3CRW1 4PQRA 2FPMA 5AUNB 2ZRPA 2HXSA 1VYVA 2OBMA 1JPJA 3IPYA 3HDTA 2IYLD 3CUEF 3AKCA 2GWHA 5IK2D 3OFNA 5AUQA 3ADBA 1U0JA 5CIQA 1MR3F 1FQKA 3UKDA 2I1QA 2X2EA 3DZ8A 4PTLA 1KHTA 2ZS9A 1JAHA 1AGPA 1JQLB 2ZUCA 4TL6A 4MRNA 2O8BB 3VR5A 1W4RA 5BYKA 1XTRA 1Z07A 4DLRA 1T3SA 2J0UA 2J7PA 3OEHA 1UM8A 4BE7B 1W36C 1H8EA 1ODFA 2WOOA 2WSSA 3D6TB 5IHPA 1E2JA 4Q47A 3CF6R 1FPMA 1GWNA 2ZVPX 4GP6A 2QT0A 1SKYE 3SOPA 4IKEA 1G9XA 1FL9A 5AJZA 1U2RA 1N0VC 5C4MA 2H16A 2OV2A 2ZU0C 2WMNB 5TV2A 1X8JA 1XEXB 3F0TA 2EYUA 4KFSA 5J4YA 1KDRA 1P4SA 3R9WA 2H57A 1XMVA 3HP1A 1DVRA 1KI7A 3RWOA 4CVNA 3MLEA 2GK6A 4KFUA 3QIAA 3GLFE 1XJCA 4O25A 1G3RA 1SVLA 1VCMA 5HTKA 2OAQ1 4BQSA 2RGAA 4M53A 2RGDA 5JFGA 3ZD6A 1Q20A 3RRYA 2IYTA 2JATA 4FMBB 4TLDA 2IUSA 2J7PD 4XH9B 5FI0B 3WNCA 1R7RA 2RHMA 2XB2A 3N2IA 1Q3HA 3DOFA 3KZ1E 3H4MA 3PG5A 4TMKA 4RFSA 2H92A 5JSZA 4JT4A 3TW4A 2HDNB 4HB3A 1KO8A 1ZINA 1ZUNB 1G6OA 2GJSA 2ZJZA 4DRZA 2FZ4A 4URYR 5EP2A 4MGIR 1UDXA 3ASYA 1XXHE 3LX5A 1X86B 3FKSD 4NTZA 4BLSA 4DEXA 2XNSA 1LS6A 4XWAA 4B3CA 1W0KA 4LYAA 3CNNA 3I32A 4DLWA 2BMDA 1G4AE 1QHSA 2LCFA 3KKMA 4ZDWA 3ND9A 4YQFA 1NIPA 3SR0A 3K0AA 2OXRA 2JLQA 1JXMA 4V0MA 4H1UA 2WJIA 1DEKA 3I62A 1KNQA 4C4PA 4DLYA 1VG8A 2QAGC 3O47A 4FWIB 1G16A 4NYJQ 4ASUD 2FFHA 4XVQA 5JJLA 3GJ3A 3QXJA 2OAP1 1E2HA 1U99A 3QPWA 2VO1A 3I8SA 3EPKA 5FTNA 1KKMA 5LD2B 2OCPA 1Z6XA 1BIFA 4URUR 3BORA 1HQCA 1W47A 4BLOA 3QUSA 1N6NA 4EQ6A 4D25A 3C41J 1NP6A 3IQXA 5DH9A 2ZE5A 1I4LD 2IEZA 4I4LA 1GAJA 1KI3A 3U61B 1N3BA 1G7TA 3D31A 2OUKA 5IDVA 1RJ9A 1ZM9A 4Q21A 4Q19A 2QAGB 4WBSA 1HT1E 1W46A 2YJTD 2ZI6A 4ITRC 2RHDA 3A58B 4G5GA 1GKUB 1E9SA 1P2SA 3MJRA 4JLBA 3FMOB 2VP5A 2RGCA 2D7CA 1ZNXA 2CE2X 2J0UB 4O2RA 2WIBA 2G3YA 1CR0A 4P33A 4E22A 2EW1A 4JLDA 1R5NA 4RZXA 5KO2A 3UXMA 2F43A 1SQ5A 3W34A 3PITA 2QRNA 4RD2A 2AWOA 2JLRA 4L15A 2D62A 2MMCA 3TQFA 2GEUA 1KDOA 2CLSA 2JJ2D 1KK0A 3R9IA 3W9YA 1SHZA 4DCNA 1US8B 3MWKA 1RYHA 3ZS8A 2IYUA 4MDEA 5EXSA 5CDFA 2NO1A 4L16A 2ZXUA 3P27A 1LNZA 3S1AA 3MWJA 4P0TA 3ADKA 2KBFA 4BFYA 4Q1FA 4HUTA 4Q00A 4A0RA 2O8EB 4F38A 1YJ5A 2ODBA 5F9FA 3U2QA 2IUUA 2DFTA 3NBXX 3RS7A 2IUTA 4CZ2A 5EP4A 1OXUA 3NDPA 1NBMD 3SJBA 4NYIQ 3OAAA 2H7VA 2J87A 3LW8A 1N6LA 3K9HA 4X8HA 2J41A 1E98A 2O8FB 3LO5A 1ANKA 4BLQA 3H0KA 2OLJA 4TQ9A 2MMGA 2DFKB 3RABA 1AK2A 4PPNA 1E2PA 2IXGA 3KUDA 1MV5A 4V0KA 4YMWA 4JJZA 1UBFA 1YVDA 3FFBA 4JBWA 3THWA 1KGDA 2CLCX 1SKYB 2XNDA 3AB3A 3DVLA 1PUJA 1HH4A 3ONWA 1ZD8A 5FR2A 3RS4A 3RRNA 3W5JA 3K0SA 1X1SA 4LI0A 2JLUA 2XXAB 1XB2A 1QHXA 4LUCA 2JAQA 4YDSA 5KSZA 1WBDA 3LFUA 4OI4A 1E79A 1ZP6A 3K09C 3RRZA 2XTMA 4QJ5A 5FBWB 4TQAA 4XSHA 3CPEA 2C77A 2P65A 3ZVLA 1OKKA 2IBMA 4V0LA 4A92A 4JIMA 5JI3E 1LY1A 1IN6A 4A8JA 2CL0X 1N5LA 4NYMR 5E4FA 1GNQA 3AF0A 1G8GA 5JWRA 2FWRA 2ANBA 4JKIA 2GXSA 2QSZA 3T1OA 2C8VA 2ZRBA 4EKDA 1W7AA 1PZNA 1G1MA 1OIVA 2J9RA 4PHHA 1DAKA 3IPXA 3KFVA 3A4MA 4NYMQ 3MWYW 4EJSC 1ZUHA 1E2KA 1U0HC 2X8AA 5FOXA 3AP3A 5DISB 5J5CA 2R65A 3MGCA 4DWJA 1BYUA 3P4YA 5EUMA 3QI2A 1D5CA 3I8XA 1L4YA 1QHYA 3RS5A 4C9BA 2J0QA 4BEJA 1Z5ZA 2ATXA 4G3XA 4UNNA 2F1HA 4EPTA 1K5GA 5JCPA 4JL5A 1G20E 1N5KA 2NZ8A 2HXYA 1N0WA 1ZCAA 4KFTA 2NG1A 4DDWA 3BXZA 4KJZA 1OFTA 4NHOA 3E1SA 4LYHA 4WOPA 3PVSA 2OHFA 4LK2A 2EQBA 2P0EA 4POAA 4DT1A 5CYOA 2IS6A 1ZM3A 1KSHA 2AKYA 1KMQA 3H84A 2V6IA 3I4LA 1T8TA 2W2TA 4PANA 1B23P 2WWIA 4LC0A 4RZUA 3SFZA 4A36A 4QHYA 3UIEA 3Q85A 3A1VA 1S1MA 3HYRA 4L9SA 3KDSE 1DAMA 3LW7A 4WIAA 3TAHA 2JLVA 2K5UA 2Z83A 1FNNA 2J46A 2PMKA 5G3YA 5DLQC 5FPHA 2FZLA 4NCJA 4LJ4A 3AGQA 3WNBA 4ABYA 4Q4HA 4FMDF 3K8YA 4EPXA 3A37A 1AA9A 3MG9A 4QM7A 1NG1A 2IYXA 4B2IA 1ZC3A 1FX0B 4R7ZA 4HATA 1W5TA 1G8YA 4TMTA 4BLPA 2AXPA 3U3JA 3AKEA 3SEAA 1E0KA 4LCBA 5FUWA 3TGPA 3NBYC 3EA5A 3AP2A 4YXWA 3KXIA 2GVDC 5J4LA 1IXRC 1YHNA 1SVMA 1JECA 2ORIA 1MRSA 4Q4AB 4M1OA 4LV6A 3LV8A 2WPDD 4TL8A 4CRWB 1GL7A 4LPSA 1G41A 1EFRD 3KJEA 3U6BA 3RS3A 2FEOA 1JEEA 1ZIOA 2ZETA 3B1ZA 1UBCA 2ZE6A 3K0AB 2REXB 3N5CA 1NF3A 3GLGE 2QU8A 4WXPA 4R98A 4Z1MD 1XDBA 2VBCA 1G5TA 1VIAA 1JALA 1OXXK 5BWMA 4XTCS 2Q9BA 1JR3D 5IRCD 4CEIA 2BMEA 3ZD7A 4YLGA 