4RTKA

Complex of escherichia coli dna adenine methyltransferase (dam) with sah and with dna containing distal pap regulon sequence
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
245
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 81
structure length 245
sequence length 268
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtkA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtkA01
2OYRA 1QAOA 3I9FA 3K6RA 4IV0A 3TM5A 5ICCA 2I62A 5DM1A 4AZTA 3V8VA 3AY0A 1RJGA 3DXXA 5K0BA 3E05A 3EGVA 4KDRA 4OBXA 2PGXA 3OFJA 4PYOA 4DZRA 5CVJA 2IH2A 2Y1WA 5HOQA 2ZW9A 4PGHA 5DSXA 1HMYA 2NXNA 2PVCA 3NJRA 2AOTB 4EKIA 5KVAA 2IDJA 2ZSUA 3BGDA 3UBTA 5GP1A 1OR8A 2JHAA 2ZBRA 4PYNA 5E2AA 3SSMA 4DM3A 2IP2A 4OQEA 2IFTA 1EJ6A 2P7IA 3FTCA 1TW2A 1NT2A 2Y1XA 5EPEA 2GAFA 2FCAA 2OKCA 3I64A 3HCDA 1R8YA 4DKJA 3KQVA 3LBFA 5HILA 3A26A 3A25A 2VDVE 3P2KA 3R3HA 2ZBPA 4R6WA 3SX0A 1NV9A 3C0KA 3B7PA 5LQJA 1RJFA 4FSXA 1EIZA 1DUSA 5ICFA 2B78A 2IIPA 1F3LA 3ANXA 1SQFA 3CBGA 4R6XA 5DRYA 3X0DA 5K05A 1X1DA 4PYIA 5CM2Z 3UJBA 5EVJA 4YV1A 2Q41A 2ESRA 3OZSA 3PVCA 4QDKA 2IGTA 3EMBA 4KWCA 4RTKA 5DPMA 5GWXA 2P7HA 1RI1A 3FUUA 4HRAA 3HCEA 1O9HA 3HA3A 3P9KA 2YX1A 3G2QA 1VPTA 2JHPA 2P3LA 3KQYA 4BLWA 5HIKA 2IH4A 4C08A 2CMHA 2NYUA 2YVLA 1HNNA 3RODA 2FPOA 2OBFA 4Y2HA 3GU3A 5E1BA 4E30A 3DUWA 2UYQA 2YXLA 2O0LA 5BXYA 4FR0A 5E9JA 2BM9A 1UWVA 4YMHA 2ZVJA 2XYRA 5T67A 3T7SA 3KPYA 3RIEA 3ME5A 2GS9A 3E8SA 1SG9A 2YXEA 4XUCA 5F2KA 2JHCA 2K4MA 1JG1A 2PJDA 2QM3A 2CKDA 3BGIA 3KR9A 4PINA 1X1CA 1KPGA 1UFKA 4P7GA 4DCMA 3B5IA 3BGVA 5C1IA 4P58A 5LQKA 2AN3A 1R00A 4L7VA 2JH9A 3EGEA 5E2BA 5DWQA 1O9GA 1VLMA 5EIFA 1JQDA 5FUBA 4HGZA 3P2EA 4RVDA 1L3BA 2AVNA 3O7WA 2G1PA 1H1DA 1AQIA 3ELUA 4DCGA 3OE5A 4XUEA 3OZRA 4IKPA 4OA5A 3TPZA 2H00A 4C07A 3E7PA 3LDFA 5LR6A 4OQDA 2XYQA 3HVHA 3C3YA 4WXHA 1JR4A 1QAQA 4U7TB 1XDUA 3TFWA 3I53A 4M7RA 2GLUA 2PWYA 2EJTA 2OB2A 3LECA 3LCUA 1VE3A 5GIOE 3AXTA 3FYDA 3M4XA 1NKVA 3KQMA 5F2NA 4E32A 3GJYA 3TKYA 3M33A 4DMGA 5EGSA 5EKUA 5T6BA 5JUWA 1NE2A 1IY9A 3DMFA 3FUTA 1RJEA 2Z6AA 5CCBA 3AXSA 3BWMA 5C0OE 2C7OA 3LKDA 4UOEA 3DMHA 3OE4A 1ZG3A 3ORHA 4IWNA 1X1AA 2PT6A 4C06A 3G5TA 2ZBQA 1FJXA 2QE6A 1R74A 3FZGA 2KW5A 1EG2A 1D2CA 5CVUA 3FRIA 2P3OA 2DULA 1YB2A 2PX5A 3KPVA 4HC4A 1M6EX 5CVVA 4AUKA 3PT9A 4OBWA 5K0GA 3LGAA 3CJTA 3THRA 3P71T 2G8NA 1QAMA 3EGIA 3SGLA 2AZTA 4E70A 3HVIA 4RSRA 5MHTA 3QV2A 4CXMA 2AOTA 3ER9A 2C7QA 1SVUA 3DLIA 2OZVA 4PYQA 3TRKA 3O31A 4A6EA 2PXAA 3QOXA 5K09A 4QDJA 3LX6A 2B25A 5E1MA 2HMYB 1JSXA 3MTEA 5E1DA 3B89A 3FPJA 5DT2A 2IPXA 5HZMA 4ER7A 5GM1A 4HTFB 1RJDA 3LSTA 1XCLA 2AR0A 3NWEA 4KRGA 3EVCA 4RTNA 3MCTA 5DX1A 4PNEA 2AS0A 2P1DA 2P41A 5EMLA 5EEHA 9MHTA 2IBTA 3G88A 3UFBA 3GRVA 4C03A 3DOUA 3BXOA 4F86A 7MHTA 2FHPA 3MCZA 3VC1A 3IV6A 2QRVB 8MHTA 3DH0A 5FHRA 5DTRA 2C7RA 3Q87B 3TKAA 2BH2A 5DTMA 2GH1A 4GQBA 2Z6QA 3ID6C 3PS9A 3OZTA 4V0RA 3SSNA 1Q0TA 5FA5A 3TR6A 1Z3CA 1EJ0A 4LG1A 2OB1A 1G60A 3DR5A 5EG5A 2VS1A 3LKZA 3MERA 3GO4A 2AOXA 5FQOA 2V7EA 1F38A 1QYRA 3G2PA 1ZGJA 4P7FA 4RWZA 2PX2A 3BKXA 4JXJA 4RVHA 3E23A 4F85A 2ZIEA 2VZ9A 1WS6A 1JTFA 1G8SA 3NVMB 2AOUB 2DPMA 5DM0A 5FTWA 3OU6A 5K0JA 3HCCA 1L9KA 5GM2A 3KQWA 2I9KA 4YUVA 3GXOA 4X63A 2FK8A 2ONYA 3OFKA 4PCAA 4ER6A 3THSA 2UYHA 1KP9A 1T43A 2ZZKA 3DULA 4ER5A 4RTPA 2R3SA 3IHTA 3KR2A 3EVGA 5E9QA 4PONA 2ZTHA 3R9XB 3FPFA 3HA7A 3KPUA 5K03A 5FULA 3OCJA 4M36A 2ONZA 3GWZA 1M0EA 4E31A 2PT9A 4GUAA 3MHTA 3KPWA 4M38A 5FHQA 2C7PA 1MHTA 5EIWA 4GOND 4P7JA 4BP1A 2AN4A 3GRRA 4XCXA 5G02A 5DM4A 4FS8A 1VQ1A 3LCVB 3WSTA 5ICEA 2OPBA 1L1EA 2PSSA 5K01A 4QVGA 4MQ4A 1X19A 4NECA 5EZSA 3KR1A 4AZWA 3ERCA 4DQ0A 3KQPA 5K0CA 4RTOA 2LD4A 1G8AA 3BKWA 4EK9A 3JWGA 5BP7A 3DMGA 4YMGA 3G5LA 3P9IA 2PLWA 5DLYA 5EZQA 3A7DA 3FUXA 2QRVA 2HNKA 5K0LA 1KYZA 1I4WA 4RTRA 1XDZA 3UJ8A 4KIFA 3KQOA 4HSGA 1Q0SA 5FCDA 4X61A 3ELWA 3P9NA 4E2YA 5K0FA 2A14A 5GIPE 4MHTA 2AOWA 1D2GA 3CVOA 4G56A 5GOZA 4AX8A 4B17A 1JG4A 4GOOD 3FPHA 2BM8A 2QY6A 3DXYA 1VL5A 5FA8A 3SXJA 4BLUA 5KQRA 3PLAE 4RVGA 5EHGA 4ZTBA 3CKKA 2ZZMA 1N7JA 3BWBA 3KQTA 3HVJA 1KR5A 1SUIA 3EVEA 3C6KA 3HVKA 5DXAA 3SR4A 5FADA 3QOWA 1DL5A 2G71A 4CKEA 2ERCA 3PFGA 2NP6A 2OO3A 3KPJA 4A6DA 5IKMA 3P9CA 2P8JA 3REOA 4YUYA 3DTNA 5DSTA 5HIJA 3BWCA 3GIWA 3NTVA 4CTJA 3UJDA 3T7TA 4C04A 2EFJA 1BOOA 3MAGA 4RTQA 2PBFA 4KIGA 4GF5A 1P1CA 3HEMA 4PWYA 4LECA 1L3IA 1YZHA 3IEIA 4MWZA 2HTEA 3GRYA 3VYWA 1KYWA 5KYGA 5KS2A 3PTAA 4M37A 4EMSA 2G70A 3DXZA 3M70A 4PYMA 4U7PB 2V74B 2NP7A 2HV9A 2JH8A 1FP2A 1R8XA 1NW7A 2EX4A 3Q7EA 5FQNA 3VC2A 3AWIA 4Y30A 2GA9A 3EVAA 3P2IA 2BR3A 2P3QA 1NW6A 3CCFA 3KU1A 3KR0A 1I1NA 2BZGA 3R24A 3EEOA 3LDGA 3OU2A 3ELYA 3L8DA 2PKWA 2OXTA 3TM4A 5E8RA 1XDSA 4CKCA 4EVIA 5LQUA 5CVEA 4BP3A 4Z2YA 5DXJA 1YF3A 1QANA 1UIRA 2PWPA 5DM2A 4E33A 2JJQA 1JTEA 2O57A 3NW9A 4EKGA 5K8VA 3R0QA 1SQGA 3OU7A 3A4TA 3KQSA 1NW3A 4ER0A 3UJCA 4YUWA 2GPYA 4ATNA 4E2ZA 1VP9A 3PB3A 4HTFA 4ISCA 5E1OA 1O54A 3UJAA 4GC5A 3TQSA 2ZLBA 5E8JA 4HGYA 4IV8A 2CMGA 2OY0A 4GOMD 2AVDA 2PXXA 3UA3A 1NW8A 3LHDA 4RTJA 2WK1A 3CJRA 1PJZA 3G2MA 3GDHA 3LDUA 3NWBA 3FTEA 3JWIA 1JG3A 