4RZXA

Crystal structure (type-3) of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
208
structure length
207
Chain Sequence
KGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate kinase
publication title Crystal structure (type-3) of dTMP kinase (st1543) from Sulfolobus Tokodaii Strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 85
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rzxA00
4HEJA 2PBRA 1F3OA 1IN7A 2AXNA 3B82A 4AYXA 4OHWA 2AK3A 2QAJA 4QG7A 4P31A 4QNRA 3SDZA 3PITA 4CEJA 2WKRA 2ZRCA 1JQLB 4HLQB 3EZ7A 1Y63A 4DBLC 1S1CA 2O8DB 4CZ2A 3B78A 2A30A 1FW6A 4MYUA 3NEJA 1GSIA 1M6NA 1NLZA 1ZINA 1YR7A 4L8GA 5J4VA 4PFSA 2OXCA 4RD2A 1Z0AA 4BQSA 1W44A 2O8EB 1OHHA 1XEWY 2GJKA 2OSBA 5E7IA 1R8SA 3THXB 4NBSA 2QPTA 1E2NA 3PUVA 3ZD7A 3K9NA 3WXMA 3QIAA 1N5KA 3GFTA 3GQBA 1HTWA 2VHJA 3U6BA 4EJSC 3SEAA 4DLXA 3C15C 3VU9B 5C2JB 1SKYE 3VFDA 1G16A 3H4MA 3AVWA 1A4RA 4CGZA 2J3EA 2OFOA 2YOHA 1NKTA 1EWRA 1BIFA 4LC1A 2KSQA 1XCMA 2XSZA 2DWPA 3RS7A 3N70A 3ZZUA 4U02A 2KBEA 3IO3A 4GSYA 1KK2A 1JXOA 1Z8FA 3R7WA 4O25A 4DSOA 4HB3A 5KOYA 3DKVA 1IXRC 1HH4A 2OESA 3A37A 2V8OA 2C9OA 1YVDA 3UMSA 1TNDA 4PSKA 3RWMB 4RKFA 4PO8A 1P60A 1W0KD 1ZD1A 5ELXA 5JLJA 4FN5A 3P32A 3SZRA 4QGHA 4R98A 4BFWA 2HLDD 5J40A 3Q72A 4Q66C 1ZAKA 2F43A 2JJ2A 4GT1A 4IHQA 1OFHA 4US1R 1KHTA 1E0JA 2H92A 4M1WA 4QBIA 5JSZB 3WY9A 2RAPA 1T5IA 1FX0B 4B2PA 2CXXA 2IYVA 2PEYA 4M1MA 4B73A 2VA8A 3B9QA 4ESVA 1CRPA 3W6PA 4Q03A 4B3CA 1WF3A 1GAJA 5HR5A 4Q7MB 2QBYB 1ZU5A 2A5JA 1YZNA 1PJRA 1U99A 2JJ2D 2ZETA 3LVRE 3VX4A 2QSZA 4HAUA 2E1RA 3B1XA 1II8A 2W58A 3WYAA 1E9AA 4JLMA 2GTPA 2REOA 3RAPR 4Q00A 4QOSA 1CKEA 3U5ZB 1IY1A 1U9IC 2QUZA 2TMKA 1U8YA 3T61A 1G4AE 3TRFA 1LW7A 5K8TA 2GBLA 2OEPA 4TMZA 2CCJA 1OLOA 4B32A 4KSBA 