3B60A 2BBOA 1ZIPA 2QORA 3FKQA 3SU8A 1AZSC 3JVVA 2ODWA 3P1JA 5EJEA 2VL7A 2YV5A 4C0SA 3BWDD 1KO1A 2IYWA 5C18A 3F3YA 3FHCB 3PV0A 1M74A 2NO7A 4QM6A 4Q7JB 1SVIA 5FL3A 1E9CA 2BM1A 1G8FA 5FPSA 4P32A 1ESNA 3MJHA 4PPQA 3NC0C 3TVDA 3P20A 2OCAA 2W2XA 4M1YA 3QKRB 5IT5A 5KPDA 3L0OA 4ZIRA 3U4QA 1HYQA 5BN5A 1ZYUA 3PUWA 3NC1C 2E87A 3SJZA 4WZAE 1V5WA 2NZJA 2WM9B 2QBYA 5E95A 1T3LA 1RYFA 1S3SA 4GSYA 4BFWA 2HCBA 3THXB 1RRGA 3K1JA 1F2UA 1Z6TA 5BYJA 4AYWA 4AY2A 4C2TA 1XZQA 1ZM4A 4TTRA 4A0HA 4IOKA 2G83A 3DO6A 3QG1A 1G291 1C1YA 2ZAOA 4MUBA 4W7SA 4FCWA 3SQWA 1Q22A 1OH8A 1GM5A 6Q21A 4B32A 1P62B 2XZPA 3VNVA 1MOZA 4U7DA 3U3KA 5JS8A 1XJQA 1T5IA 3ETLA 5KPJA 2F3TA 2XXAA 3FGNA 3SYKA 221PA 1SULA 3FHOA 1R0ZA 4D0LB 2DCUA 3TKLA 2ZIAA 4MGYR 4N3NA 3B5JA 1NBMA 3R20A 2BMJA 1II9A 4H9GA 3VQTA 1R8SA 2A5FA 2JIZD 3J81k 5F98A 5LBIA 2C9OA 1RC8A 4OK6A 3AVUA 1E9RA 2C9YA 2J5XA 1KI2A 2H17A 2WJYA 4M1SA 2ONJA 3W8NA 4G5OA 1AS2A 1IN4A 4NE2A 1FUKA 721PA 2DFNA 2QM7A 1KOFA 4L4UA 4PAOA 1ZNYA 2QRZA 2FA9A 1FP7A 5AJWA 4BFXA 3K70D 2JGNA 4KBFA 2ZU6A 1KTVA 1JNYA 3QKSA 2A2ZA 1R5BA 1UBEA 1KI9A 2HJGA 1A82A 1IY1A 1PJRA 3CO5A 4BLRA 1TNDA 2P5TB 4RCYA 1BOFA 4B73A 4AWXA 1GKYA 1WRBA 4Q9HA 1S3GA 1PLJA 1ZNZA 1J90A 1OH7A 3SC3A 5SZHB 2EFGA 4BRWA 2YWFA 2GJKA 1OT3A 1Y63A 2GDJA 2J1LA 4ZDJA 1BMFD 4K46A 4WZ6A 2PL3A 2Z4SA 4LX0A 4B2PA 1NVVQ 1QF9A 2F1IA 2ZYWX 4UNPA 3QPVA 1OKKD 2HF9A 1EG7A 4I1UA 4D82A 3SJCA 2QQ0A 1VHLA 2ZSBA 2DHRA 5L3SB 3CIOA 1TMKA 1Z29A 3GJ6A 3OIWA 2FGKA 4HAXA 5D3MA 2WWFA 1WCV1 2NO0A 3E2IA 1C9KA 4LRWA 4OHXA 3PEWA 2O0HA 3G0HA 2CL7X 2UZ3A 4OHZA 2CK3D 2J0SA 1GL6A 4HLUC 3UMSA 1PVOA 2OCBA 1F5NA 3RANA 2REBA 8OHMA 1S9HA 1SXJA 1JQJC 1J8MF 5DI9A 4MKHA 1SXJB 3QXXA 4I81A 2HYIC 3FMPB 5H68A 3UATA 3ZS9A 3LVRE 2ODEA 1RPZA 2ORVA 2CVFA 2EWVA 2VSFA 4XVUA 2JJ8A 1E2DA 5FTLA 1F60A 2AD1A 2RH5A 4AYTA 1IN7A 3OIUA 3QG5A 2IWHA 1OHHD 4MYTA 5FBLB 421PA 4B75A 4TT3D 1OW3B 2V7QA 5JWOA 2ORWA 2XTNA 2ZRFA 2FGJA 2QE7A 3L0PA 2BBSA 1G7CA 1RFLA 4JLOA 4BFTA 3OIVA 1Q44A 4LV5B 2F9LA 2ZI9A 1GZSA 1E99A 4FCTA 4KI0A 4RZ2A 3LA6A 4MGZR 2O52A 4AG5A 1OSNA 5H8WA 2CK3A 4O2LA 1OXTA 4PO8A 2BCJQ 1U98A 4NCKA 3KB1A 4CEIB 3QKSB 4TLEA 1OFHA 4TYNA 2WIAA 5KTYA 2ZRJA 4OK3A 1G6HA 2OZEA 1FFHA 2ZSDA 3KUCA 4M22A 4P31A 4X8LA 2Z43A 3CWQA 1D2NA 1G8PA 4S2EA 2XZOA 1G17A 1VDZA 4OHYA 3I92A 3M6AA 3OFND 2D4HA 3QQ5A 3U6KA 1P2TA 2YOFA 3ZZ0A 5F2EA 4M2LA 4HB4A 3QF4A 5KU1A 2KWIA 3WMFA 3TUIC 2G1JA 1CKEA 4LBWA 3BS4A 2A3RA 4HLUA 4DLVA 4IHQA 5CIWA 1KO7A 5ELXA 2WOJA 1EFRA 3OZXA 3OEHD 4GBMA 1IQPA 2RGNA 5SZJA 1P7CA 1KAGA 1G3UA 1UKEA 2ZJAA 2KE5A 3QVUA 2AR7A 1W5SA 821PA 3NG1A 1DAFA 2HF8A 1J70A 1P75A 4J0QA 1E9EA 3OHMA 4IDPA 5DN6A 3TE6A 4XVRA 5GJVC 5EE5B 3W8RA 4LWZA 4YMVA 2WJJA 1G5RA 3KKQA 1R6BX 1E3MA 2QGNA 5G41A 4MITA 1ESMA 2H8KA 3ND8A 1ZRHA 4Q7KA 4EFLA 2VHJA 4JVLA 4EPWA 2N46A 1H65A 3JZMA 3M0EA 4OHVA 2ERXA 5K8LA 3CR7A 3QXSA 4JKYA 3A6PC 1RJ9B 3QKRA 1MABB 1TL7C 3BRWD 2HUPA 1GKIA 3IGFA 1LVGA 4C0KA 3UG7A 2J7KA 2A7QA 1CEEA 2ASEA 2GJAA 2Q3HA 1WA5A 1W1WA 3NKVA 3TBKA 4BECA 2VSOA 4IOLA 4DDVA 3IEVA 2V54A 2BEKA 4US1R 2V8OA 2VF8A 1P9RA 3DZDA 4NZYA 1E9FA 3GFTA 3IEUA 2ZTSA 1CJKC 1XWIA 2JDID 4EIWA 4NPHA 1Z22A 3LVQE 2R44A 2IYVA 2YWGA 2JLSA 3FKSA 4C0JA 4RY2A 4Z8XA 2J3EA 5EP1A 4A9AA 1D8TA 3LWNA 3WBJA 4JBXA 4Z54A 3BH7A 3U4QB 1KSJA 3PEVA 3R7WA 2O8CB 2XSZA 3D8BA 1ZMXA 2Q0HA 1GRRA 2HJVA 4C3ZA 1GP2A 4I99A 5J4KA 1J2JA 1R5OA 4DLXA 2YYZA 3I61A 1DBSA 1KI8A 3REFA 2G88A 521PA 4QGAA 1QRAA 5GVSA 4IEIA 4US0R 5FTKA 3TR5A 4QGFA 2GF9A 3CKLA 2FU5C 2ZI5A 4OI2A 1K5DA 1E9DA 2XGJA 4U02A 2JDIA 2WVJA 3BBPA 4LDJA 3DOEA 2F55A 1P72A 2WWYA 4BUJA 1DAHA 3FYHA 3AF1A 4YMUA 4RSGA 1UEJA 1G5PA 3DM5A 3SDZA 3I72A 4BFUA 3GLFB 1N6RA 4G01B 2OLKA 2RCNA 3CRRA 1UKZA 2A5JA 1JI0A 2W58A 4B43A 1BMFA 2OSBA 5B57C 1ZU4A 4B3GA 3C7KA 2GEVA 2VRWA 3PQCA 1N2CE 1NRJB 2VYFA 3OEED 5CLQA 1CRQA 4QGGA 2BM0A 4LJ8A 2ZRIA 2EFHB 1VCIA 4QFMA 3EARA 4PC3A 3CPHA 4IDQA 2BIFA 2AKAB 2BV3A 2XNDD 3AUXA 1KMHA 1LF0A 5KSOA 1G8HA 5FOVA 2GESA 3MWLA 4JLJA 1GUAA 4PXAA 1TUIA 4TYWA 2QNRA 2F6RA 1SXJD 4QBFA 1E2FA 3MFYA 