2PXCA 2NXJA 3S68A 2HR1A 4RYLA 3EVFA 3B3FA 1KPHA 2IDKA 3HNRA 5JR3A 1WY7A 3C6MA 3M6VA 3FTFA 3G8BA 5CIYA 1SUSA 5EKXA 5C9ZA 3SM3A 2YQZA 3MB5A 4QVKA 3SVZA 3UA4A 4PGGA 1ZGAA 1SKMA 3K0BA 4RVFA 2ZFUA 4MTLA 1FBNA 2P35A 1FPQA 4R8SA 5ICGA 3AJDA 3PX3A 2O07A 1ORIA 3M6WA 3HCFA 3T7RA 4C05A 3EEYA 1NW5A 3P8ZA 3NDIA 2CL5A 1BKYA 5DRTA 2XVAA 5LQRA 3GRZA 2EJUA 1V39A 3LL7A 3OPNA 5U4XA 2PV0A 3BT7A 1R6AA 4OA8A 5EOVA 1G38A 1YFJA 3HP7A 3PX2A 3SMQA 5KQSA 3HCAA 2WA2A 4RTLA 1P39A 4XUDA 1RI4A 1NBHA 2FRXA 5P8WA 4CWAA 3GRUA 2P40A 2NXCA 4P7KA 4FZVA 1XTPA 2PX8A 2XVMA 5K0NA 4DA4A 3BWYA 5CVDA 2BR4A 3EVBA 3A7EA 2ZIGA 1TPYA 1AF7A 1KPIA 1KXZA 1WXWA 3G89A 4AZSA 4YUZA 3FYCA 2CWWA 3HCBA 1YZ3A 3MGGA 3B3GA 1ZHFA 2I6GA 5DTQA 5HIIA 3NVKI 3KQQA 3MQ2A 2N47A 4V0QA 5D1HA 5ERGB 1P1BA 5DX0A 4GC9A 3NMUF 2H1RA 3CC8A 4FT2A 2IBSA 2B9EA 1PRYA 1WG8A 2E5WA 5FWDA 2FYTA 3LCCA 4QPPA 4RV9A 1INLA 3I58A 1L3CA 3V97A 1BHJA 2B3TA 2QYOA 1X1BA 3BZBA 3T0IA 3TMAA 1JSZA 3CGGA 3F4KA 3G2OA 5EEGA 5T64A 2EG5A 1MJFA 5LQAA 3FUVA 3ER8A 1IM8A 2I7CA 4X1OA 4RTSA 1G55A 4HH4A 4K6MA 5EQJB 5BW5A 1RI2A 3D2LA 1YFLA 1XJ5A 3FTDA 4QTUB 4WVLA 4X60A 5HFJA 4AZVA 5M5BA 5EC8A 1KHHA 3GNLA 2AOUA 1M6YA 1VBFA 3P97A 4O29A 2Z6UA 3A27A 4GBED 2H11A 4C4AA 1B42A 5GINE 2B2CA 4QPNA 2AOVA 4R05A 4PYJA 5DX8A 2UYCA 3O4FA 1XVAA 3SSOA 4R8RA 3DP7A 4HG2A 4X41A 3UZUA 1U2ZA 4BLVA 3HTXA 1R18A 2XYVA 3TLJA 4GOLD 2UYOA 4QQNA 1WXXA 3TOSA 2F8LA 1EQAA 4YV0A 1QZZA 1VP3A 2PX4A 3MTIA 3FPEA 1JQEA 5B1SA 3UJ6A 3HA5A 2NXEA 3PFHA 5E9WA 4OX9Y 2VDWA 4CKBA 2ORED 2O05A 2ZWVA 1ZKDA 1VIDA 2PY6A 5LSAA 1G6Q1 3EMDA 2ZCJA 2GB4A 4PIMA 3CJQA 3H2BA 3ELDA 3GGDA 3KHKA 2VP3A 3M6UA 2ZZNA 1EAMA 1WZNA 3C3PA 4PCLA 3EVDA 3LBYA 4RX1A 1P91A 4FT4A 5FWAA 3G7UA 3JWJA 4FP9A 2XBMA 4YV2A 2YXDA 5EMMA 4MIKA 5HEKA 1JG2A 2VDUE 4FGZA 1RI5A 3FPGA 4YUXA 2UZ4A 3U81A 2YTZA 3FRHA 3R6TA 5LQCA 4E2XA 2YUIA 2AN5A 5EHIA 4E2WA 4QQKA 4BY9E 2G72A 5CCXA 5EMJA 2YR0A 1JQ3A 4LWOA 1AQJA 3EPPA 3BUSA 1N7IA 2WA1A 3UWPA 5EMKA 5HIMA 5H02A 3JWHA 4CTKA 3B3JA 1AV6A 3KKZA 1ORHA 5CD1A 3LPMA 4PIPA 5IH3A 1IXKA 1NV8A 4POOA 1KIAA 2FK7A 3HM2A 2ZWAA 4KW7A 4QTTB 2BR5A 5F2OA 3DLCA 3FUWA 4LWPA 5BW4A 5CUQA 1DCTA 1BC5A 4F84A 1NBIA 4RTMA 1I9GA 1XXLA 1ZQ9A 3RW9A 3GCZA 3UJ9A 4DF3A 4ER3A 5LQNA 1XCJA 4KDCA 5D1NA 10MHA 1TW3A 2JG3A 2IH5A 2ADMA 1RI3A 1FP1D 2R6ZA 2ZIFA 3I5UA 1N2XA 4FSDA 4GEKA 4PYLA 4EQZA 3VSEA 3EVZA 2ZULA 1D2HA 3G8AA 1YUBA 3IYLW 2HWKA 2O06A 4KVZA 3UJ7A 2NNWB 3NDJA 4H0NA 3M6XA 1Y8CA 5K0EA 4PYKA
chains in the Genus database with same CATH superfamily
2HX1A 3MLBA 2MSEB 4HH3C 3U4IA 1L5GB 2OUKA 2QLNA 3SS8A 1DJPA 4ETMA 1LTKA 4C7XA 1RKUA 3EGVA 2VJMB 4KDRA 4N54A 2FJUA 3CF4A 3G1UA 3RTEA 1A1VA 5TMBA 1TVMA 3TLMA 3EZLA 5FLXA 1PWHA 1DO2A 2NXNA 4G5RA 4GICA 4DNXA 1AD2A 4EO7A 5AIBA 2HK8A 3E9NA 1OR8A 5A02A 2NZXA 2X3FA 2JF0A 2YWFA 1W35A 1Z2EA 1T8TA 2P7IA 1L0BA 3L5KA 1ZZEA 3QEKA 2BFBA 3MINB 2JASA 4OF4A 4QAQA 4V0OA 3DDOA 2WM2A 2WT9A 2RKWA 3FVQA 3EA4A 1EG7A 1G21E 2CZQA 3N6RA 3MB8A 1A69A 3A25A 4Q5IA 1B93A 5D00A 5DI3B 5ALPA 5ALVA 2JAHA 4WAUA 1RDFA 4NESA 1I7QB 4LCBA 2GWHA 1EIZA 5J4HA 3ZBUA 2WNHA 4UEQA 5LZ2A 2GARA 3ANXA 2B21A 4F96A 2ZVDA 3DJYA 2KE5A 4PYIA 4ODIA 5EZYF 5KHAA 2ENWA 4CDNA 4YV1A 1YUNA 4DMHA 4BKQA 5A0TA 4FEGA 3ROZA 4LJ9A 1R15A 2HJ9A 2IGTA 2PQ6A 3F6EX 3JZAA 1PBTA 4UQPA 2VRBA 3K96A 3HR7A 1VKRA 2ZE6A 1Y80A 3OEWA 2NU7A 5H3CA 1R6TA 4IH4A 4MR9A 1XYYA 3C3MA 3A32A 3MUOA 1VSQA 3SBEA 1JIKA 2J85A 3USZA 5HIKA 4ZOBA 1YUMA 3V8RA 2NYUA 3NBZC 5TPZD 4X62B 4X24A 5KTNA 4Q1VA 4QZVA 4XR4A 5IF3A 1PQUA 5L3ZA 1UOQA 3KDSE 3CINA 3ZZNA 4EFNA 2B98A 4OHWA 2W6PA 4Y9TA 3WNZA 2WWYA 1U1EA 3P45A 1A8UA 4BAZA 3LE8A 5FAKA 1CJSA 4ZYTA 2OHHA 1XQYA 2PZFA 1Q19A 2Q28A 1NAIA 1X8LA 4WD3A 1T1JA 2IHKA 2JL1A 2Y9PB 3ED5A 2LPMA 1UZMA 4LZWA 5B58C 5EQDA 1W59A 3T1TA 3TAXA 2Q5CA 1QWOA 4ZMRA 1B0UA 1UFKA 3RUAA 3CUKA 3IP6A 4P31A 2AN3A 5LP6F 4C6HA 1ND6A 1ZUIA 2N42A 1M2OB 3W7AA 4E22A 3AF6A 4YI3A 4WLFA 5A3JA 3OWXA 3QBJA 1RXUA 2PYZA 4BFYA 1XEAA 4J2OA 1D03A 3PRKE 4K28A 1CFZA 1PNOA 1P29A 2IY9A 1XZ8A 2AHRA 1MV8A 2JFBA 4PAGA 3RRMA 2ZI9A 3FBGA 1JWAB 3TUJC 1F2UB 3CVVA 4KOEC 2Q3LA 4C4SA 2JZOA 4A2PA 5FOSA 5TSDA 3M4XA 2JRCA 4NRDA 1LI5A 4MDHA 1K3UB 4HF7A 2VCYA 1XDGA 3Q3JB 4OHXA 5JQWA 2ZUDA 5KTKA 5KYWB 4TYNA 1JDPA 4XLZA 2HUPA 5AVUA 3KZCA 3AKEA 1NUHA 2AF4C 1FFYA 5THKA 3UHOA 621PA 1TF2A 2YWCA 1TZJA 1ZMTA 2R8EA 3Q7RA 5FBLB 2EL7A 4EG0A 2PMCA 3O8BA 1D8AA 3VSBA 4C06A 4GECA 3AR5A 4KK4A 3HYNA 5BR7A 1C3EA 2Z4TA 4BX0A 1KVQA 5IRCD 3FLEA 3FWNA 3FOEC 1DTWA 4RMGA 4Z86A 1IHDA 5FL7A 3EFOB 3KPVA 2FVXA 2DY0A 4IDOA 3JD4A 1EUQA 1P5JA 3WGOA 3NAQA 1GAEO 1O5TA 4ZKEA 2O3TA 3ZXSA 4NE2A 1D1PA 1DAMA 3TLZA 5FP0A 1OROA 3KHSA 2PMWB 3TW0A 4E70A 3NRJA 4IIJB 5I7UA 1F12A 2IE0A 2AOTA 3E27A 3EE6A 2QSJA 3IKMB 3ZZ1A 5HG0A 1EXNA 3GLFB 2DXIA 3AEYA 3W2FA 4DMFA 2QB5A 3IE1A 1JW9B 3K72B 4TTAA 2XCOA 2XUZA 2EHJA 3NAZA 5I4BA 3K2IA 2A2ZA 5FPSA 4UTVA 3H9CA 3P9ZA 1BS9A 4WLOA 1GFIA 1RJDA 1Y3CE 4FHCA 2D0IA 3JQBA 4H7HA 3QX8A 5AJYA 3VYRB 1IB0A 3RK1A 3SOZA 4A3SA 1XJCA 5BSWA 1DAGA 2H5IA 2A9RA 1L4LA 2WINI 4COKA 2IUYA 9MHTA 5ABPA 3B82A 3ZV6A 1ZU5A 