4L5BA 4O2LA 1DAMA 2D62A 1YZLA 3VQTA 2A9KA 4MGIR 4FIDA 2NPIA 3LV8A 3QVUA 1Z2AA 4QM7A 4DLYA 1T3LA 5G40A 2OLJA 4IW3B 4OQFA 3VKWA 5H68A 1KZGB 2WWYA 1D2MA 1OF1A 4LJAA 4YONB 4NL4H 1KO8A 4EPTA 221PA 4PHTA 1DAEA 2WVJA 2P2LA 1AS3A 2FSGA 4OHXA 3A4LA 4RVCA 2QPAA 4JMPA 1VYTA 5KNDA 4TLBA 2Q6TA 1QG4A 1R10A 1G3RA 4RD1A 1OV4A 1ZIOA 2IYXA 4ESHA 4TLCA 3DOEA 4LV6A 2JLVA 2JATA 2QQEA 4K8OA 3IPYA 4EDHA 3MJRA 1OIVA 3RRYA 3THWA 1NN3A 3REFA 1OH6A 5JMTA 4HLUC 5HPYB 2BKUA 2YWEA 5BYJA 4CRWB 2CCKA 2WJJA 3GEHA 4R7ZA 2DWQA 1Q1ZA 4UNQA 3NBZC 4HAZA 4WXPA 4BASA 2B21A 3K70D 1KK1A 1IM2A 1NVVQ 1XEWX 4JLNA 2J41A 1XEFA 4XSHA 2JEOA 1ZP6A 3QQ5A 3VR1A 2IC5A 1UM8A 2ZROA 2PT7A 1AJEA 3SN6A 2JLQA 4OI1A 3QG1A 2OAQ1 1XTIA 3IHLA 3OEHD 2GZAA 1T6NA 1XMJA 3OHMA 5EZ5A 1M7HA 4B2IA 1E2QA 3QKSB 1M2OB 2ZYWX 1W47A 1AM4D 5KUTA 1W4AA 1Q1BA 2ANCA 2YOGA 2PX0A 3AF0A 4GZLA 3NHAA 1A1VA 2V6JA 2OCPA 3LXRA 1CULC 3OAAA 1AS0A 2GETA 2OBLA 3C5CA 3AKEA 3CRW1 5L8VA 2FSIA 1U9IA 2ERXA 3AVYA 2OV2A 3SJCA 4URUR 3LLUA 4TYNA 1PUJA 1T3SA 2EYQA 5SZJA 1Z6AA 4MRVA 3QXSA 1US8B 5E7MA 2I3BA 4D2IA 3PEVA 4B44A 2A5FA 1KI7A 4JKIA 3AF1A 2R8RA 1I2MA 4DEYA 4Z54A 4LHVA 3QNUA 3B1ZA 4DUGD 2O0HA 3ZZ0A 2AWNA 1SVMA 5K8UA 2WWFA 1LTQA 3U44B 2HT1A 4K46A 2GEUA 3IILA 2WIAA 3CNNA 1FZQA 2ZS9A 5EP2A 1LV7A 1NVVR 5FPYA 2PL3A 4CDGA 5DNYB 3T06B 1E3MA 3D31A 3EPKA 3EPJA 2VRWA 5J4LA 2R6DA 4WOPA 3SU8A 1EG7A 1A7JA 5SZHB 4CVNA 1KGDA 3LWNA 4F7WA 3UK6A 3K70C 3IO5A 3A1UA 3THXA 4LY6A 4W5HA 2P3SA 3KQKA 3CX6A 1S3SA 4DLTA 4BLPA 4YMVA 821PA 3PEUA 4OL0A 1KDOA 5CK5A 3DDCA 3U7EB 3AVPA 4M1OA 4QGAA 3IGFA 3UG7A 4QRHA 4DB4A 2W00A 3RS5A 2RGCA 1BYIA 2QAGA 1E9RA 2A5GA 1T4GA 1E9CA 2W0SA 3TUJC 2CNWA 4RFSA 4URZR 3RC3A 1I4LD 5C1BA 3RRMA 5FUWA 3ZQ6A 1UFQA 2G77B 2J1LA 2D4HA 3HJNA 4XIGS 