2OESA 4XWKA 3WYAA 1OXVA 3LD9A 1DO2A 1T6NA 1R0WA 2VHTA 2W2VA 3L43A 3QJYA 2IX3A 1PLKA 1IY0A 4L9WA 4QG7A 2F1JA 5AJYA 3HR7A 1Z2CA 3PENA 5FUYA 1DE0A 2O8FA 1P2VA 3SFVA 4MYHA 4NMMA 4BZXA 3KKOA 4DCTA 2ODNA 1FZQA 2WZQA 2BJWA 2GKSA 4M9QA 3HU2A 1BS1A 4OQMA 1AM4D 4GDFA 2O0JA 2ZROA 4D4JA 1XCMA 2F9MA 5BXQC 2XJ4A 1HE8B 1QG2A 2PEYA 1XBTA 3GLIE 1FMLA 1SVKA 1XD2B 3T34A 3F8TA 1OJLA 4HUQB 1F3OA 1MO3A 2GILA 4Q4LA 3OE7D 1GVNB 1FP6A 4LC1A 4DSNA 3W5IA 5C4GB 2GCNA 5B58C 5G3ZA 2BKEA 2GXQA 2KI5A 3H2YA 3KL4A 3U7FB 4LJ6A 3VX4A 2ZI4A 4FMCB 2A5YB 2R62A 3BK7A 1Q3TA 3AVYA 1Q21A 1ZD9A 1XEFA 4FMDB 4AC9A 3LXXA 4B3FX 5AUOB 1GRQA 2WSMA 1XD9A 1EFHA 1N6IA 2BDTA 2OO7A 2PZGA 3A1TA 2GTPA 3ZGXA 4A1FA 1I4DD 2W6JD 3DM9B 4WVFA 2IT1A 2ZYUX 1CXZA 3B85A 1CF4A 2ZYTX 3K9GA 2V55B 3HYTA 1OYYA 2CJWA 3IUYA 5HR5A 4RKFA 3NH9A 5CK4A 4XD7A 2ZJOA 5CB8A 4FXPA 4FD2A 2QROA 1KK1A 2L0XA 2WWHA 4CEJB 2HLDA 3WP1B 5KUTA 3TLXA 2ZYVX 4BFZA 1WDTA 3X1DA 2P3SA 4LJ5A 2LKDA 4DHEA 2GAOA 2VF7A 2ANCA 4V0ME 3RHFA 2XZLA 1JEDA 3GJ5A 3W6OA 5E7MA 1VG9B 5JWHA 1ZM7A 3QNUA 4YDHB 1D6JA 1UBGA 4F93B 3NDBB 1E9AA 3GLHB 1P5ZB 3BB4A 3CX7A 2HT1A 2OCYC 3BH0A 4US2R 2FJUA 4KVAA 4IDNA 3RS0A 1FMJA 4MKIA 4OBEA 4PPFA 2DBYA 1XEWY 2R8RA 1VG1A 3THYA 1AGRA 3R7WB 2O8CA 4D0NA 5CB6A 1UEIA 2KJQA 4NYJR 3ASZA 4ON9A 4F4JA 1ZBDA 4TTQA 4F92B 2PH1A 1KI4A 1UPTA 1W36D 1II0A 4IRUB 1YR6A 4CEHB 4PHFA 4JMPA 4OQXA 2ZRAA 1HURA 4Q9IA 4RFSB 4QL3A 2OE2A 4LHWA 3ZDQA 4A6PA 1XX6A 3CZQA 1HEIA 2IF2A 2ZR7A 3EA0A 4AK9A 3V4RA 4LY6A 3WMGA 2FV8A 1YR9A 2EYQA 3CX6A 1MABA 1QBKC 5EP3A 4M1TA 1DG1G 2WWXA 1WE2A 3BFVA 4IDOA 4QHTA 1W2GA 1XRJA 3W3ZB 3FMIA 3OAAD 2WPDA 1DPFA 5AK0A 5KYKA 2AD5A 2ZQ5A 2MSDB 1S2MA 1E0SA 2BOVA 2A5GA 4WZBE 3T1VA 2QP4A 2Q9AA 2P6NA 4DBLC 4PO1A 4Q1AA 3ICEA 1E1RA 1KZ7B 2RMKA 2R9VA 2VP6A 4B71A 2FDCA 3VTKA 4ILEA 4JLKA 4NCIA 2J0VA 2CE7A 4HB0A 4CDGA 4M9ZA 2PJZA 3I5YA 3RDPA 4XIGS 3BGWA 1EXMA 2A9KA 4HLQB 1Z0JA 1F2TA 3LXRA 3W6PA 5SZKB 4M1KA 2JLWA 3VNUA 4DT1B 4E09A 4NKRA 3ZVMA 3GLGB 3OF5A 4E03A 1T3HA 1JB1A 3B1WA 1VMAA 3LBHA 5EE1A 2W6IA 2C95A 2EWWA 2H5EA 4PAMA 1BYIA 1CBUA 2BBTA 3VKHA 2ZJ2A 1QHIA 1ZAKA 4D26A 1N6KA 1Q12A 5L3VA 2GXUA 3LH5A 4LJYA 3E70C 3CZPA 4MYCA 3HPQA 1E0JA 5J47A 5KDDA 1CJMA 4ESHA 2B21A 1Z0KA 1XMIA 2QMUA 3RNLA 2RGXA 4G5QA 3DDCA 1WMSA 2RAPA 1XMJA 1JBKA 1XEWX 3X1YA 4LHZA 1CJUC 3LX8A 5KNCA 4PSKA 1ZJ6A 4K8OA 4MRSA 1N6PA 2ZSAA 2D3WA 4JL8A 5JLJA 1XP8A 2C2HA 3TJZA 3QBTA 2QA5A 4Q1DA 3R9XA 2FFQA 4TWZA 4BWYA 3B13B 1COWD 4DLUA 1Z2AA 2J59A 4XJXA 1MKYA 3VX3A 2V1XA 3K0FB 1TF2A 4Q4AA 4FMCF 5LB4A 1FNMA 4NYIR 3TMKA 5L8VA 4Q7LA 4B76A 1NSFA 3RWMB 3Q72A 2QMEA 1XD8A 2IF0A 2QAJA 3EG5A 3HR8A 5A5GA 2PJRA 1XPUA 4BFVA 2V9PA 3GFOA 1KMHB 4DIEA 4BEBA 4M1WA 4RD4A 1A4RA 4ZCLA 3FWYA 3T15A 1NLZA 2HV8A 4JLVA 1LF5A 2G0TA 1BKDR 1RRPA 1XD2A 3BH6A 4JBYA 4KLZA 2PX3A 3LY5A 4KITB 3DEFA 1R10A 1E2NA 2JJ2A 3WNDA 5DNYB 1XPOA 1P2UA 1OFIA 4MKFA 3SYLA 3FB4A 4A0FA 2P6RA 4Z8YA 4CW7A 2YNMA 1ONBA 4EAQA 2G6BA 4QJ3A 4M4SA 4URVR 1XFAA 4TMXA 5M04A 1SKQA 2Q3FA 3LNCA 1Z6GA 4MUAA 4QJ4A 4ZIRB 5JSZB 1NLYA 4GZLA 3EASA 4BZPA 1S8FA 5KOYA 5CJPA 2EU8A 5FOTA 1XTKA 1NY6A 1K6MA 1U8YA 3U7GA 1CR1A 3R8CA 3X1XA 5CM8B 2ONKA 5FBRB 2GJ8A 3AVQA 3U7HB 3ZZTA 2GAAA 1DS6A 4EUNA 1GNPA 4OJQA 2DPXA 3CWZA 4Q4JB 1OPXA 1US8A 4M9XA 3AF3A 1EFUA 3LLMA 3EPLA 4Q03A 2VSXA 1LTQA 1R2QA 1M7BA 3NBZC 4KFRA 5FOWA 3O8CA 4PR0A 2F3RA 1NKTA 4I1VA 1A5TA 4LJ7A 3B1XA 4UXJA 1P9NA 1SGWA 1P73A 4Q02A 2HLDD 3PUXA 3GJXC 3B78A 1JJ7A 3RVBA 4DLZA 5P21A 1ZVQA 1NBME 3EW9A 2VHQA 1TEXA 4M9SA 3MD0A 2P67A 2QMOA 1T0HB 2WKRA 2EFDB 3KKNA 3EIQA 1X8LA 4LBZA 1D9ZA 4TT3A 4V0NA 4PFSA 2ZVQX 4ZO4A 2GZAA 3B8HA 2EFEB 3VHLB 5FH9A 3EZ2A 1T91A 1U9IC 3GLIB 3SN6A 1U9IA 2R6DA 3AQ4A 3T12A 3W90A 5FOSA 1G21E 1AZTA 2QMHA 2PLRA 2F7SA 2PLFA 4D2IA 2CCGA 1AS3A 3H86A 4WAUA 1NN5A 4LJAA 5FOUA 1ZNWA 4AKGA 1E1QD 2IYYA 2NMVA 2ZR9A 3THWB 1JR3A 1LFDB 3MUFA 4R2IA 4CYMA 1QHNA 3EC1A 4KCGA 3QSYA 4X8MA 4BRUA 1A2KC 1M8PA 3AV0B 3C16C 4NU0A 4ZCMA 1G4UR 1I4TD 2B92A 1QVRA 5KNDA 1GIAA 3HU1A 2ZS7A 3GLFA 1Z0FA 4QNRA 4I1SA 2Z6VA 5AJVB 1N25A 