6CHYA 4D25A 4H18A 3EASA 3ABIA 2N1BA 1GVHA 3WAKA 1NVTA 1M34B 5HQJA 5KX5F 4F5EA 1ZI6A 5FHRA 2FPSA 4TTSA 4DWVA 2VKTA 3K0AB 3FZEA 4OLAA 1MX5A 3OZTA 1OFGA 4NLLA 1M8GA 1P1KA 3H6HA 4ZIRA 1DFIA 2BCJQ 3M1IA 4HDMB 5DU2A 1IBKB 1Z22A 2ONKA 5JMOA 4RORA 2O7SA 4JI3B 1HQCA 1EM6A 3U7HB 2ZE7A 4JIGA 4UUQA 4ZRMA 3TIGA 1XMOB 2J33A 3SD7A 1GAJA 1E0KA 2VZ9A 4KR0A 1Z6PA 4JI6B 1G8SA 3LXXA 8ADHA 4QOFA 3SC6A 1IJKA 3F96A 4UM8B 3KEOA 4JL8A 3CWZA 2D1SA 1N6HA 3JZIA 1ZGHA 4KMRA 1FSSA 4TLAA 5KPDA 4Q3BA 2YN4A 2JFFA 2Q1WA 3NT5A 4OFBA 1DKUA 4RHTA 2WHEA 3C97A 2IUEA 1FDIA 4LV8B 1AUXA 1JZTA 5AW8A 4JT8A 5HSGA 2CYAA 3E58A 3RUCA 3WLMA 4QU8A 2Z8XA 4M22A 4GU5A 4PVDA 3DZCA 3T5GA 5C7OO 1YNSA 3OZCA 3GHHA 5DYIA 3N2YA 3MHTA 2QX6A 4D98A 5IDWA 3PJFA 2DUMA 3I6BA 4ND3A 1JHPA 3HB0A 4HNRA 4QXQA 3T4XA 5HKLA 4XQ0A 3E9QA 4XW2A 3ZS9A 3DAFA 5ICEA 5FBKA 3QX3A 2OPBA 2A9VA 5KMGB 2PTHA 3T38A 2YMLA 2GK7A 1B7GO 5LYJB 3L1VA 5LMZA 2EKPA 1Q1EA 3ERCA 4AZWA 4AJNA 4E07A 2ZROA 3KQNA 2BELA 4H31A 4RMIA 1VL6A 3ZC3A 2VOJA 2WJJA 3HR4A 3U4HA 3LKBA 4JAVC 4R81A 5CYGA 1ZUD1 3A7DA 2BD0A 4NH4A 5LLSA 3LA8A 5KYWA 2CLLB 5G1NA 3PUVA 1P2SA 4KIJA 1F8FA 1N2CE 5CR9A 4ZP1A 3ZK7A 1U5CA 3TRHA 1MB0A 1EUCA 4WERA 4DUYB 2IIBA 2PTGA 4PGMA 2A0UA 4G56A 1CQZA 1E8DA 3SHFA 4PPFA 3VNSA 1MPXA 2BAGA 2LKDA 3HU3A 4I55F 4FWTA 5SZJA 1VSBA 4EG7A 3AUYA 3PYXA 4LGVA 3D8BA 3SXJA 3KTDA 1PG0A 2CE2X 5IKXA 2YXPX 3NEAA 4Z7QB 1VE5A 1CHDA 3O8OB 2GXQA 4KV9A 1ES9A 2FW7A 2HIGA 3N8DA 3UCXA 5FUQA 1A9ZA 2ZZMA 3F8TA 1Z5VA 3LOUA 4PTLA 3EVEA 2VTBB 1GY8A 1VIVA 2O5VA 3KJNA 5IAKA 5IWCA 3WO0A 2VPTA 3ZI0A 2XEDA 2ODEA 4HWSA 3DV0B 4P3KA 1CR1A 1M75A 1WXDA 4IAOA 2CHFA 5I9TA 4XCVA 3MOIA 1JEQB 2OV2A 4G0QA 1A3CA 1TIKA 4RDHA 3TB4A 5KTSA 1AK1A 3BTSA 2D7CA 1MJGA 3NC0C 1DX9A 4QODA 5DB4A 1HNXB 1CUSA 2R86A 3DVLA 2Q21A 2C94A 2JFQA 5KZMB 5L3QA 1OCEA 2GZDA 5T4FA 1Q91A 1FNSA 1TOAA 1WP9A 3QMPA 2HTEA 1CS4C 3DHYA 5M2QA 3ZWNA 4M37A 3EDQA 4UCXA 4EMSA 1EK2A 2G70A 2WHPB 1RQ2A 3JAKA 4BBAA 2XOKD 4S05A 1CR2A 1MFPA 3JYQA 4B6QA 1LW7A 1CRLA 1KI6B 3MYYA 5BV8A 1OAKA 3ZCXA 3SJ7A 2QN9A 3KU1A 4XXHA 1CCWA 1S0UA 3RSZA 4KQIA 1X7YA 3R24A 3UNXA 1DHTA 2VP0A 4X6YA 3SJCA 3EPHA 1EBUA 1WMDA 1Z35A 3KE9A 2JFVA 2WYOA 1R6VA 3QRWA 1U1DA 5CVEA 2JLXA 5DM2A 2Y0BA 3TNLA 3U6KA 3JS5A 3LT5A 4OHFA 3ZNNA 4BLRA 3BERA 3R0QA 3L8EA 4JYPA 1JIVA 2R6FA 3BMXA 4FZ3A 1JNYA 4O1MA 3TQTA 4AULA 4G1MB 4CM5A 4UXIA 3VMMA 4IDQA 1CF9A 1Z0SA 4BIIA 2GCNA 4BZZA 1XTIA 3WE7A 2KBEA 3KJQA 1K5DA 1H0HA 2GJSA 3CJRA 1KH1A 3AOGA 3WIVA 4UTNA 4ZCLA 1B74A 4BFVA 5JD3A 2XWSA 3RANA 2HR1A 1Q57A 1QMGA 4R9VA 1XAGA 3K31A 2YIMA 3T99A 4C0QC 4BEBA 1Z63A 3B70A 2H48A 3E22A 1CX9B 2A84A 3EN0A 4HDRA 3FTFA 4UHHA 2Z1DA 1K3TA 2FEPA 5C8YB 4LMAA 1VG0B 2JDIA 1A7AA 1YA8A 1DXOA 4WZBA 3SM3A 3TNYA 4EM6A 1J39A 3VDQA 1A9RA 2P9CA 4ENRA 2ZI7A 3UUEA 4EJSC 5F3RA 5FKJA 3Q2OA 5AH0A 1BXRB 1ZC4A 5AXDA 4CG1A 2WIFA 4RVFA 4NBSA 1NPDA 3RTDA 4EG5A 2GAAA 2XKBA 3AJDA 4JLWA 5TNXA 4EEKA 1NATA 5TR9A 5LMNB 3HDYA 2EF1A 2O2CA 2HMAA 4JEUA 3EYAA 3G68A 3NHAA 3BRSA 2NO5A 2WU4A 2LKCA 3HN6A 4P0QB 4Z3KA 3OZBA 1U0RA 2ZAMA 2I8CA 2OGZA 3A1EA 3I45A 4DDVA 3J7TA 3QYFA 3VUFA 2ZG6A 1E1CA 1WXGA 2V45A 3E53A 2VP4A 2JK1A 3A0RB 2BZ0A 1PFKA 4KN9S 4YAUA 1TM1E 3DCYA 3H2HA 1CPYA 1UBGA 1YMVA 2M1XA 4KGVA 5BYJA 1ADFA 1XJQA 4REMA 3D1VA 4PNZA 1XMJA 3T5CA 5JH7B 3PI6A 5KSZA 3HGMA 3MLEA 4EI2A 5HKOA 1OFUA 4D6XA 1RWQA 4IWYA 1II9A 5K0TA 1Z56C 4BB9A 2EW8A 1ZNXA 2JD0A 3BXPA 4KN8A 4QPDA 4E6PA 2QXYA 3IC5A 3O8CA 1YI0A 3SLGA 4NYJR 1SH7A 1WVMA 3KP1A 4M9RA 3K9NA 2REQA 4QJ4A 1UH5A 2ZS7A 4O4LA 3RS5A 4BBJA 5JXJA 4B7CA 4DR3B 4F7WA 1OXBB 2B99A 3NM4A 4HQOA 3RS7A 4A8JC 4D9MA 5IM4F 3SIPA 3RWBA 1R9MA 1GIAA 1KO8A 4WN9A 3UATA 3ASZA 3F74A 3QLJA 2XGGA 4YRCA 3J81k 4DRZA 3EOAI 4N49A 2PS9A 4AZ3A 1JH9A 2JFZA 4HN2A 1YT5A 1AO3A 1K0FA 1OT5A 2XLBA 4PW0A 1T0BA 4PNHA 1WQ3A 2FW9A 3K6JA 5EWMA 3A3NA 3SFZA 3UZUA 5KDLA 2ID9A 3B2EA 3IKTA 1B0ZA 4KSCA 3CV3A 3ZU6A 4H3VA 5ALYA 4HVCA 1JEAA 1NRWA 4PSVA 1E99A 1JDNA 1O87A 1YB5A 3IAHA 5KNDH 4UM9D 4EA6A 5HCUA 1NP7A 3KB8A 2I2FA 5ALSA 1QHIA 1WIWA 2A9PA 4AJ9A 3QUCA 4DMMA 2PY6A 3B6ZA 3I9JA 3PGMA 3BBLA 1W94A 1BO6A 1U2SA 3OUTA 1KBOA 3D59A 1D1SA 2CVFA 3CJQA 3D6HA 4JYBA 4PIMA 2W2PA 4PANA 1NM5A 3B7WA 3KSAC 5AHKA 4LF6B 3ZIAA 2G1UA 2Z09A 4P6VF 1U6KA 2C1EA 1IZ0A 1NN1A 3K8OE 4IYJA 3C1OA 2X0EA 3G7UA 4FYHA 1ZK2A 2HF2A 2QM7A 4PZDA 2VNJA 2PK3A 4ZT2A 2ZSEA 1MP0A 3GY0A 1KARA 3EA0A 4HKTA 2OGTA 3EARA 5HS4A 4M8IA 2F9MA 1SBZA 3Q5EA 3TCKA 1OI2A 1PU2A 2CE7A 4NC9A 1QH9A 2J7KA 2PNJA 3ADBA 2Q9BA 4MB0A 1M2VB 1IIRA 1MEOA 2OXRA 3FRHA 1XVTA 4KFSA 1RD4A 4D9NA 3FVVA 5THQA 4R1UA 3BF7A 3EXG1 4D4KA 3D3WA 1GFWA 1SB9A 3BCRA 4P22A 2AFHB 1GPMA 4NHOA 5KTOA 2GPSA 2YV2A 2FW8A 2O8CA 2XMQA 5EMKA 1PW5A 1SY7A 1EZ4A 3DWIA 4R2WA 3ZHQA 1PT7A 4FD3A 1M2NA 4P54A 3EFBA 2WOOA 4WK0B 1BAPA 5DLQC 3S27A 2FMHA 1CXZA 3CNNA 2PX0A 1YHZA 2YHAA 4LJ7A 1LW6E 4F5DA 3HM2A 4KR6A 2ZWAA 3N07A 3FX2A 2FN8A 4JOCA 3U7FB 4B7ZA 1PWEA 2PLRA 5CUQA 2H8KA 3V8NA 4RFSA 2GA8A 3KZVA 5BRJA 1UBUS 4P92A 1FLAA 2FPWA 2YV3A 4KDCA 2PAFA 1FRQA 3C6ZA 5K3CA 3WK4A 1UF9A 3RRBA 2RGWA 4HNTA 2ZULA 3GFOA 3U31A 1CK4A 1NBWB 3IULA 3K9GA 3MJHA 4HZUA 4LUCA 4OK5A 3JPWA 3TSOA 1ZLYA 3VXKA 2L19A 3LLSA 3NDJA 2NZVG 1EWRA 1N8NA 4ICIA 3UMMA 2H2HA 4WCVA 5LL6P 1VI6A 4W8HA 1WB5A 2Q1YA 5ICCA 4ZAGA 3QSGA 4YT8A 4H60A 3GVXA 3VQTA 4RACA 4M7PA 2NM0A 3GARA 4DMLA 4DBZA 2WKQA 2H1HA 1WA5A 3WFZA 1D2AA 1T2UA 1V6CA 2VL7A 4M89A 3WADA 1VJTA 4TN5A 3P0JA 2C5AA 2ZSBA 3CW8X 2DLNA 4AF8A 4AB1A 1GV1A 1K97A 3WJ7A 2FV8A 2P65A 2R68A 1ENOA 2AA3A 2OO7A 5ALZA 5JLJA 3UUGA 1LGYA 2ILTA 4NJMB 2QI9C 2QZJA 2P4UA 3NGLA 4KR7A 1V2GA 1AY0A 1JEDA 1RIFA 1JJVA 2V4ZA 4MMZB 1CF4A 1NYRA 1OLUA 4MRRA 4J8PA 3ZU3A 3REGA 3S1SA 1DBVO 4KNYA 3WGQA 4CLRB 1N1EA 4F1KA 3INGA 4YAOA 1NZFA 2IIPA 4OREX 5IASA 4LRYA 1KEEA 2OGWA 4LGCA 3ENZA 4J75A 3ZVKA 1ZAYA 4GXQA 4G0YA 1G5FA 1UMCA 1E2UA 1UPFA 4QDKA 1RPAA 3MCVA 1IG3A 4S1PA 5AD1A 3EMBA 2R5NA 1BS1A 3H8SA 2O2XA 5IAAA 5IM5A 4Q3NA 4D4IA 2P7HA 4WLVA 5TJ9A 1F17A 2QLMA 4GT1A 1Q44A 5ALEA 4D92A 3CNBA 3VDRA 3N5CA 2VVTA 4PZCA 2AFHA 3WNVA 5A9TA 2CMHA 3TQFA 4HWRA 2H1CA 2JIBA 2DJ5A 4BPRA 3RKRA 3N2NA 4MZDA 3UMYA 1HLFA 1T91A 2ODPA 4NZYA 3M9XA 5CFMA 4OL0A 2OD9A 5E9JA 1E7YA 1SJ9A 3FLMA 3WQSB 2ZVJA 1G66A 1QIFA 5K51A 4A0SA 4B7XA 2HFKA 2I5PO 4LF4B 3KPYA 2JLAA 4JK3A 5A7FA 4BEVA 1KO7A 1SG9A 4H7KA 4L08A 5F7ZA 1GQ2A 4MAMA 4C3ZA 1C4XA 1A8PA 2CKDA 4HX5A 4QWWA 4X95A 1KZHA 4D74A 1E2JA 4EBBA 1SXGA 3LFUA 2CJFA 3D5QA 3KELA 1R00A 4L7VA 5B3JC 1U8XX 1C29B 2CEAA 4FIZA 4XB6B 2AFVA 2E4XA 4MCHA 3ZQKA 4RVUA 3RVQA 2XF8A 2AVNA 1GCAA 4ADSG 5IDVA 3B3QA 2CL6X 3ONDA 4G09A 1XVLA 3ITNA 5FOXA 3ELUA 3OF3A 4GXRA 1N2CA 1SHZA 1P2VA 3LWZA 3NNNA 1E7RA 3UK6A 4FI3C 3DBVO 3TPZA 4B84A 3DNPA 4U0KA 2VATA 3V1YA 5AW3A 3PIRA 1E0AA 3TG8A 4Q1FA 4G0PA 2RGBA 4IMJB 4J0FA 5KNCA 4BNGA 5T5QA 1RWXA 1U90A 2E4VA 3GDWA 1RQRA 4EATA 1WB6A 2OB2A 4LRXA 5JV5A 4C88A 5IEJA 2QP4A 1Z6GA 1DRUA 2O3UA 3FCUB 3VGPA 4PX9A 4COOA 1NVMB 3RYIA 3TSZA 4JJAA 4ZO6A 2C2YA 1PLLA 1IY9A 2HWYA 2YC2C 1C1XA 4TUYF 4BXOB 2NNLD 4NYMQ 4R9SA 3ZGOA 4UOEA 4MI3A 1JFSA 2AUMA 1KYXA 3KUXA 2XXAA 1QFJA 1OFIA 2JGIA 2JIMA 3IRUA 2HJWA 3LPCA 2R44A 3C16C 4K6OA 2QAGC 4JBNA 1DVRA 4N3NA 1USGA 2FR8C 3L6RA 4LC9A 5JQGB 2D8MA 2JJYA 3AVPA 1E1NA 4ZOLF 5HNKA 1TQ6A 2NQ2C 2AN9A 4H77A 3MUFA 3ZCPA 2LR0A 5E38A 4EW2A 4AUKA 5K0GA 1GZ4A 1RRFA 1A7UA 2VT2A 3QQ5A 1U0GA 2V4UA 4OQLA 1YE8A 4KZKA 3LP5A 3RC2A 1X3LA 2AZTA 3LWBA 3AESB 2FE4A 3ZYCA 3BRWD 5BVGA 2GPBA 2NO9A 4GDMA 2W48A 2Y68A 1OOEA 1NX9A 3D4IA 2DLCX 2OAGA 3WRVA 4I1VA 4U2GA 1NYLA 3FH0A 2ZM5A 3NJ8A 2DX7A 1MO5A 1OFHA 1Y5IA 2PXAA 4DBLE 3RKUA 2Q45A 2B25A 1JIIA 1Y5LA 2L2QA 1C0KA 1JSXA 3IVCA 5KVCA 2YWRA 4PHHA 3W4KA 3K6SB 2W83A 4ON9A 1JMYA 3OZUA 4ZV9A 4PNEA 5DF1A 3RVSA 3F3YA 2I29A 3EHDA 3O4JA 2GSDA 4MKZA 3CRZA 1QHHA 1DEKA 1VIMA 4IQ4A 2CLEB 2YY7A 1U2EA 1GVNB 3R1IA 1H66A 1XQXA 3DH0A 4V2IA 3S44A 3DO5A 3PD0A 5ILOA 1DPFA 1LLQA 3EDOA 5AHRA 1P2GA 1JHMA 1R50A 1SFRA 4I9FA 4OMDA 4JENA 3VR4A 1Z4PX 1K63A 1IJEA 2B5OA 3LPDA 3QA3E 5IAGA 1YC5A 1B6RA 1NYTA 5NLLA 3NR2A 3MERA 3I04M 4RGVA 3HDQA 2E87A 3T9DA 1XN4A 1J8MF 2PIDA 1TCBA 3BOSA 1UR5A 3FJOA 3ZHOA 4AIIA 1MC5A 3P4XA 3OU6A 1XZEA 1H1LB 2V54A 2ZIZA 3DQPA 3C5HA 3L01A 1HQKA 1QP4A 2ZJ1A 2HA6A 4J76A 4PX2A 1FQKA 5LOVF 4FEAA 4V0MA 2F8TA 2PUWA 2QPTA 1JPJA 3PXCX 2F3PA 5EE5B 4V03A 4Z1MD 4ZZ1A 2KBFA 4DADA 4ZVQA 1FDTA 3C4QA 1MO4A 3EVGA 1AOXA 1XDDA 4IHQA 1DWPA 2FFBA 1N0IA 2P69A 1JDSA 3B52X 3ZVRA 1AMOA 4JI0B 5BOVA 5JNTA 3B9RA 3M1YA 2WIAA 3SZMA 4F97A 1M0EA 2V65A 1V3TA 1DAOA 3WGHA 4Q1CA 5I7VA 5FHQA 4JR0A 3TI7A 2UU9B 5TE9A 1A71A 3BQMB 1UQUA 4PU0A 1NIJA 4DNPA 2V4MA 3WSTA 4F06A 3A6KA 1MFZA 1R6XA 3PF8A 2A5LA 5LA6B 2HEIA 2Y76A 5HRCA 1N3IA 1WLYA 2G9VA 1MB4A 2XAAA 1T9ZA 3D8NA 3CE9A 3OICA 3FDZB 2VF8A 4R41A 2G88A 3KWJA 5JJBA 3VC3A 1Y1TA 3O7MA 5LMCA 2I76A 3IMKA 3P9IA 4GPD1 3W6OA 1FMLA 1E2DA 2V58A 3FUXA 3RYTC 3SKXA 1ACMA 1R8SA 2QD1A 4W1PA 3V4ZA 4RTRA 1EFVA 3KDAA 4NV0A 3Q9SA 1TLFA 4ZGBA 3KQOA 4F2WA 1KYVA 3D8TA 1KI7A 5FI5A 4BEWA 3I4LA 1EVZA 3K0CA 4M86A 5JT1A 3CVOA 4G97A 4DLKA 2R6DA 3S1AB 1UBFA 3VPCA 4YCLA 1KO5A 1ZW6A 2GVNA 3SNKA 1N2CB 1V4VA 3WISA 1DJOA 2VNHA 2AUTA 1VL8A 4L76A 4DS3A 1ESMA 1XCOA 4OHPA 1GT6A 1X9IA 3IKJA 3OJEA 1AUOA 3DFZA 4C22A 1FFSA 3LW8A 5F33A 3O2NA 3V1LA 4CCAA 1NDUA 2A0YA 4UUBA 4AMUA 5U1PA 1AJEA 4IXMA 2CFIA 3F9RA 1KAOA 2IHJA 3NVAA 3QYAA 4HEJA 4ZO4A 1K9SA 4FBMA 3MTJA 3AJRA 2GBIA 1H5UA 2LCFA 3HFGA 4RY2A 3UH1A 4BUCA 3CURA 2WTUA 2ZU0C 1OGYA 2BEJA 3RRJA 3UJDA 1ZD5A 2HT6A 4HNVA 2RJ3A 4UUMA 2FQQA 2EZTA 3HXQA 2ODNA 2VJDA 4NCXA 4RTQA 3UMJA 4G01B 3SJAA 1XLTA 5DE3A 4JROA 1R6BX 4J4HA 4MWZA 4YECA 4HH0A 4WOBA 5AXAA 4XYEA 5DGHA 1Y4DE 1VCHA 2E5LB 3N1UA 3BQ9A 2GN9A 5FQNA 1JLMA 4ZJZA 4BZPA 4ZDJA 1HEUA 3FNHA 1JEYB 3AJ8A 3EEOA 3ZCQA 2H7XA 3TUZC 1WUYA 5E8RA 4KI7A 4F92B 4CEIB 4NYIQ 1KRXA 4PFKA 1UIRA 5AK3A 3JARB 4F2GA 3LXUX 1EUZA 3PHCA 2EHDA 4IUYA 1OF1A 2XUIA 2JFNA 2ZRBA 5D3QA 4X92A 4C0BA 1E66A 4HTFA 3A9CA 1LDBA 4I3HA 2D0OB 4NYJQ 4IV8A 3G1TA 3V1TC 5L6MB 4FOOA 4Z4FA 2W6ZA 1BFKA 1Z83A 3GFRA 4K03A 5C7IO 1WNFA 4XDYA 1OYWA 3EVFA 1ZMBA 2VHVA 1KPHA 4RPHA 4A4DA 3E8MA 1IHOA 1QF7A 1XROA 5CIYA 1MJNA 1QGZA 2QEQA 1SBQA 4EGAA 3B2NA 4YGXB 1WSDA 1OXKB 1SAYA 