3C8UA 1OFUX 2ZJYA 3NHAA 2JLXA 3BD9A 1Z06A 4PC6A 2WICA 1JPNA 1FW6A 2CVHA 2XTZA 3RSLA 3MAAC 5EZ5A 1D9XA 4TLAA 1KIMA 2V3CC 1G7RA 2GEDA 4ASUA 1ZM2A 1KNXA 1W4BA 3GJ7A 3BE4A 3PFIA 4II7A 2ZREA 3LBNA 4YC7A 3ADDA 2WAXA 2WV9A 5JRJA 1P9WA 2WMOB 3ADCA 1NLFA 3CW2A 1E2IA 4LBVA 3SS8A 4D4LA 3KQLA 1OLOA 4OQNA 2ZSEA 4OI1A 1A2BA 1AN0A 4FCVA 2W00A 4AYXA 1J8YF 4Q5IA 5HZKA 2CXXA 2FSGA 2C9CA 3O8DA 4E07A 3AVPA 3QVVA 3I5XA 3BJIC 5B64A 1KK2A 5L3QA 2LWIA 4EJSB 1G3QA 3U3OA 5H1YA 1S1CA 2QI9C 2BBWA 3AUYA 1VCNA 4LV8B 4LYJA 2GZDA 3RSOA 1M34E 2G1KA 1KZGB 5EQTA 3KB2A 4JLMA 2N42A 3Q8XB 5D3QA 2WKPA 4QNMA 1AJEA 1M6NA 2LKCA 3IIKA 4CEHA 4MH0R 2VIIA 2JLZA 4ZCIA 3GJ4A 2WWWA 1WXQA 1XEXA 4QOSA 2W6ID 5TXGA 4GFDA 2O8BA 3AP1A 2ZRCA 3A1UA 2PBRA 2GBLC 3GEEA 2FSHA 1HQYE 2FG5A 3QY0A 1S4QA 2ERYA 1NMZA 3Q5EA 4B3BA 4Q4HB 3R8FA 1XCPA 1TTTA 4IOMA 5LPNA 2IXEA 2ZI7A 3UANA 1SVOA 1VCOA 2GHIA 3FVQA 4EDHA 4W5WA 2OFXA 1GNRA 3TR0A 4ARZA 2XJ9A 2QPAA 2QPTA 3FDIA 2OBNA 5DSZA 2ZRMA 1LV7A 3CNLA 4JSYA 1C4OA 1M2OB 1IN8A 1M7HA 1F48A 2PEZA 3RS2A 2C98A 4BLTA 1NVXQ 4PO9A 4A2PA 1HV8A 2UVQA 5JI2E 2XOKD 1NJFA 1Z0IA 3NIBA 4MQBA 3AF2A 5L3RA 2QM8A 2CEAA 4KHZA 2V6JA 3FE2A 3AVWA 1G64A 4XWOA 3GLHE 2D74A 1OYWA 2WAYA 2QZ4A 3A1SA 3EXAA 4D81A 4A6XA 1JR6A 2AWNA 1YRAA 4PZLA 4V02A 3LQRA 1QVAA 2RB4A 3VR3A 4PPGA 3B9PA 4G5RA 4UXIA 4HDCA 5GJWC 1E2MA 3KQKA 2VHUA 2VLIA 1PLLA 3PCRB 4ACBA 1I2DA 1KKLA 4LGMA 4TYYA 3F5FA 5LD2C 5F9HA 4NBSA 4N0DA 2ZRGA 1KJZA 1TQ6A 3V00A 1ZU5A 4AG6A 5FBVB 4Z51A 3AVOA 4G0NA 4HZUA 4KLNA 2P6UA 3CH4B 4D4MA 1DG3A 1E79D 4DEYA 3W3AA 4TMZA 2RKOA 5HE8A 1RE0A 5EE0A 5B2ZA 3SBEA 3TUJC 1OB5A 1OIWA 2IA5A 1OV4A 2JJ1D 4G1UC 2UKDA 2VP9A 4QRHA 1E4VA 4GT1A 4QGHA 5E7JA 2IS1A 2VP2A 4B6EA 4A8JB 3GEHA 4KV9A 1XXHA 2Z5FA 3OEEA 3CF0A 4OKSA 5J40A 2GETA 1EFTA 1UFQA 4H1VA 4O0MA 4JL6A 5KHOC 3RAPR 2OILA 1OH5A 2B7BA 1W0JD 3MMPA 4KXFB 2NPFA 1Q1EA 4B44A 2GA8A 3PUVA 3T35A 4A0GA 4RFVA 4GMDA 4D80A 2AK2A 2XX3A 4DSOA 3FFAA 3TSZA 4IVRA 1B0UA 1UDWA 2B7CA 2ZRDA 1HTWA 1XTIA 1H8HA 5DN6D 5B30A 2ZRLA 1EX7A 4IJMA 1AKEA 1M7GA 2IWRA 1TEVA 1TQ2A 4RZ3A 1O3YA 3AKDA 2JJ1A 4P4UA 2Z4RA 4ZDIA 4B2LA 5C1BA 1Z28A 3NTUA 3WYGA 4HEJA 4TZ0A 4DSUA 3L8YA 3UMRA 2YZ2A 3T06B 5KNBA 3Q7PA 2QTHA 1TQDA 4OHWA 2CCKA 3BERA 4LHXA 1TUEA 2QGZA 1W0JA 5EZ6B 3T1QA 2CHVA 2WSSD 3AH8A 2OBLA 5HKKA 3IIMA 3S1AB 3K0EA 1P6XA 2MSEB 1S9DA 3OE7A 4TYPA 1QDEA 3LAWA 2F43B 4URXR 3ZQ6A 1KI6B
chains in the Genus database with same CATH superfamily
3UMFA 3IMFA 4LSWA 4MCJA 1NC3A 1TF5A 4BPRA 3A4LA 4N7JA 2OPBA 4FOSA 2HK7A 2NU8B 1DRKA 2ZITA 3RTCA 2DEUA 3GLRA 4QDUA 3C4JA 2VCYA 4GKBA 3ZVRA 2H11A 2CN1A 4GRAA 1H9CA 3H9GA 3WBKA 1EK0A 1L1RA 1NDQA 4CL8A 3NFRA 3TYXA 2J9YB 1OAOA 3Q6IA 1SVWA 4Y2VA 3CNHA 3TVYA 2PD3A 5BN4B 1KO5A 2J3HA 3M4XA 4BMVA 3ILHA 4QAQA 2V0NA 1PBTA 2XUKA 1XRMA 3SNKA 1WU8A 5JHHB 2C0QA 3EVGA 3QLVA 5ENZA 5IT0A 3PB3A 1QU2A 2NWQA 4M1MA 4O4IF 3WLNA 2V98A 2VS1A 3SJAA 1TEHA 3K9NA 3L0SA 5LQJA 2DCMA 2VK4A 3D6JA 5KYVA 1HDGO 2WB4A 2I3AA 5A3VA 3ZVNA 1CQJA 3DMRA 1H5UA 4BNYA 4TYQA 3EOBI 4BKQA 3L5KA 4PQYA 4FHFA 4L5BA 1OWLA 2B0JA 2FZ5A 3SFTA 4EQ6B 2I0FA 3E7PA 3EXHB 4LRSB 1DKOA 3U4AA 3ZN2A 1OLSB 4L72A 1P3DA 1O94D 1TK3A 4DVGA 4CCYA 4IW3B 3KTAA 1HNZB 4HVAA 4PG5A 3FHTA 1PUIA 3BK1A 3JZDA 4ZZ1A 3JRWA 1UQRA 2ZEJA 3R7AA 4Y2YA 1NJ5A 3IVXA 1SUFA 1JHPA 3ZGZA 1ABFA 1GZDA 4TL9A 1RKXA 4E70A 2ZSFA 2G77B 3C85A 3U19A 3GGDA 1R16A 4HQOA 5HS6A 3CUWA 1JEYA 2Y4NA 1Z08A 2QJWA 2QVCA 4BB0A 3F47A 1DXOA 1Y89A 3R3JA 4UNRA 3WXMA 2DX7A 4TQUS 3S8MA 2QUZA 2CXSA 3ZI0A 3AR9A 4QUIA 2UUAB 3IC5A 3U0BA 2YC4C 5I51A 5M7EA 3G0OA 1N5IA 3L9WA 2HQBA 3LG2A 4TKVA 1VP3A 3RF6A 4IR7A 1D6NA 4KVZA 1XXHB 1L7DA 3N8KA 2HY7A 4RTOA 3GMTA 4MUJA 4C21A 3HK2A 2F1RA 1U0EA 1VECA 1GPAA 3N58A 1NWCA 1N2XA 3RBAA 1EGAA 3F9IA 3C5CA 4DL9A 4JT2A 4R40A 1C8BA 2P3LA 3VU9A 4FWTA 1D09A 1T8UA 1ZI9A 2PL1A 3S5JA 5DI3A 2WJPA 1U1DA 3ZY2A 2VTVA 3JQAB 1C8VB 2BHNA 4GGPA 3QVXA 4XDZA 2XB8A 4CMIA 2DFLA 4RH1A 4ZO8A 3SGLA 2R25B 1SUEA 2ZT8A 2NGRA 2O7NA 4HGYA 4RLFA 4YRNA 1KVSA 4A8PA 4KR7A 3D02A 2FRDA 3FI0A 4OAOA 2CB9A 2GWRA 4JLWA 3TR6A 4X1KB 1CEQA 5FV7A 5HK9A 1G66A 1M1NA 3W79A 4BVJA 1J99A 4EJMA 3ND5A 5KOHA 3JVUA 4L76A 5BN3A 5C32A 2YV4A 4P4SB 2PGIA 2B8TA 5KKAA 3B1FA 5L4SA 3CVXA 1JS1X 3LU1A 1F20A 4XTRA 1BXRB 1E1RD 2GEKA 1EGHA 1I2MA 4F1WA 4EFNA 1E92A 4DUYB 4FZ5A 2ZR8A 3W5CA 3P0HA 4ZPJA 1RM3A 4RMNA 1Y4UA 1FSZA 2D1RA 1V11A 5EWLA 1UFRA 2V4ZA 4FUTA 3IXQA 2OQVA 1RHMA 5EMKA 2QRJA 1H2WA 1HM5A 1ISSA 3FPFA 4HX9A 5EFZA 4TUYA 4BUCA 4ZGBA 1JXAA 1AKYA 3EY9A 3AIKA 1DIOB 5EEGA 4QHSA 2ZP1A 1FVFA 3DWEX 2O07A 3UA4A 3QFFA 1YZKA 5L3SA 2PS0A 1DUSA 5JSFA 1XTPA 2WMDA 1B8NA 1KK3A 3EZ6A 4FUQA 5G0UA 1C3JA 3UWKA 3YASA 2HA2A 4BZQA 3GN2A 3ZUPA 3Q15C 1HE4A 5CCBA 4RCZA 1T9GS 4AL4A 4O33A 4FFBB 1S89A 4GP9A 4P4NA 3IOBA 1W25A 4KQ9A 4PZZA 5GJBA 1Y8QA 3SLRA 2XB4A 3UFXB 2PMEA 1RHJA 1V0JA 5HM6A 4C7OA 1WP9A 2P7HA 2PCLA 3CNQS 3A9RA 1EK6A 2WU8A 3F5SA 4LXQA 5AI9A 2EBFX 5FNVB 3TRHA 4UEKA 4A4DA 4EGCB 4X7RA 3MHTA 4G2TA 1K8RA 1VZ3A 3S7ZA 1MQAA 1XVIA 1XJ0A 2OOKA 3JTMA 3V8BA 3CO0S 4O2BA 1XNGA 1M6VB 4I66A 2CXPA 3V4FA 1VPLA 3ZLJA 2J3DA 4ES6A 1LK5A 4TVBA 1VJDA 3BIFA 4KBGA 4KIUA 3TJZA 1XRPA 3DZJA 4CF4A 1NXTA 3LS2A 4Q7QA 1XCGB 1Z38A 3H1TA 1JDTA 5KDLA 3AF4A 2R8XA 3CG4A 4Q1EA 3G0GA 4BBPA 4JJ4A 4JUAA 1IM2A 1E5LA 3JZFA 1P77A 2YOGA 2JFGA 4F3KA 1YNSA 2C2WA 5FUXA 4C30A 2JPDA 2O8DB 4JJIA 4D8VA 1AS0A 3E9YA 4WA8A 4YV0A 4F91B 3C1UA 4ZAGA 1BQ4A 4BBAA 5LXTB 1ZUIA 4M8NE 3T1HB 4YJ3B 1A8UA 2YHSA 1FSGA 4X7BA 1NIJA 1NASA 1Z5NA 1F0KA 1P31A 2H6EA 3REQB 1RRFA 1B74A 1T2VA 5IBQA 3FZEA 3A1WA 4D9IA 2B8WA 2EV9A 1L3BA 1YQTA 1XELA 4JXJA 2YDYA 1Q1AA 1A7KA 4H7HA 4KYUA 4MW4A 4YCNA 1PFQA 4FJ0A 3IUQA 5KC9A 1ZHOA 2E4ZA 3GP8A 2JFZA 4X94A 3W4KA 2G7ZA 4HLCA 5AW8A 2CW5A 2FPWA 4R8VA 1XYVA 2P2LA 2ZTMA 1Z3IX 3LDAA 3MJVA 2Y1WA 4MJLA 1UDCA 1VL1A 3KR0A 4MRAA 1SHKA 3AVVA 3WAGA 1E0AA 2Y0EA 5LP6C 4TTPA 3D54D 3UJ8A 5EUQB 1PDVA 4OREX 1OREA 4KODA 4O4LA 1HE5A 4YRTA 1KYTA 3JVEA 4PVCA 1XU7A 4EO9A 4YHHB 2IYSA 2PNFA 1NURA 1SQ0A 2HJWA 2WPNA 2XDQA 1SUWA 1WZNA 3NH6A 3GLGA 3AFOA 3WA6A 3OOEA 1CJTC 4S1NA 3E3OA 4ATNA 1ZD4A 4B7UA 5HZGA 5J4HA 5A3JA 2Q21A 2G80A 1KJQA 4Q1CA 4K9LA 4U2FA 5K45A 1VE7A 1WMAA 3NCTA 4OQFA 1SHJA 3TRFA 5B3JA 4AKIA 1H1TA 3EXHC 5TB5A 5EINA 5KSYA 1WMBA 2I80A 2O1WA 2HM7A 3WIVA 3NYQA 4UJ3A 2Q3MA 4DCJA 3OBIA 2H1WA 1EJBA 1U28C 2ZYSA 3GLQA 3RRMA 3UFBA 5C8YA 3ZHCA 1V7CA 3FG9A 1Z0AA 5BO5A 5T3YA 4ZKDA 1Z6ZA 2Y0CA 3O94A 4I2NA 1CR4A 5JEDA 1V1JA 3HKEA 4QYIB 4QBGB 1AHPA 1RKVA 3SM3A 1TAGA 1E3WA 4PLHA 2JRCA 2W0MA 1HFJA 1QAQA 1QNLA 3D4PA 3VI4B 4O4IA 2NPIA 4FFBA 1EK1A 4OXYA 5AWFC 2YZGA 1OIXA 3WWOA 1EWRA 1FFXA 1LVHA 3HY4A 3HRIA 4TV9F 4R1NA 3FFTA 1T2UA 4WBXC 5HA5A 4B2YA 4RPLA 1TIBA 1SD5A 3V4SA 5BNWA 3K2EA 2GX6A 2P9GA 3IIJA 4OMCA 2FOLA 2TMYA 3W1EA 4XAQA 5FPTA 2OGTA 2FNAA 2RHHA 1DX9A 5ED4A 1KQGA 1FUUA 2C78A 1T8SA 2GQ0A 2H4FA 2VJKA 3OE4A 3LT5A 2VP0A 3PIRA 3W0LB 4CLRA 1UIRA 1W93A 3IHWA 5EJ9A 1WU7A 1RLOA 3B36A 1UKAA 1U0LA 4PFJA 2FPLA 2Z8XA 1X6VA 1SZDA 3NWJA 4TTIA 3BULA 3RREA 4H1WA 2QP3A 2PZEA 4BKMA 1QOQB 1WF3A 2QZ9A 5CYPA 3SC2A 3UJCA 3VHXB 4NATA 1FVXA 3INTA 2DB3A 3BHNA 2PS1A 4OQPA 3CBQA 3SQNA 2O0KA 4RGQA 3C3KA 2P2CA 1PTJC 3O5AA 1IEVA 4I5FA 4WADA 1XLWA 2VT6A 3EQ6A 3FMVA 4MGEA 3MWEA 1R8XA 5AMXA 4CV3A 2I4IA 1X74A 4HZUB 3M5CA 4ZV7A 3FF1A 5EZQA 5D3KA 4BO6A 4RFLA 5JNVA 3VYWA 3IO5A 1MEOA 4D8XA 2R6CA 3SPXA 2ZKLA 3BE6A 1P1IA 4FSDA 1D04A 1ULTA 4LPKA 1X70A 4A2WA 3C24A 2X2OA 2QYSA 4CKYA 3Q12A 3HY3A 1ZH0A 3A04A 2A9QA 1LX7A 3PGLA 5B3KA 4HNAB 4CCWA 4FGLA 5IPFA 3I8OA 2PZMA 4G8CA 4PIVA 1LWOA 3TNFA 2CB0A 2GF0A 2WHEA 5KNDD 1ZGZA 1XZIA 4AM8A 2H7YA 4EY7A 5HCIA 4TV9B 2XVMA 3AG6A 1T6ZA 2Y92A 2IW3A 5SYNA 5C3MA 1X77A 4O4LB 1ZC4A 4D9FA 1C3EA 3P2MA 2GNOA 3SCZA 2V1UA 1EK5A 3THOA 5EHGA 1CD5A 1ZCFA 2F00A 1I10A 1YQXA 2IHBA 3FVTA 3IP8A 4OM7A 4R16A 5B7QA 1HT2E 4RENA 2KYRA 2AZ4A 3QF7A 3WDMA 2YWEA 3ZWAA 3H65A 1F7UA 4Q15A 2HPHA 3KQHA 4CR8A 3ELYA 1L4UA 2GBFA 1KY3A 2A9VA 5BWNA 2ZT5A 4Q24A 5ES3A 2H1IA 4PGFA 2GI4A 1PWEA 4TX1A 3GMSA 3GX1A 4H3HB 4ZAZA 4W5JA 4MP6A 5ALDA 5FWXA 5JCJD 3MGGA 1XXLA 1JIUA 1NN0A 5DTRA 3UW1A 3SYTA 1KDTA 5KAMA 4AJKA 3KYBA 3AB7A 