4BGIA 5J23A 4JB8A 1U8YA 1Q5PA 5HJ5A 3GLRA 1M72A 4HUJA 4CHGA 1E0DA 1XLVA 3AB8A 3C39A 4P3PA 3VKWA 1UBKS 2P35A 4BFUA 2X0JA 5J2TF 4YX9A 4NG5A 3KLMX 2WIGA 4NZ9A 3HCFA 1L4MA 2ZPAA 3CF6R 4JA2A 2IEIA 1DU4A 2FPIB 3BVPA 3EEYA 3EF0A 3GJ3A 3NDIA 3ZYZA 4EZIA 3F8SA 5JAHA 5CFNA 1U3GA 2QJOA 4NWIA 2EJUA 3KNZA 1DE0A 3LQKA 3SZLA 4DYHA 1ODCA 3BFKA 3K1ZA 3L0CA 3HP7A 2BLNA 4TZTA 3OZVA 2X4LA 3X1YA 5BYKA 4CV2A 1U2QA 1I01A 1L1RA 5JJ5A 1KERA 3IE2A 4TZ0A 1SXJE 3EC1A 4J3NA 3EVBA 4BMXA 2ORVA 1Q7GA 3AL2A 2DFTA 3COYA 2ZRPA 4K3UA 2O7RA 3EF3A 1KDZA 5I8WA 4IIJA 4MGKR 1ESDA 1R0YA 1MABA 1OTYA 2BTQB 2HHJA 4TS1A 1HFWA 4XQ9A 2PZEA 5LBIA 3SXUB 4GC9A 2XE8A 2H1RA 3NHYA 3FFXA 1EFCA 4GX1A 4KVGA 1TEHA 1XR3A 4R2IA 2NV6A 5AHWA 2WAAA 1XELA 5KC8A 3OG9A 1U0OC 4YMIA 2OVFA 1Y8ZA 3ADKA 2F3SA 4IILA 1VKZA 4RV9A 1L3CA 1ETUA 2XIJA 4ZZ0A 3RS4A 1ESEA 1CUDA 2K2QB 1EX7A 1PJSA 3RS0A 2AKEA 3P32A 4G9GA 4BZXA 3A05A 2NU7B 3AR7A 4J94A 4DGSA 3DZJA 2QGFA 3HS3A 1C5KA 2HO4A 1XFDA 2VF2A 2ZTMA 3O2JA 4MW0A 4TMYA 2C31A 3W6UA 1O0BA 1A9QA 1K8ZB 2BBTA 2OGSA 5EXXA 4AWXA 3ZD6A 2SHKA 2EBUA 4YB8A 1E3QA 3UW1A 1Y0BA 2I67A 3QQPA 2H11A 2OGUA 4FZRA 2PH1A 3VVLA 4WOJA 3ZHBA 5HQ3B 4QJ3A 4UAGA 1PS8A 2PGJA 4XGRA 2ZRLA 3VPHA 4TRJA 4OK6A 5DNDA 1IQ0A 2OCBA 3IJEB 3LQ4A 4N3AA 4HS9A 5BSTA 2ZRAA 1RBZA 1RYNA 1LI4A 3P0FA 4Y6GB 4REQB 4ZAZA 2IVZA 2YNMC 1UC9A 1UCFA 3HA5A 5G1PA 3QX9A 4HGQA 4MJXA 1SVLA 2PSEA 2ZWVA 2D0DA 1OKKA 3IQGX 1U7UA 2OCKA 2KWIA 1RLJA 5EHZA 4KQCA 1FNCA 2YHUA 3K5HA 3OM0A 1ISFA 2VHJA 3QXXA 3OOJA 5F64A 4Z4HA 1PZEA 3EVDA 1AHIA 2QL7A 1E20A 3AHFA 2MYNA 4F1JA 1G8JA 3K20A 4X0EA 2K7ZA 1Y6JA 2ZJ6A 3ANYB 3U3RA 2CSXA 1HPLA 4RS3A 4K05A 4XQCA 3SDBA 4DIDA 1IN8A 1HZZA 1QVVA 2CMDA 1PWZA 1DLJA 4CF4A 3C3WA 1CP3A 5LQCA 3PNVA 4HZGA 4HDKB 3R40A 3CKMA 1SOAA 3QXSA 4MS4A 5BN4B 5BWLA 3BEOA 3EPPA 3VR5H 3U62A 2PUGA 3BUSA 4LY3A 2E55A 1NZJA 4IH9A 3IJ5A 1OPRA 2QR5A 4LKRA 2AD5A 3ETEA 2O2DA 5CMLA 5ALHA 2Q3EA 1DG9A 2LVBA 3SN6A 1P2UA 1FQWA 3P9QA 5KINB 3GLHE 2DCUA 4POOA 2FK7A 2X0IA 4NU6A 3ZLVA 3R9KA 1XX6A 1KOJA 1A0OA 1KMHB 1NXWA 3A8TA 4MRSA 4U2KA 4WT7A 3VPDA 4C7OA 1YB1A 3ZX4A 3SP1A 3SS9X 3RW9A 3UJ9A 2JIQA 2EGHA 2Z5LA 3IUBA 2R97A 5B55A 1NXOA 4NXMB 5LBUA 4JP2A 3MD0A 2Z4RA 1N2IA 2FWAA 2R6ZA 4RH1A 5CLHA 4LMRA 2RKBA 4FSDA 4PYLA 4QYIA 1DIRA 1EGAA 2O06A 3GVCA 5D3KA 4M9UA 3VJMA 2NNWB 1JR6A 1YULA 1QO0D 3L3BA 2WWVD 2G5CA 4B3SB 3PLNA 4MVJA 5J2UF 4DV4B 3ABOB 3D2AA 3AKCA 3FB4A 3EBOA 3A6ZA 4H6XA 2ENUA 3K6RA 1VCOA 3T1QA 2NX2A 2I62A 3V33A 3FSEA 3AYZB 1PR9A 3P0RA 5BN5A 1IN1A 1Y81A 4FX2A 5K0BA 4M0LA 1ZJJA 1HF3A 1LZKA 2H2GA 2PGXA 4O4IB 5H81A 4B6FA 2QBYA 4HYQA 3JQ7B 2OENG 4HVLA 5F7XA 1YZQA 4IO0A 4O1IA 1ZCZA 4LJKA 4HAIA 3ONNA 1J9GA 1E3MA 2IDJA 2J3IA 3L7OA 1QTIA 3VNAA 5G4KB 1W4LA 3RRNA 4RZHA 4TTJA 1SUEA 3B60A 2PIAA 5COQA 2QPAA 3UOAB 3EZ2A 3OX2A 3FTCA 5I47A 4W9MC 1PDWA 1KZYC 1ISMA 1CUEA 5EPEA 4ED9A 4JDUA 3SU8A 3Q0EA 1SUFA 1AKRA 1TM2A 3G49A 3ROEA 3BGWA 1G8HA 2QRUA 5I7RA 2VZLA 3BORA 4HK4A 3DE3X 4KPGA 3CRW1 3E1KA 4FSXA 4ROTA 3OETA 1UXJA 2B78A 1WXFA 1OX5A 2P77A 2YFYA 3N28A 4ZCPA 5JCJA 4QBIA 1ECBA 1RYHA 3GUCA 4S2EA 2GJ4A 1Q95A 2O2EA 4M1WA 4OQFA 3SYNA 1LNSA 2QX4A 3QKRB 2HQ1A 5DWVA 4DLTA 4NCHA 1KEVA 2NU9A 4KJZA 1ZO8A 1XVVA 1V1MA 2QJRA 4HS4A 3FTNA 1GKKA 1C9EA 3HA3A 2I3ZA 4A26A 5HKKA 3TO5A 1C1DB 3M1LA 5DHQA 4HEA6 5BURA 5LIPA 4IEIA 1GRNA 4BO4A 1WMEA 2F2TA 4D3XA 5HWSA 3C3KA 2R2AA 2OFPA 2WSBA 4JJ4A 4UDXX 1RHRA 2FPOA 3B6IA 1FP4A 4YJKA 2RHRA 4CM1A 4CNQA 4ZV4A 4Y2HA 1OH7A 4YJDA 1D3AA 1Z47A 2O4UX 4QUIA 3F8WA 1KJ9A 4L57A 6Q21A 2W6CX 1CUJA 2J3JA 3QE4A 4DLZA 4MIEA 5T67A 1MKYA 5CURA 3RIEA 3DKKA 4JLVA 2NYAA 3DE2X 3KSDO 2WKWA 2PCJA 3IKVA 4OI4A 4WZ6A 3ZE6A 4F45A 1P2FA 4ZDIA 2QM3A 2QAGB 4V38A 3UV6A 1KPGA 2O7NA 4MX8A 4XIJA 1CC1S 1I9CA 3EXG2 1P31A 3GFSA 1BD4A 1PJBA 3IAS1 3JVIA 3NKFA 4P58A 5KOJB 1O9GA 3ORQA 1X38A 3JYOA 4E0BA 3PUYA 1CT9A 4YO8A 5ARBA 1F06A 3BD6A 1YACA 5FORA 3KG2A 4EUSA 4RFVA 2FA9A 3NZEA 4ARSA 4DA8A 5JMTA 5JWHA 3T7AA 4FIDA 5L3SA 3OZWA 4MEBA 3E7PA 4LTMA 1Q1QA 1V2HE 5A4JA 221PA 2EW1A 3I5XA 1VBNA 5CT8A 1A96A 1NVVR 3CVJA 4FOSA 4HAOA 3LIPA 2HLHA 2ZSJA 2BFPA 3HKEA 5ECDA 1V7QA 3ONFA 4JJGA 2ZYHA 4UEKA 3T34A 2Q07A 3WA7A 3GCGA 4Q4JA 2FPLA 4E32A 4OEHA 4B9EA 3GLIA 2ORYA 5J40A 4RD1A 5EKUA 3PJRA 1UK6A 2OHXA 1M8JA 3HXPA 2PANA 3OT1A 3ESRA 5T6BA 1PO7A 1SUBA 3FUTA 2QMHA 3GGPA 2ERXA 2YW2A 3AXSA 4C01A 2HZ7A 1M10A 5HE9A 2BP7B 2BPOA 2IYRA 2ONJA 1EPUA 2QL6A 2Y1OA 3HUFA 3HO8A 3NKLA 1MR3F 1JH8A 4ZU6X 3SJUA 2MWMA 1TKCA 2A57A 1D04A 2ZCUA 3FZGA 1E5QA 2V7GA 4KQXA 4QXOA 4UNQA 2ON6A 3DAPA 1J7JA 3MLAA 4GM0A 4CEHA 3ONEA 4J0HA 4F8YA 5FLYA 3LGAA 4DV3B 1M0WA 1KY3A 1A8SA 3HWSA 4FWBA 1UJ2A 4A10A 1OHHD 4MWCA 1YJ5A 2CHUA 1X80B 3QXHA 3ER9A 2H2DA 2ZUTA 3U6BA 1Y1QA 2HSJA 2IF0A 5DYWA 1W48A 4RPLA 5C3MA 5KVVA 1V96A 2DKNA 2PN1A 2W4QA 1U2TA 2H2AA 3JRXA 4HQ0A 4KO1S 4TKUB 1IDN1 2Q4EA 1IC6A 1B8VA 4W6ZA 4WI1A 4WKCA 5D01A 3TTVA 3ORFA 2FX3A 3R44A 2OCLA 4JLBA 4GI5A 4KDFA 1FXUA 1GZVA 4JASB 4ARBA 4LE1A 4G65A 1HETA 2W6ID 3EG9A 5FFNA 5IARA 4ZJUA 3EEFA 4EW1A 1KJQA 4KOAA 1G21B 4DUZB 3K5IA 3DQQA 3ZWPA 3V7FA 2G28A 2FB9A 