2O7VA 1Y6FA 3CUTA 5KYTA 3AR3A 1MIHA 4HAZA 5FI1B 1L6RA 2A33A 2NV0A 4LXYA 4JI6B 3VR1A 5JS2A 3WA7A 3W5VA 3JWJA 2GFQA 3EVCA 1DWOA 2C4NA 4WQMA 5BQFA 1PT5A 1VMDA 3HU3A 4M6WA 4QAJA 4RJLA 3T6KA 3ZPXA 3AM3A 1Q7CA 4ESVA 2PRIA 5HIKA 2CDAA 3IR5A 4XGKA 4MVCA 2A4MA 5MN6A 2O8EA 4B34A 3FTCA 3FOZA 1QIGA 2IL1A 3FMGA 4HXGA 4PYLA 1RQLA 3IERA 4MQFA 4MNTA 2HK9A 2JIZA 4NF2A 5JSQA 1N7HA 2BC9A 2G0NA 3F46A 4CGYA 4ERNA 2HYIC 1EFPB 2WJVA 5IXJA 1HG0A 2OP0A 1QO0D 3DLBA 1N0HA 3EUAA 2OB2A 2C99A 2REOA 2BI4A 2XWQA 3EIUA 4JP8A 5A3SA 5HBRA 4BNLA 1SOUA 3LZDA 1WCWA 4NDAA 1WTCA 4UDXX 1RRMA 4G9BA 4WOKA 4YAFA 3X2SA 5K0CA 1BDHA 3BWXA 2JEYA 1NMXA 3HYSA 4OU4A 2FW7A 2VPWA 4UDYX 3TFQA 1H66A 2G8LA 2PBFA 4H4CA 4LMAA 5H7XA 5I8PA 4NMXB 3HCRA 3IBGA 4LHSA 1QRTA 4B4DA 4CLHA 5C80A 2QENA 1GGFA 4LJ9A 5DNCA 2Y6UA 4ENQA 2FI1A 3HJTA 4FQ8A 5JMPA 4P0PB 5BWMA 3OD1A 4TSFA 4EB6A 1PJQA 5ITZB 2CZGA 2HMWA 3AOEA 3G8AA 3GRFA 3AOEC 3BOSA 5IW8A 3UJ9A 4ZJZA 4I4CA 4Q01A 4TLCA 1KTIA 1B2LA 3DYBA 3FSGD 3QXGA 4EGQA 4FYMA 2ADMA 4L8GA 3GEGA 1XSEA 4K0RA 3OC6A 4U0KA 3IYLW 1PEDA 1XKXA 3G5UA 1Q0QA 2YWRA 3E82A 1TM5E 1XGKA 2C42A 2EXXA 2YHBA 3E4CA 1A8HA 3IKJA 4I1OA 4KSCA 3K1TA 1K98A 2AVNA 5AUPB 2G5TA 2VA8A 2PYZA 4D44A 2EZTA 3L40A 2GJ9A 2R2AA 1K4YA 5FTMA 3QUBA 3I30X 3E61A 2JHPA 3OHSX 1Z26A 2P5SA 1T0IA 2D5CA 3ZV4A 4QICA 1NW4A 1OPRA 1IOLA 2DHDA 3BAFA 4CETA 1IZ0A 1JHDA 3GLTA 5LCXA 3O3OB 4F2GA 5LB2A 2OFWA 1GN9A 1EQAA 2INGX 2WP8J 3VR6H 4IZOA 4EPRA 1CR2A 4YCDA 1KZHA 1QGUA 2XQVA 1M2VB 3MGBA 3CURA 1KI1A 4MPRA 5ICCA 3JSAA 5K0JA 1VRWA 3IHLA 3NT2A 4ZI2A 4D8UA 3LUPA 5COAA 3KPJA 4MI9A 5HCNA 1OFVA 4B8YA 4BQRA 4IRMA 1XNJA 2FCRA 1UMDB 4UASA 1LS1A 1C9EA 3DTVD 3DW3X 2BMFA 4P3YA 1ZLXA 2ZRHA 2IUEA 2X9GA 4JJGA 3AHIA 3TLKA 3PYMA 4HYTA 4BFSA 1EIWA 1H6AA 1DKNA 3U3ZA 1H6CA 2YC2C 1JR3E 3KDPA 4XD7D 3RYFB 3SVZA 1KHHA 4PBRA 4JGGA 3PUHA 4KH0A 1O8CA 5TQ0B 1OXSC 3S3TA 1IZ8A 1L3CA 2G8NA 5K3CA 2LBPA 5KWEA 4IEFB 2Q46A 4W5RA 3CUSA 3O4IA 3QMVA 4H7FA 3TCNA 3SSOA 4AG3A 2P4EA 4H0CA 1IJEA 4YAIA 3RYCB 3VR2A 2WTUA 1P5JA 2I1VB 5JJKA 2YXNA 4AJOA 3AESA 4I1RA 2J3LA 1E6MA 2DXIA 3IILA 3SKYA 2DBZA 3K96A 4Q48A 4RE5A 4BXOB 3I64A 2N1BA 2OQIA 2SHKA 4IDCA 4QELA 4OKNA 2Q9CA 3E8XA 3ESZA 3P2KA 2VZEA 4WSOA 4E88A 2HWUA 3KJIA 4W1PA 5EMHA 1KJIA 3KTAB 4BB9A 1GGEA 1Q57A 2YH2A 4HVTA 3FFWA 1X7ZA 4QXQA 3NGMA 5KJ1A 2JBWA 3FYTA 3U56A 2IPNA 1E6KA 1BWSA 1VL0A 3DZBA 1HR0B 5LQCA 3GJ6A 3X1WA 3EIEA 1XDGA 1C9MA 2IGBA 1JJAA 2IXAA 2VP4A 3MTIA 4JKOA 4Q18A 4IG9A 3AEUB 2VHCA 4Q3KA 2G9QA 3H2JA 2FFAA 3K70B 4WN9A 3ZDZB 4OL0A 3QX7A 2IOFA 1F0NA 1NLMA 2EW2A 13PKA 4LE1A 2ZIWB 4ZQHA 1M0TA 2B8JA 5ER9A 3U7JA 1G3IA 1RHRA 4HAYA 3ABIA 3HGTA 1CYDA 1JV2B 1MZVA 3FTNA 4OXNA 5A05A 4IO1A 5K4AA 2E4WA 3T3IA 1EUZA 4JVNA 2BKXA 1O87A 1NN1A 4UVEA 1RCTE 2BMWA 1NVAA 3MZ0A 2AK3A 2GCOA 2EJWA 3DMNA 4UEQA 2Z9CA 4E13A 1GITA 1OVMA 1E1DA 3AERB 4ND8B 2NYUA 3KM0A 3NDJA 3U7RA 2IOHA 1PZHA 4ZDKA 1YBHA 4BIIA 6NULA 3T1TA 4YAOA 2PZAA 1FY2A 4ZI3A 3NAQA 4H77A 4HEQA 1IAQA 1WQ3A 2YIDA 4ENVA 3ANTA 1Q0ZA 2VHXA 2WDPA 5IG2A 3AF5A 3CRNA 2LW7A 4GYJA 1KKUA 4BTLA 1ZOSA 4EUEA 3EUWA 2A30A 4DIOA 2DFVA 1RVDA 1DDGA 2VQ3A 3PVCA 4UKDA 3T8YA 3BWEA 3E2MA 2W6ZA 1ISPA 2WAOA 1XOIA 4OUKX 5CT5A 4ZAXA 3OZSA 2O48X 4V0OA 3SHWA 5JCZA 4BY9E 1G2OA 1O96A 4GZ3A 1SU4A 4QU8A 1HLPA 3VMMA 5KS2A 3R6GA 1E77A 5FI5A 5T6BA 3HBJA 1VA5A 5KQGA 2BFCA 1O95C 1JL3A 1JDNA 3PUZA 3K3PA 1YA4A 3ROTA 2IPOA 5T41A 1HNWB 2IE0A 3T95A 3L4JA 2UUCB 1U1CA 5GZ6A 5F33A 2GPJA 3BHIA 3SHFA 5CT4A 2QX6A 1B7GO 3BF7A 2X77A 2RGBA 1HX7A 4MLDA 4M21A 5JZ9A 2OV4A 1BW9B 4UZSA 2QN3A 1Q0PA 4G67A 1P9LA 1W4AA 1X9GA 2PUJA 2NZWA 4EATA 4P9NA 4ZEVA 4QRIA 5K8VA 2WU3A 1MRNA 4I6GA 1WAMA 4K6HA 1X7ZB 4CM1A 4CMAA 3H9QA 2XODA 4LIPD 4LI3X 3IT0A 2NZXA 4JBGA 1FNDA 1RLJA 4QVIA 3OICA 2PUHA 2NP7A 3FWPA 1GZHB 4PYRA 2CJWB 1S3FA 4OBBA 4ZA2A 3UWPA 3VJLA 1UM9A 3ZYCA 5FDFA 1SOWA 3QEAZ 5CH5A 3DUWA 4MKRA 1IY8A 4JFAA 1OR8A 4KE6A 3A32A 2QVZX 4IGAA 2R6GA 4PNEA 3EX7C 1HDCA 3ZIUA 3DYVA 2VXYA 3R4CA 3O4VA 1Y8RB 1PEAA 3JSXA 1FU8A 1U3WA 4FDMA 4J2HA 2QYTA 2R6AA 3N7UA 4U39A 4RL6A 3JW8A 4URWR 1CZRA 3SY8A 4G23A 2W2KB 1IN5A 5JZOA 2HEIA 4UPEA 4C6TB 4DM4A 1QV9A 3MRSA 2Q6LA 3JATB 3RFTA 4PCAA 2DYKA 2I2BA 4QTYA 3GQBA 1Z74A 1EUQA 3KOYA 5E9QA 1GXSB 3CRVA 3HUTA 2OO3A 4BQFA 1ISGA 4RQTA 1TVCA 2Y1KA 4LHVA 3HV2A 4EECA 5LQNA 1Z2NX 1WNTA 1I8TA 1UKCA 1Q95A 1QVZA 2W2LA 5HRCA 1ZH2A 4TZTA 4DCCA 3VPCA 3CCBA 3AERA 4AURA 1DCMA 3LWBA 2FK8A 4G1CA 16PKA 2GCPA 1L7NA 5MN4A 5SV2A 1SEVA 1XLUA 5CITA 5ECYA 4BKPA 1VM6A 1IOZA 2AFHE 1HA3A 2JGLA 1Z83A 1MHPA 3GZNA 3NKFA 5CX4A 3UJ3X 3UM9A 1MB4A 1TMOA 5FEMA 1VYVA 3NDRA 4L57A 1BGVA 1D07A 1JPJA 1G59A 3HDTA 1GFZA 4B6QA 5IK2D 1QUFA 4ZRNA 4LZPA 4ZXPA 2A8YA 3I1JA 3AR6A 5CVUA 5HKLA 3CX3A 1U0JA 2OMKA 3JALB 4ND2A 1FQKA 1UAAA 1ZESA 2ACEA 1E3SA 1JWBB 4H16A 1C9YA 5BWCA 2W42A 3EH1A 1XYGA 2SCUA 3KU4A 4PTLA 4MX8A 2ZUCA 2YMPA 2CXUA 1LZLA 4Y2RA 5GGYA 4YS6A 4QODA 5KINB 3W9SA 1P1BA 1Z07A 1OBFO 3LGAA 2J0UA 5JOQA 4FN4A 2CBGA 1YJQA 4S1WA 4JYAB 4BE7B 2DP4E 1DKQA 1G8MA 2VF5X 3B2QA 1QOPB 2NZ2A 2JFOA 3KRTA 3OPYA 2PDAA 1E58A 4U0JA 1ZLYA 3O83A 1PFGA 4Q47A 2ZTVA 3LUKA 2F3SA 4AS3A 4AN0A 2LIPA 3ZGOA 1WABA 3KSUA 4LVNA 1DI0A 1NC1A 3M6LA 2HSGA 3CISA 3KAQA 1ZK2A 1EMDA 4QUBA 3BMOB 2JZCA 4RL4A 1GT91 3ZOKA 1Q1NA 3ASUA 2ZU0C 4NJEB 2HRRA 4TXMA 4BGEA 1XEXB 1KA9H 3F0TA 5J4YA 4YROA 3EZGA 4TS9A 2Y0PA 4DMCA 1DVRA 1SUPA 3G5LA 4N7MA 1C0KA 2GK6A 1GA1A 3INYA 2XTAA 1WY7A 2PAFA 3TD6A 3STUA 3UUWA 1WSAA 3BDVA 1U1EA 3P9QA 4JNKA 2L69A 1G3RA 2CNKA 4K28A 1JA0A 1C0LA 4AF7A 3V4ZA 4CM8B 2RGDA 3HU5A 4IQ8A 1G38A 4JK3A 3U7QA 4ENUA 2PUBA 2NUAB 3T9CA 2MCFA 2ENWA 2IYTA 3AEXA 3FUXA 2B4YA 3L7IA 4DJAA 4FMBB 2I33A 1ZD2P 2IUSA 3I45A 3H99A 4LG1A 4ZOLF 3NOOA 4OQZA 3WNCA 1R7RA 4DBZA 3RUDA 2XB2A 2GUWA 5KHLB 5C5IA 3T9AA 1MC5A 4J91A 4QSMA 4UD2A 5K3DA 1QK4A 1XKLA 5AW2A 3P9ZA 4MYRA 4UOEA 4DRZA 3Q0EA 3GROA 3PIIA 1G9SA 1PG2A 1RYYA 3D6MA 4YCMA 2D4AA 2WI8A 3ASYA 3AUJB 1Y4ZA 4KQJA 1B8VA 1XXHE 1FNBA 2ZJ0A 3A1CA 3IQEA 1Z4MA 2O54A 1THTA 1YHZA 2I6GA 5FO0A 3COWA 5ALSA 4BWVA 2VHVA 1JRLA 1OLXA 2B1QA 2XNSA 3QHPA 3QOXA 3PKJA 1GYQA 4MYSA 2BMDA 1G4AE 2LCFA 3KKMA 3I58A 3RSHA 4YQFA 4BLVA 3SR0A 3K0AA 2OXRA 2JLQA 4V0MA 3ZH2A 5AM4A 3I62A 2FWJA 2EJBA 4L85A 3Q5GA 4FWIB 4NYJQ 1AT1A 1BCSB 1RIIA 2FFHA 2JGKA 3GJ3A 3W7VA 2H9YA 2OAP1 1ZKMA 2WVAA 3SHVA 3BPSA 3ZU4A 1YB2A 4YJ2A 1IWPB 1MJGM 4BNVA 5FWYB 1FRFS 3KJNA 4MR7B 1K0FA 3PNLA 2CVQA 1OX5A 1RBYA 1T3ZA 3TI7A 1Z6XA 2VNSA 1V6AA 4FX5A 1TO1E 4J16A 2I6XA 4J16C 4URUR 3VTFA 3BORA 1E4EB 1GVHA 1HQCA 4CIBA 1MGOA 2OR3A 4TZKA 1JU3A 4YNBA 4P8RA 3IQXA 4CMJA 4EG4A 3NASA 4C7JA 4FWBA 1GAJA 3ITDA 1RZUA 1DKUA 2B3DA 4XKJA 1YI1A 4ZYZA 3U61B 1G7TA 1SCNE 1VXRA 1A4UA 2AFRA 4RK7A 3SIRA 3VU3A 5G1PA 1RJ9A 1RHQA 1ZM9A 3KUXA 3X2FA 2EKBA 2HSJA 5C53B 4Q19A 2QAGB 1HT1E 1PRYA 2GKGA 2LRHA 3FLMA 3G0CA 3GGCA 1XAGA 2WD7A 3OWHA 1EFDN 2VFAA 4FONA 3NOQA 2HQOA 3O8OB 4JLBA 3B3JA 2GEJA 4Z7OB 4G25A 1EA5A 4MAFA 5ALHA 2J0UB 3ZXYA 1PF7E 5SY9A 2WIBA 5AXBA 2G3YA 2OL4A 1A8IA 4P33A 1N9GA 4FEYA 4RY9A 3A06A 1U02A 2JGMA 1NE7A 2G4CA 3IEXA 4ENWA 2F43A 3W34A 3LSTA 2PKYX 4JU8A 4RD2A 3ZWVA 3AM5A 1K4MA 3ED5A 4R8MA 1Q7EA 1O7JA 2I4OA 3EGXB 1H22A 2JJ2D 1KDOA 3W9YA 1BHSA 1HE3A 2R6JA 3OOHA 1B15A 5CB4B 2GASA 2RKBA 3ON5A 5FPQA 2IYUA 3KB8A 3ZS8A 4CMCA 5J58A 2PRJA 3T3MB 1ADCA 4A27A 1VIMA 2BR3A 4PEVA 3MWJA 5I7SA 4JEMA 4MCAA 3IEMA 4ALJA 1HL3A 1ZD3A 3IAXA 3NEAA 4MO9A 1IPEA 1O9HA 2J9FA 2Z2IA 2Y0DA 1A96A 1FLAA 3MTQA 2L18A 4Q00A 3VSEA 1UAYA 4S1PA 1YOVB 4U2BA 1UC4B 3WLPA 2LUOA 3LNTA 3MPUA 3RS7A 5DM70 1RJWA 4ZVQA 5EP4A 1PQWA 4HDMA 3DFKA 1QVVA 2H7VA 4MYDA 4UBMA 3G8CA 4E5KA 4EM6A 5K9ZA 1IRIA 2PANA 3LW8A 3K9HA 3BUSA 4N47A 4PE5B 5JNTA 1Z2EA 4PW0A 3ODPA 2O2XA 2J0QA 3G9QA 3D2AA 2DKFA 2W6CX 1MTZA 4GXTA 4LE0A 5U4QA 3TIIA 2MMGA 4RDHA 3RABA 1AK2A 4H7JA 1C2TA 4O2BF 2Q7XA 1U3DA 5D00A 2C2YA 1PGJA 3HNPA 1NJ2A 1UBFA 1YVDA 2BGNA 2JIBA 3PNOA 4HNRA 3ZEAA 4CKWA 3UBMA 4B81A 1JJFA 3PP8A 5IDQA 1SKYB 1XZFA 1SU6A 2ACKA 2Y1OA 3DVLA 5DRTA 1PUJA 1AK9A 2J31A 2H85A 4BQIA 1W1IA 1KRWA 4LI0A 1U7DA 1LJLA 2XXAB 5ABPA 5IN4A 1RDFA 1VBMA 1QHXA 2GM9A 4G4SP 4LUCA 3GFGA 3WGHA 3IS3A 1WBDA 2I6TA 3LFUA 