1PS0A 4PQYA 1W4BA 3CU5A 3OM1A 4EHIA 5JANA 1QIGA 5CX1A 3TLGA 1XJWA 4RD2A 3L9XA 3I23A 3PS9A 1KNQA 4QC2A 5CXSA 3SSNA 4BO0A 4C4PA 4JUFA 4ZHQA 4R0MA 1UADA 4LG1A 4M83A 1TUIA 2YVQA 3UPDA 4OHKA 4I7EA 1G60A 4B2PA 2H9YA 2VS1A 2IYSA 1Z3IX 1QYRA 1QG6A 1HUQA 4LYEA 4MTCA 2CBGA 2XB8A 4ROSA 5HF5A 1H4VB 1BWPA 1T1EA 4FEEA 5AVRA 2AOUB 4J91A 5J9FA 1OWNA 2VBCA 2F7SA 4A8HA 5AW7A 4EPVA 1O95C 3ESQA 3HU5A 1Z39A 3FBWA 1ZUWA 2FLWA 2BGGA 1TYDE 1UOOA 3OURA 3R4VA 5I7FA 1VJ0A 3DULA 3LZ6A 4NH0A 3CRQA 1W36C 1MAUA 3TMYA 2R0QC 5CHYA 5DWDA 2FSVA 3ZGVA 1CUXA 2CDRA 1VSVA 3D6MA 3IO3A 3K0SA 4JBXA 1JEEA 3OIGA 2VLBA 2F59A 3DOEA 1Y7TA 4EF5A 1U5BB 3NASA 3FIJA 2C3UA 2PSHA 4QFBA 3P20A 4XIIA 1NWCA 5F3DA 2DY1A 4RW0A 4MKHA 1OPXA 1LSUA 2GAJA 2B5WA 2A4MA 1VQ1A 1FFGA 1XF9A 3LCVB 3LNTA 2BHSA 4R3NA 1AS3A 1K3FA 3EYWA 3RUDA 4KI0A 4QVGA 1R6DA 3OESA 3ZWAA 2DWCA 3QPWA 4YRZA 1KJ8A 4LOLA 1W0KD 5EZSA 1OWOA 3RIHA 5K0CA 4D8XA 3IB3A 5AW1A 3NTRA 1OTXA 2D7JA 5ALMA 4UAJA 3PUWA 4HNSA 5ECWA 2PZGA 4YRGA 1RVDA 3QKTA 3DB2A 2MOKA 5K0LA 5KNCD 3OTIA 1HLGA 2WF9A 4M8SA 2FZCA 4YAFA 3T7JA 3OKFA 4BASA 5KI6A 1WAMA 2C5LA 2FEMA 3EXFA 1WXHA 1YBAA 4LDZA 4N7JA 5EP3A 5EWLA 4RJIA 3S3TA 1DC3A 2PZLA 2FUNB 2QU8A 5FYQA 3V9PA 4D82A 3QE9Y 3LIIA 3QJGA 5ENZA 2X8JB 4LXGA 4XUGB 5F77A 1AU9A 4P84A 1JFVA 2I2AA 1NT4A 1QX4A 2ZSAA 1AQLA 2JFOA 4H4DA 2GPWA 1UAAA 2FWJA 3DKVA 3F3SA 3UHFA 6YASA 2ZRGA 3OT4A 4U3JB 3KAPA 2NU6B 4OYYA 5DHSA 5FJJA 3QENA 3ASYA 2GPNA 4IIDA 1K7XB 1MXFA 2R85A 3KXIA 3ZNPA 1X9GA 1IHXA 4DV5B 5DXAA 1OXVA 1QGUB 2CEKA 4ZVUA 1WJGA 4FGLA 4PC7A 4DSNA 1MOQA 2PVPA 3UAXA 3LT1A 4L0DA 1SVMA 3G85A 3EH1A 1Y9EA 5I8PA 5IG2A 4YUYA 5GONF 3DTNA 4JC5A 3AFHA 3T7TA 4TWIA 3UXEA 1UZAA 1QE5A 2PCLA 4ERNA 2YBDA 1N2BA 2IV3A 1IOVA 1DX4A 3FR7A 4U7DA 2C61A 2H2IA 4K9QA 3P2MA 5CIWA 4HLUA 3ZQ4A 1J70A 4OKIA 5KYGA 2Q3FA 1CUIA 4L6IA 4A2CA 3I0ZA 5CEJA 2EV9A 2WJWA 3F46A 4RA6B 1CVLA 4BNXA 1SEVA 3G5AA 1GDHA 4ND5A 2X41A 1OGIA 1U0EA 1L8AA 2GA9A 1H2FA 4LQCA 4QAJA 3LRPA 3ZWDA 3AEKB 2IYOA 2RJOA 3G5MA 5DHAA 2R1VB 3TM4A 3WR5A 3L9WA 2M32A 3EZ9A 3L8DA 4B6PA 2NTNA 4NCAA 1O8CA 3N0RA 2X6TA 3CIFA 3PV0A 1PR5A 2QN3A 4LI0A 3W8FA 4V02A 1G7CA 4EAQA 2X9QA 3JVDA 3U19A 4MDEA 4LXIA 1YZYA 4QNNA 1YZVA 3W05A 3KQSA 5DJ5A 5DMHA 1CUHA 2ZP1A 1WPQA 4BOYA 3UFXB 5E1OA 5H4HA 1KI1A 4LYYA 3AR6A 3KJIA 3DZBA 2BM1A 4JJKA 2OY0A 1I0IA 4DABA 2AVDA 2HXGA 3KZNA 3PEYA 2BWJA 5DP2A 4BNNA 3QXCA 2YVUA 1YK1A 2PXCA 3AFIA 3AIOA 3M9LA 2ACKA 4YCCA 3G1WA 3PGXA 3ZVLA 4BFXA 1MJ5A 1VHWA 2J8ZA 4KQMA 1W8IA 3IQEA 4GL4A 1XZDA 1IG0A 2ZRHA 4J43A 2P6MA 2Q4TA 3AHCA 3LFTA 5KYXA 1J09A 5JCZA 4GKKB 1AT1A 4JC4A 1SWWA 1AZWA 2I99A 5K3OA 2NO1A 2IA5A 3MAAC 3UA4A 2GFIA 2VQSA 4B2YA 2HQOA 3CG0A 2QRJA 2CF5A 1KK3A 3H83A 2ECKA 1Z8NA 4DAOA 5EXDA 2D5BA 3AL3A 4OLJA 1KJNA 3PHBE 3O26A 1FSPA 3THWB 2WHPA 2WYWA 3JAKB 4POAA 2DHCA 5FBHA 5BWBA 4XWYA 3ZKWB 2O07A 3MYRA 2P0YA 1CZUA 4FYPA 4J03A 1PQPA 2Y1DA 4OQ4A 3WRXA 4Y2VA 4YNBA 4BVAA 5AVYA 1SXIA 2UUAB 3C3JA 4L9SA 4RHXA 3DC7A 1QYIA 1E3TA 2P2LA 3FYUB 4GZMA 1ULAA 2JEOA 3TLKA 3V1MA 5EOVA 1DSSG 4EUFA 1QHHB 3WGYA 3H3JA 1B6TA 4EENA 1KDOA 3UJNA 3Q8MA 4RTLA 3MJVA 4KMSA 4AJLA 1NJFA 3CQ9A 4V0KA 4MWOA 4EHNA 4PO1A 4P3OA 4N41A 3D3NA 4AJPA 4D3SA 1H8HD 3THYA 1NMEA 3GPBA 4A0HA 1WXWA 2Q3MA 2C1ZA 1T5SA 4TSFD 5AR1A 1IRXA 4ZYLA 5BWNA 5FUMA 2ZTVA 2MSWA 4YUZA 2IS6A 3SR3A 4TT3D 5DTQA 1MA3A 5G41A 3ET5A 4RV4A 3KXPA 3NVKI 2YINC 4HRXA 4OUKX 1ZXLA 2VHEA 4MAFA 4UEJA 4DJFC 3KK0A 3VZCA 2RHWA 4C30A 5B7QA 4QTYA 1I3KA 2A4KA 2PKRA 3M8KA 3GCXA 4JX9A 4RA9A 1ECGA 2W7TA 2YWJA 4FYWA 3KKNA 3G0HA 3MPUA 3UYLA 3WL8A 4UASA 3KBBA 4UHFA 2VYNA 4PM4A 2NUTB 4MLZA 2X2OA 5EQJB 3KAJA 2D1QA 4CYMA 3LY7A 2WC1A 1VRWA 4G36A 3GYGA 1P33A 3U17A 1G20B 3P97A 4L8FA 3A27A 4YQFA 2P9JA 3KCNA 1V6SA 2H1WA 5GINE 2HXYA 3D54D 2IGBA 3I8OA 3TL2A 1A27A 2IELA 2OZPA 3FWPA 1W30A 4RVCA 4YPFA 1SCNE 2QZPA 1JJIA 3L04A 3KOXA 1YJBA 3N2EA 3ISJA 3VHXA 2OZLB 2IOFA 4MRMA 4ZI5A 5F23A 3M3PA 1U3TA 4II2A 2XT9A 5HZKA 8MHTA 1Q83A 1TJ5A 2Q5HA 2XPCA 4O3FA 2ZATA 3RKSA 2B6HA 4R8VA 2CXXA 4AAYA 5BQFA 1CSEE 5LB4A 3QVWA 4IFEA 3AUTA 3DLHA 3BSYA 2OECA 1Z0UA 3KTAB 3LBHA 1ETHA 2PMKA 3GA5A 4G0NA 5CP8A 3G13A 1PFWA 1T24A 2VYQA 4XX0B 1O5IA 5KWEA 4FLFA 4H6PA 1UM9B 4JI2B 3CF0A 4GVLA 3K3PA 4K0KB 1DBQA 2HU5A 4U1RA 3EWSA 4HCJA 3LY9A 1KK1A 2RSLA 4ZVMA 2FEXA 5C8ZA 3GGSA 4II7A 4OQYA 3LYAA 4OAPA 5HRUA 2A1UB 3LWNA 3N0WA 1XZKA 1V5IA 3ANLA 2WPDA 3H97A 4RIFA 3V4OA 2QMEA 1QGED 2FZKA 1HKHA 1JBQA 3RS9A 4W1QA 1U2DA 1U5AA 2RONA 1B2LA 4FFRA 4O8ZA 2V1UA 2XADA 1UJ4A 1UM8A 1Y5MA 5J1TB 4C2UA 4WBSA 5EMJA 3TJMA 1GSAA 5E6UA 1BGWA 5DGXA 1ADYA 4KXWA 3M34A 5L7WA 2G76A 1V3QE 2XUHA 3GLVA 1E1RD 4FFDA 3DOOA 3AOEA 4ZPJA 1LEHA 3KLBA 4KUHA 3TZQA 4AMBA 1ZUNA 3FY4A 4YCSA 4CKXA 4ZK6A 1GZUA 1KI9A 1LTQA 2PO7A 4MYUA 1NV8A 1HE4A 3RSHA 1NUSA 4LJSA 1U3WA 1ZCFA 4OFZA 5D6OA 3P26A 3BZWA 2C3MA 3W4JA 2O8VA 3WNQA 5M34A 4CM4A 1BQ3A 1ZXXA 1PGPA 3SHVA 3R4CA 4D9HA 2AJCA 2QDKA 3VHQA 2EG9A 3TOVA 5GZ3A 1T9DA 3O1HB 2D06A 1IVYA 2FNAA 2N75A 3ROGA 3VKFA 4EJ6A 5JS1A 3UF0A 4DOMA 3CLTD 3G8AA 3AFOA 5KOJA 3LO5A 1MZVA 1S4QA 2XT0A 4I4LA 3PNYA 4XM2A 2BISA 1N92A 3JASA 4QHYA 3RYFA 4UVDA 3OO1A 1TAUA 4MULA 3TM5A 5F7OA 1JSLA 4KGXA 4Q21A 3IA7A 3R5FA 1XKQA 2FSPA 1Y7LA 1GPNA 1X7WA 2GEKA 2JH3A 5E95A 3IE0A 5HDQA 4DCPA 3X1XA 5FI3A 2XRZA 1IUOA 4ZOAA 4WY8A 2AW5A 3SJZA 3BGDA 4XPIB 3MSXA 2ZSDA 3FPAA 3IL2A 5JYCA 1GQQA 4FBLA 1S8OA 4MI9A 4QRDA 2YZKA 4PY2A 2IFTA 1TDJA 5BT9A 3NBFA 2B6NA 4YJHA 1LPMA 4FDUA 3JRNA 4QO7A 3I28A 3GPLA 2JJ2D 2OHFA 1YMQA 3KSRA 3D4PA 4DM4A 2ZRJA 1YVDA 1NW4A 1U2DC 2B83A 2QORA 3LBFA 3BMNB 7AT1A 4NATA 5CYPA 4ZQGA 3AP2A 4INPA 3EB9A 4D9KA 3MTQA 2GYUA 2X7XA 3B6MA 2IODA 3EFEA 4UMFA 1LB1B 1K7SN 4GVXA 3C43A 4GR5A 3W79A 1OXSC 5AJXA 4ZO8A 4D99A 1EFRA 3A3PA 1AZLA 2QW1A 2VYCA 2O2ZA 2WJIA 3IR6A 3PQDA 1EZ1A 3FFBA 5IJZA 5K7SA 6ADHA 1Y6FA 1TVEA 5DI9A 5DPMA 5IKPA 2PD3A 4BUZA 2VHUA 3S1LA 5TPWB 2OD7A 1FTNA 3KOYA 4IBOA 5IDYA 4LCJA 2PKYX 4ZYUA 1ZK0A 3AV0B 1PHRA 1DRKA 2C8LA 2YFHA 3AHDA 3I04A 3CEHA 3UMBA 1BWRA 4HGOA 5FR2A 2MINA 3WLLA 5A9SA 1P4JA 1CJVC 1T0JB 3MMNA 4CFZA 1QV9A 4DPKA 1KEWA 1PUIA 1XKXA 2W9XA 4B3TB 1LLDA 1P1FA 2E4WA 3S8EA 3G17A 1J0DA 2Z5GA 4HAWA 1A88A 2ZR7A 5F4ZA 4B71A 3PP8A 4H1HA 3ME5A 3C48A 3Q7PA 4LXYA 2Z08A 1R4NA 4GPIB 5BPFA 1N3YA 3F71A 1T4CB 3P7MA 5CFQA 4PZPA 5K9ZA 3DO6A 3NC1C 4ND1A 1IXYA 1U8TA 3C24A 3AEUA 2C4MA 2VIIA 1CR0A 4GPTA 3UH0A 2NVOA 2R9VA 3QVSA 2NQTA 1X1EA 3P2EA 3TDKA 3TINA 1ZSNA 3U9LA 2EX1A 4G86A 4BMCA 5JW6A 2GQ0A 1RWVA 2J0UA 3DTYA 5A0VA 1G2IA 2CVQA 4XUEA 2I2WA 5JHGB 3GLHB 5BSRA 2R8OA 3MGAA 1ADJA 4EJ2A 2XYQA 4MV5A 4WXHA 5DNUA 5AJHA 1YKSA 4H1WA 1QAQA 1PJ2A 3FM9A 1Z2PX 3QPBA 4QXMA 4CKCB 1QQ7A 4O02B 5IH7A 5EHNA 4MEJA 2BP7A 3GJZA 4ANFA 1VE3A 3TW4A 1ZD3A 2C88A 2JZCA 2M1ZA 3HB5X 1YZFA 4P3XA 3U5ZB 2PT5A 2EFCB 4E5SA 1L7DA 5G4LA 1T9AA 3RC1A 4CM6A 1XMPA 4YXWA 5C8XA 4JWTA 2OORC 5HPYB 2LNDA 4UOQA 1Q1AA 3E22B 1LDMA 1UXGA 3FOZA 3EQ6A 3I1IA 3VH1A 4D42A 3BXGA 1PGQA 5LFAA 1DGQA 1R3UA 3P19A 1YVUA 1WPRA 1M74A 2OPHA 5A62A 1WKBA 1ZMOA 1PVVA 3PWZA 1M8KA 3FRIA 3K1AA 1G9SA 4HC4A 3ECCA 2O20A 3W9BA 3IGFA 3ZW9A 1HDXA 4UJ3A 4HDAA 1P2BA 3VKGA 4OQMA 3FCOA 1ZY2A 5BNWA 1I7NA 1FCJA 4J49A 1JJFA 4BNMA 3AYXB 1P5RA 2Y9MB 5FD8A 4IF4A 2GHQA 4ETNA 1ZH0A 3B78A 4HXYA 1QZXA 2JAPA 4IZOA 4UCFA 4G63A 1H4TA 1JXAA 2Z3ZA 4BNDA 2G04A 3BXHA 4FGJA 3SF8B 4RD4A 4C20A 4DLRA 1C9NA 3GPIA 3UENA 3FPJA 1CY1A 2IPXA 1LZLA 5HZMA 4ER7A 4GM4A 4AY4A 3W5VA 3BL6A 4EA7A 3EQ8A 3CTPA 4BN0A 2K5UA 5EMLA 1EQ2A 4B8YA 4ENQA 4QIHA 5D86A 1CR4A 3IQIX 4PF1A 3IV6A 2QRVB 4Q4HB 3S99A 4I08A 1I4LD 1ECCA 3DO8A 4FNAA 4F4JA 1NXQA 2IL1A 4NG4A 4LCEA 1LQTA 2G0TA 5HUHA 2UUCB 3CNOA 5KVQA 3KKMA 4MVJP 2J46A 2XQJA 5F5LA 1OFUX 4ZT6A 3RASA 5JCJD 3H5WA 3KM0A 3FE2A 1GLVA 4DSTA 3DV0A 2J0UB 2AK2A 4Q1DA 2UDPA 3Q8WA 2G4VA 4B73A 4M88A 4YHBA 3SQLA 1LRJA 4P86A 1E7MA 1TX4B 1QS0A 1TCUA 2RHTA 1OH6A 5JJKA 5FTWA 5KX5A 1G9TA 5A4IS 3S8MA 3T41A 3GMSA 1Q7RA 4MW1A 5GM2A 2I9KA 2VYFA 4ZQEA 4AJHA 2YIDA 3UT0A 4DA6A 1ZOSA 2O6LA 3GI1A 3N2KA 4M7OA 1HDEA 5EJMA 4EFMA 5A5FA 1AMNA 1KP9A 3WAJA 3BL5A 1P19A 5E3JA 4O6VA 1N0VC 3UKJA 3EWAA 3IHTA 5DO9A 2J87A 3AOEC 3HA7A 1XNQB 1QP8A 3W7VA 4DRXA 3AV3A 3R74A 5EJ2A 3GWZA 4U00A 4LQDA 3R3JA 3CN9A 3I6ZA 1DDIA 1U94A 1OXTA 3IAXA 4PSCA 1M2KA 4M38A 1E4YA 3F7MA 4XB2A 3RVKA 1EGQA 1UZUA 2VF4X 1RC8A 4NSNA 2V0GA 4ILEA 2NUAA 3UWKA 2ECPA 4FS8A 5DM4A 3C6QA 1KE2A 4F4UA 7GPBA 2XF2A 1L1EA 2PSSA 2H52A 3TVDA 4E7OA 4EFKA 5FOVA 1GGJA 2DUUA 2XOXA 4EWLA 4YAEA 3GF4A 2PRJA 2NV2B 1XTZA 5BQPA 5JXWA 3QFSA 4FFBB 2I2DA 1DQSA 2MSNA 3DT9A 3OFNA 4Y2SA 1CB0A 3BS4A 3OQIA 3RNOA 4WFKA 2WAYA 3MIZA 5I3CA 4YMGA 4RCYA 2G5PA 3U7QA 1X42A 3NALA 1JLRA 4KE9A 3L7YA 3HFRA 4TXLA 1L5HA 5HQ3A 1JN0A 1I4WA 2PRSA 1GPAA 1E1DA 1R5BA 4IR7A 2I7TA 3VZDA 5KBYA 1PK9A 1TFUA 4MI1A 4ECEA 1K8XB 1J6UA 3L84A 4KC0A 2PKEA 3ZWBA 2PX6A 1DIOB 4AX8A 1PV2A 1YR3A 2KLHA 5SYNA 1JG4A 2Y4OA 3LSYA 1QGUA 2PA3A 3N86A 5J58A 3QEBZ 4UFPA 4E5UA 1VL5A 1BCSB 4M1SA 4OHVA 2QMZA 4DZTA 1AQUA 2CLOB 2FTKE 5HR5A 3W3AD 1XRRA 4FFVA 4MS4B 3ML1A 1RW4A 1VBMA 5EERA 2C54A 5EJEA 3OY2A 3K9QO 1ECFA 1W6UA 2IUSA 1W29A 3C6KA 1ZM9A 3QFTA 3I8SA 4QLAA 1RQ7A 1VPWA 3SOPA 4WESA 3X2SA 2HWUA 1QFMA 2GZ2A 3V4PB 3CH5A 2X8JA 2ILVA 4IZ6A 2VJKA 4ZO7A 1QHFA 3AFNA 1DAFA 3P9CA 5E6SA 2UYYA 3IUQA 2WMNB 4K9KA 2Y4NA 2GRJA 5H70A 1AZSC 1QH0A 3MFQA 4Q9DA 1BX1A 4KO3S 5HIJA 7MDHA 1M1YA 3LG2A 3FNBA 3MJFA 5BYBA 4FUTA 2P0AA 1J56A 1EWQA 3EF1A 1ABBA 3NT2A 2VSXA 3DXFA 1P5FA 5JY6A 2CVPA 3W5AA 4IO1A 4WV3A 2CDNA 2PE5A 3DXZA 5IULC 2G36A 3C3BA 4GBMA 4XVQA 5KSPA 4P0TA 1EBBA 4TSKA 3AR4A 3TLBA 2QNRA 4GP9A 4Y30A 2WSMA 3RAJA 4DXHA 2P3QA 4I1YA 5D5PA 3LPNA 1YS2X 2AI2A 4I9GA 2WZDA 1TF5A 4U5QA 4CKCA 3MOSA 4BMSA 1DBRA 1FMJA 1S7GA 2HV8A 2XB2A 1Z5ZA 4IX9A 5I9BA 4Z2YA 1UFOA 2YY6A 2PWPA 3ETDA 4JBHA 2O57A 2C9BA 4K0RA 3BFXA 3AIKA 3GJ4A 1BE0A 3PXBA 1OX4A 2A0WA 3D3KA 4NPCA 4PZ9A 4DLVA 5HF9A 4C7KA 1OJLA 3CZAA 4LYFA 5GJVC 3UJCA 4PPNA 4UBLA 2XYGA 1JXQA 3A36A 5BN4A 1H42A 2GETA 4XJXA 5A9RA 3ONVA 2RHHA 3KWMA 2R7KA 3SEFA 4FN4A 4JI4B 4S1TA 5E8JA 4ZI7B 5HE8A 3THXA 2LP4Y 4I8DA 2ZRMA 1L4FA 4DSZA 3ZX5A 3IX7A 1E32A 3W78A 3HB1A 4OB7A 1VJCA 1W2GA 1I7DA 1GWNA 1PX2A 3GNSA 4YALA 3PVZA 2J67A 3BB4A 1P1RA 3CO5A 3G0CA 