3NO4A 5C31A 3MWGA 3VPDA 1ZP6A 1TE2A 4YT8A 3IP6A 3P71T 4TQAA 1I6KA 1C5KA 3JVIA 1Y98A 3CPEA 4OVKA 2P65A 4FD3A 3TSAA 4K9KA 3TFWA 4KXLA 4V0LA 2GBCA 3DGEC 5GINE 1GNQA 1XZBA 1JFRA 1Y5NA 4MHTA 3KQQA 3PC7A 1UZMA 3AI2A 3UGKA 1Z37A 5BPFA 4N5DA 3ENNA 4UUBA 1TZKA 5EKTA 3T1OA 3K2IA 3LUFA 3I9FA 2X9VA 2P30A 4CQLA 1R0BA 1PZNA 3ITEA 1G1MA 2JZNA 2ODQA 2XUOA 1DAKA 4CKBB 6YASA 4XWYA 3MWYW 2GN2A 1U0HC 2X8AA 3PXXA 4FFDA 2WF9A 4C2AA 3A1EA 4R4JA 5F7OA 1VKHA 3BTOA 4G0ZA 2WF7A 4DW8A 1Z2DA 3P4YA 4XIIA 1WHTB 2HC9A 3SE7A 1S3IA 3I8XA 3O2QB 4MDHA 1STOA 3T4EA 3JYNA 3AR2A 1TM3E 3NVMB 1E6UA 5MGBA 1J5EB 4G3XA 4OHBA 1UXKA 4PLCA 5AT1A 1QP4A 5BSMA 3RF7A 4F60A 3UHFA 2ET6A 3P0RA 4FZVA 4U3JA 1GUYA 1I01A 4KNWA 4TVKA 4E3WA 1ZKDA 4NHOA 3E1SA 2PUVA 2VN8A 3O26A 4I4TA 3IKVA 1NV8A 1GGMA 3NJ4A 2DM6A 4JUDX 3D4OA 1OI3A 3EBOA 3WYDA 2OK8A 5B6PA 4CIWA 2IS6A 2TRSB 4BVGA 5JSUA 1ZM3A 1KSHA 2AKYA 1EFAA 3MD9A 1J25A 2LVBA 2VQ6A 3B3QA 3NUZA 1U3UA 4RZUA 2OCKA 4ZWNA 4QHYA 3SFZA 3HYRA 5KKNB 1LD3A 1GPBA 1WB4A 3G0IA 4L9SA 4PLZA 1DAMA 1Z8HA 1D2GA 4WIAA 2GVNA 2K5UA 4RPCA 3DWFA 3IQHX 4J7CA 2QTAA 3EW7A 4NK5A 2PMKA 2A1UB 4RVGA 5AJUA 4DJJA 4M0DA 2D5IA 3ROGA 1RXUA 3HCAA 1SWWA 1UP4A 2PJUA 3AGQA 4ABYA 2XTJA 4Q4HA 3DV0A 1AA9A 1YSCA 1CZKA 1OX4A 1JU9A 4AUNA 1TLLA 4P7FA 1UWLA 4YALA 2PQ0A 5LU8A 3A9WA 3EFEA 3OX2A 4MVJM 5DF1A 1QCCA 3IPRA 2DKOA 2W2NA 4P98A 2PWZA 1FCJA 1NKVA 2WF5A 1XA4A 3I9MA 5G2OA 3U3JA 1B6RA 5HKBA 5FUWA 3G5AA 3NBYC 4UD6A 3AP2A 1ORHA 3B51X 4N40A 1YA8A 5J4LA 3PXDA 4RXTA 3G1TA 1SC9A 4RHXA 4X5OA 4GQAA 1TM1E 4V0QA 1NX6A 2DY0A 3MTEA 3FOWA 1DV2A 5CLIA 5B6IA 5IJ0A 5IMSA 4F71A 3KJEA 3WK5A 4MW2A 5HQ3B 4QJIA 1NXVA 2I3ZA 5ELMA 2W43A 3PDJA 4DAEA 1P44A 2WK1A 1UBCA 2ZE6A 3IIEA 5CT8A 2IW1A 2OA0A 3JR7A 1L7QA 1NF3A 4Y1RA 5IM4F 2PA0A 5BT9A 2QU8A 3GLGE 3IAAA 3N2GB 3BWYA 5I9MA 3HO1A 1KJ8A 2E89A 2VBCA 1HRDA 3FTEA 1B14A 4CEIA 1YCHA 2Q5IA 3Q98A 4AJIA 3ZD7A 5DNVA 2YRWA 4AX4A 5IFLA 1ZIPA 5JAMA 2QORA 4EGSA 2VL7A 2NSDA 1L5SA 4HGNA 3BWDD 1PNVA 1R9JA 4MHOA 5BSKA 2KQUA 2VOJA 2YJNA 3FHCB 2FZKA 3CE6A 3OOJA 3AO0B 1Z7BA 3AUFA 1D03A 1T36B 3KJFA 1SVIA 3P8ZA 1E9CA 1V9CA 2YWCA 3KVVA 4MVXA 2BM1A 4WZBB 1G8FA 5FPSA 1ISMA 3D0OA 3JXEA 1GPUA 1PWYE 3JZIA 3LVFO 4MVJG 3TL2A 2CXQA 1QH8B 1X9IA 3NC0C 1MNAA 2OCAA 4PAGA 3WMXA 2WSYB 2P9FA 2VC2B 1VBFA 3LTEA 4ZIRA 2REQB 4X1YB 3UK2A 1JHYA 3ZK9A 4MMZB 3WQRA 1QHFA 2X9NA 3FSJX 3L77A 4WZAE 3KYIB 4MMYB 2NZJA 1JDUA 2FN8A 2H4HA 2IVFA 2EARA 1X7GA 1E7QA 2DWUA 2ZAYA 5EIAA 1TYAE 3IMKA 2IY7A 2ZYRA 2DR2A 1P4RA 4RMJA 4W8HA 4KXMA 5DASA 4C2TA 2ASVA 3OUUA 4A0HA 4KQ2A 1YE3A 4PLVA 1ZH6A 3QG1A 1WG8A 4RTKA 5AHXA 3HDYA 3LFHA 1Q50A 4R7GA 4W7SA 4PX3A 3HJHA 1OH8A 4HGZA 3LKDA 1H2YA 1XZDA 1P62B 1ZJWA 3VNVA 2P2DA 4D9CA 3WQSB 5T6MA 2F3TA 2KHZA 3ZWYA 1V4BA 2A1IA 221PA 5AOAA 3SEQA 1T34A 3ZV6A 1I7NA 2KLBA 4F4DA 5MN5A 4IDFA 3TKLA 2I2FA 1L8XA 2PGNA 2SCUB 1VSVA 3SIWA 1QFSA 3Q3GE 1O96B 4N3NA 3TDNA 5J23A 4K9QA 3B5JA 3R20A 4HH0A 2WFAA 4JP3A 1R8SA 2GM5A 1Y6QA 3SR3A 1QB7A 1N8NA 1P6UA 1GPMA 2J5BA 2Q6VA 4NBLA 4Q3LA 4TKMA 5F98A 3CSUA 3LYUA 5KTPA 2AMYA 4JUFA 3AI7A 3T9DA 2J5XA 1KI2A 4JOQA 1Z4LA 2H17A 1GTL1 2PR2A 2ZOSA 4X20B 4PYQA 3EYAA 3RTDA 4RTQA 3ABZA 2W2MA 2X5OA 4B45A 2DFNA 3OT1B 1YONA 4ZT5A 4BRSA 1ZNYA 2QRZA 1NR7A 3LSYA 2Z3WA 3K70D 1M9NA 4BTVA 3T5BA 1OA0A 2WVGA 2ZU6A 4G36A 4ZVKA 4C4XA 1I3MA 1TKAA 2BDEA 3G9TA 5IXYA 5JE8A 4YRKA 1KI9A 1WXDA 1IY1A 3CO5A 4PS1A 3CKYA 2G82A 4G2NA 3R0ZA 3IURA 4H7PA 2PFSA 4IF6A 4B73A 5JAQA 2IPMA 2O3QA 2FRVA 1W73A 4AO8A 1S3GA 5A4IS 3A4TA 1LU9A 4YXFA 2HK8A 2O2SA 4BO5A 4G4SO 1AE1A 2AW3A 2EFGA 4ZI5A 2GJKA 1SUCA 2GDJA 4KXQA 3N87A 4DMFA 2PL3A 2Z4SA 5CM2Z 2FMTA 1QF9A 1AUVA 1LWNA 2F1IA 4UTXA 1XNRB 3HA2A 1OKKD 3MXTA 3K16A 3KSDO 5ALQA 3IMCA 1GAXA 1KZ9A 5SYMA 4D3YA 1ENYA 4D82A 1J5XA 1YFKA 2G7MC 4M0EA 1VHLA 3DKKA 4YDRA 4UNIA 1ZUD1 1Z29A 4HAXA 5JISA 4AS1A 1DC6A 4Q12A 2WWFA 5F35A 2NO0A 4LRWA 3RG8A 2RCYA 2M6RA 3G0HA 4ECEA 2CL7X 2OENG 2RJ3A 2UZ3A 2G28A 4XEUA 5B2FA 4OHZA 5FOQA 1HRKA 5IAGA 5KWSA 3IQIX 1TJ4A 1WXWA 2QZSA 5IVPA 1V95A 3TLEA 3FCSB 3Q3IA 1JYSA 3UMSA 1PVOA