5E6RB 3TNFA 1NVWQ 3KYCA 3NHBA 4Z49A 1IOZA 1P9OA 3FOFC 4FGKA 4A16A 2XNSA 3TL3A 2PGIA 2GBLC 2R1ZA 3D2CA 3IP7A 3SQXA 1EP9A 1VMIA 3OJCA 4M3NA 3R5SA 3L8GA 4Q6BA 3ZLBA 5BORA 3SG0A 2P9FA 1QDUA 4B6SA 4IQFA 1O6CA 1X1SA 2W6OA 1VHTA 3MXOA 1U4OA 4HX2A 2BGJA 2QMUA 4LXTA 4AT1A 3UIEA 4RD6A 5EIXA 3LDHA 1RBMA 1IM2A 1L5ZA 1U8CB 4WWHA 1BKYA 3ZTWA 1R0SA 3N6VA 1X0VA 4B6EA 1VB5A 3WAGA 2Z56A 3E9MA 3RCBA 1SUAA 1UKZA 1LPAB 3HCNA 4TXJA 5GQSA 4I55A 3N39C 4NZOA 1GPBA 4DVGA 3KOUA 2GJAA 1ZFNA 4RBNA 2Q5OA 4NENA 4ZPXA 2A78A 2NXCA 3R9XA 5K0NA 1WW3A 5I45A 5KMGA 2H7YA 3AMVA 3GD7A 3LC2O 3RUIA 5BQ3A 2J48A 3OLQA 3REQB 1LVHA 1V26A 3FOCA 5CA1B 5T4EA 4WH0A 5IBQA 3HCBA 3M6LA 4CDGA 2WAXA 5HIIA 2Q6LA 1QVRA 3SHTA 4OIFA 4OI1A 2D7DA 4FYMA 3D0OA 4LBYA 3CC8A 4OHMA 3MHPA 3UYKA 1U63A 5JNWA 2NZ2A 4XDZA 4XPIA 2OV1A 4H7PA 2ZUBA 5BVHB 1FDVA 5JLAA 4B85A 4UM9B 2VAPA 3E9CA 2OUIA 3PDWA 4GMGA 3YASA 3HWRA 4XSVA 2KSQA 3NHLA 4HLDA 5D87A 4MVJF 5J2UA 1JJAA 1CVIA 4R31A 1WBDA 2F1IA 1U7DA 1I2DA 4L16A 2QVGA 1GL3A 3TVTA 1XT6A 4Z4QA 4EUNA 4TWBA 5AESA 1JMKC 4RWEA 5I5GA 1FRZA 1E64A 4FW9A 2GBLA 4XM0A 2AQ8A 1M6YA 1Z7GA 4K88A 1NJGA 1U1IA 1DCMA 1ZS9A 2OVBA 2O0JA 1TZMA 1YV9A 4FKBA 4PYJA 1QFSA 5IVIA 4D1YA 3PXGA 4R8RA 3EXEB 5I9IA 5JADA 3PX7A 1FFAA 3V00A 2B4KA 4RHYA 2V55B 1VLVA 4DCCA 3SZ3A 4JGGA 2G7ZA 4B40A 2YH2A 3JD2A 4DR7B 1Q0UA 1VFNA 1CS0A 2NSLA 4Q12A 4DCUA 2ORED 1FRFS 2ETVA 5KPJA 1TU3A 3M81A 1THZA 3FVWA 3AJAA 1OBCA 1D4FA 1KJZA 3SPXA 2QUJA 4G5HA 2OXEA 3ELDA 3K2BA 2EP5A 3W9SA 1EFPA 4MV0A 1WZNA 2VRCA 3I4CA 5IP5A 1MRSA 1TZKA 2FUKA 3PSHA 3CEPB 4M0UA 5JO0A 5K99A 3IUJA 5FRDA 3T7IA 2O8DA 1AF4A 3F49S 4FGZA 1GU0A 1DOHA 5KQMA 2I4LA 2Y92A 1RE1A 1BQ4A 2F6RA 1FNMA 4J0GA 4BRZA 5TC4A 3BFVA 4IF6A 4YJ2A 3B6JA 4A2QA 2G72A 2F1KA 4LV5B 1GGKA 1D7AA 2CHQA 1QCYA 3CISA 4LE0A 2GVDC 1T0HB 3AR2A 1Y33E 4UBJA 1EGHA 3ON5A 1N5LA 4OMUA 1NNUA 3IH5A 3NM5A 2GZSA 3MWEA 4AMVA 1AXEA 1VHDA 3TKLA 1LPBB 2O8EB 3W2GA 1I0LA 1BYIA 4UNIA 5EYPA 4Y7DA 4HRVA 1PFVA 4KW7A 1SK8A 4AF6A 1Y9JA 4LWPA 1DCTA 1IHPA 4CN9A 4TRRA 5ICSA 5K6AC 1XTVA 4YHHB 1JKFA 5KQPA 4K2HA 3RABA 4DJDC 4RMHA 1XKTA 2VYND 4JGBA 4AP6A 1H4SA 1CDZA 4X8OA 4IIVA 2EGUA 3EIXA 1FP1D 2OKGA 4NZMA 5D3MB 3RC8A 4IIYA 1UMBA 3OOEA 1YRLA 5IW8A 1NQOA 4XQEA 1XXHB 5K5EA 3QOFA 4H0NA 3A2LA 2OYRA 1QAOA 3VTZA 5D84A 1NMQA 4IV0A 4HXFB 5CX4A 1EA7A 3N7UA 3HKBA 5TGZA 5F98A 1CY2A 1AUPA 1M6VB 3ZWMA 5IJXA 2VQ6A 4Y0VA 1SXJB 3TK1A 1K8YB 4KYIB 4NARA 4NOJA 4NPHA 4QD3A 5EAIA 3LPLA 4Y6PA 4B46A 1OBFO 4ALJA 4CIAA 4KP7A 4B87A 1E2KA 2VLIA 1YR2A 3NHZA 3K0KA 5HYVA 4G0VA 2J9FA 4G0UA 4P82A 3A9UA 2VK2A 2DHQA 1EHIA 2WKPA 5I9NA 4DUGA 4FM9A 4DCNA 2OKCA 5ALDA 5LWQA 3K70D 4QM6A 2B7LA 1CQPA 2CB0A 4BKMA 3OQOA 2X2EA 2UVQA 2ACVA 3EC7A 3P9RA 1XTQA 1WXQA 2IYUA 1EXMA 2H9AA 3TZLA 1CDDA 1F3LA 1ULHA 1PQ4A 2MJLA 1C2YA 5JNRA 4IQ8A 1GPJA 1ZMXA 4J4BA 5JC1A 1NE7A 2HNAA 1PDVA 5B7GA 2YY5A 5K8TA 2WUGA 1CEQA 5EPOA 3NUQA 5AI8A 2XMRA 3DTVD 3NG1A 3B1VA 1B4DA 3EAGA 4J0QA 4MR9B 5GZ6A 5LB2A 1MJHA 4HRAA 1XEXB 4PYRA 3W5CA 2YJ3A 2HSDA 3G2QA 3NTLA 3TWOA 4S04A 2P3LA 4GE3A 2H6EA 2WIDA 3AX6A 3D3JA 4FFLA 2QW0X 3FIUA 1U3DA 4JYAB 3RODA 1EB8A 3CBQA 4HDCA 5HW0A 4HDKA 4ECAA 1SXPA 4M0MA 1EFDN 2N9UA 4RJ2A 4EHJA 3H2JA 5SYMA 2WTXA 3BSWA 2O0LA 4LV6A 3E9EA 2PWZA 3ZOZA 1CG6A 2GNPA 1C3XA 5CB8A 3K9FC 2CXPA 2C59A 4YMHA 1IHUA 1OAOC 2IYVA 3JSXA 1LX7A 2QKYA 1LDNA 4QA9A 1CZNA 1A9SA 1X87A 2X3YA 4PXAA 2JHCA 1J07A 2VFAA 2PJDA 3F9CA 3BXFA 3HWWA 4L4SA 4BWFB 4F2HA 1X1CA 3HG7A 3ZTYA 5AVXA 2WTMA 4YRPA 3BIJA 3QY9A 2XLCA 1IK4A 2JH9A 4QSHA 3MOGA 5E2BA 4B4UA 5LZ8A 4RZQA 4YJGB 1M6WA 4GMFA 2O5CA 1U2PA 3IEXA 3D2BA 1EVKA 1X8KA 1XLUA 2QM0A 2V6IA 4C0AC 3FZNA 3C4VA 2O8NA 4Q4JB 1V3UA 2OT3B 2X23A 3O82A 1DKPA 3UG7A 2PU5A 1RQLA 3PZRA 3QVTA 4U7TB 4WZAE 1Y8QB 1R8JA 1CQIA 4FYXA 4CLHA 3F6SA 1KXJA 2I6QA 2H3EA 2PWYA 3SX2A 3JQ9A 1S2IA 2X5NA 1KP3A 3FCCA 3VOAA 4BLPA 3GZ4A 4UHBA 1XRSB 4GI3A 4Z1MA 3PIDA 4J0CA 4E15A 1AZTA 3TZCA 4AF7A 1CV2A 3Q3VA 4Q3AA 3O0DA 4DRYA 4W5RA 5ALOA 1MG0A 5F9MA 4J2HA 1IZ9A 1J06A 3BREA 3RSSA 1E9RA 5B2FA 1T6YA 1T8YA 2C7OA 5AOBA 1JHZA 3DMDA 1BGXT 5IUNC 1H0RA 3ZLTA 2MR5A 1AG9A 3TQHA 4P4GA 2X9GA 2C9ZA 4CF3A 1XZMA 1V7ZA 4CF6A 5IDQA 2Q1SA 1Z45A 3H2IA 1MD9A 3OUZA 4CKEB 3SKVA 3A0UA 1JI0A 1WOYA 1CULC 4BDSA 4ZYYA 3DKIA 4TQUS 2BF7A 2IY7A 2DULA 2QRZA 3GX1A 2H31A 4JOQA 1O2DA 3PT9A 1DX6A 3ZXUB 1BHO1 1Q0QA 4MUEA 1DZIA 1ZWKA 1HL7A 3PDHA 3M6FA 1ZQ1A 3EGIA 1K8RA 1XMQB 1JBEA 2QMQA 4AQYB 1ESZA 4KQ6A 1KKUA 3HVIA 4JYZA 4M55A 3AKZA 1OYOA 1JAIA 2PKQO 3ES9A 2HMWA 2VEOA 1N32B 4QDXA 3VNRA 3EWNA 2OV3A 2XWQA 4HOYA 2G80A 1BXGA 3OQJA 4G07A 4NMMA 3LX6A 4QUGA 5GV7A 4E5KA 2WF7A 2QAJA 3MTEA 2OQVA 5AT1A 3PEUA 3KRTA 2GYYA 3LUPA 3FXAA 1FFDA 4DLAA 4G2TA 1E9DA 2P3SA 4JI8B 4KRGA 2QUIA 5DX1A 5EWMB 3G0DA 2XRMA 3DEKA 1GDDA 4CDMA 5EEHA 4NI5A 3A4IA 4IDNA 2IBTA 1QH1A 3DE6X 3MWDA 4F86A 4TKZA 2FHPA 3VC1A 2OL4A 2W2KB 3DFIA 4AZ3B 5A4FS 5AVZA 5I01A 3VMFA 1GGHA 3ETCA 3Q9NA 4YP6A 1NRJB 2WG1A 3EXHC 4JIMA 5ESDA 4CIDA 4JHXA 4N7RA 4HAYA 5H9WA 5B4TA 2IDMA 5PGMA 3Q0IA 4LGYA 2IYEA 4ZQBA 1KVTA 1F48A 3DT6A 1O94A 4UKDA 2WABA 2GWRA 1TJ4A 1Z13A