3EARA 4PZZA 1HQCA 3B13B 5JWHA 1B0UA 3W6OA 1KI6A 2ODBA 2DCUA 4C2TA 3V4RA 4JVSB 1A2BA 3VMFA 1DAHA 1P9WA 4PAMA 3MFYA 5FBWB 4BEBA 4F92B 1SVOA 2IYZA 4D26A 2GEVA 5F9FA 1E9FA 3QKUA 3HWSA 1NG1A 2C9YA 2F1JA 2VF7A 1G6OA 2WKPA 2WJHA 1D9XA 1KO4A 2VBCA 1IXZA 3A36A 4CEIA 1HY3A 4PQYA 2KE5A 4G3XA 4TYWA 4DCTA 1DE0A 1XTQA 3CX8A 3TIFA 3ZIAA 2IA5A 2B8WA 2IHYA 4WIAA 3TR0A 1N5IA 4P3YA 2IXEA 3IBGA 4EJSA 4C0QC 2WPDD 4W9MC 1W7AA 3C8UA 3DO6A 3AGPA 3ONWA 3DEFA 1E96A 2CDNA 4ACBA 2AKYA 2O52A 3CKLA 2RGGA 3W6NA 1E2EA 1NI3A 4EPYA 3P4XA 4FCTA 4LHWA 2J0UA 3EPHA 3AVTA 5FOWA 2AX4A 1OW3B 1FUUA 3WP1B 2D2EA 5SZIA 1QHHA 4MKIA 2QN6A 3O8BA 2QTHA 2W6IA 2YV5A 3GJ3A 3LO5A 3OE7A 1W36C 1TX4B 2IXFA 3KQLA 1G64A 3WHKA 1HT2E 5CK4A 4CF7A 2F3TA 3AP3A 3FFAA 4JLJA 1U0JA 2J0QA 2QL6A 1XD2B 4N0DA 2KBFA 3N2IA 4HLDA 1WCV1 2ZSEA 3WBKA 2V3CC 3WYFA 4LJYA 2QGZA 4BLRA 4TQAA 1EX6A 3QF7A 3THOA 4BRUA 4XTRA 4KBFA 4B48A 3NC0C 1NN0A 4D82A 3V00A 2ZRKA 4Q1AA 3GLIA 1NJGA 1P62B 4EFLA 2QORA 1KSHA 4YMSA 1CRQA 1NY6A 4B3XA 5EE1A 1US8A 1DAFA 2KWIA 5B64A 3QKRB 1GL7A 1WB9A 1TTTA 4R9UC 1VHLA 4QHSA 3J81k 4C9BA 4MUBA 1EFUA 4FCWA 4DCUA 4DLZA 3PFIA 3ZS9A 1MO3A 2RGAA 4P32A 2BC9A 1NNEA 3U44A 5A4JA 3KKPA 3SBEA 3THWB 1Z63A 1G8HA 4HB2A 5HZKA 2CNWD 1MT0A 3EA0A 1CEEA 1SVWA 2GBLC 4YMUA 4D4KA 1G21E 3EIEA 3N5CA 1DEKA 3GFOA 4LI0A 4US2R 2OBMA 4GOKA 5DHFA 1NF3A 1GNQA 4HUQB 5DSZA 4Q9IA 4JSTA 2SHKA 2VEDA 1GWNA 3SS8A 1YZQA 3W34A 2BBOA 5C4MA 2RB4A 4TYYA 1NVWQ 2QQ0A 3FGNA 4AKIA 4TMKA 1HT1E 2CLDX 4XH9B 1IHUA 1E9EA 1SKYB 3UMFA 1MABB 4JT4A 2EFEB 5FL7D 3LDAA 3NKVA 1CJTC 1UDXA 3AKDA 3HU1A 4LYJA 4A0FA 3EG5A 2B92A 3FVQA 1UBEA 2WICA 2YHSA 5TY0A 3BOSA 2GHIA 2XNDA 3CW2A 3BJIC 3AVOA 4MKHA 3TSWA 3LXXA 4U7DA 4NCHA 2Z4SA 3L0PA 4WW0A 1G20E 1FP6A 1RKBA 2KJQA 1E79D 2YZ2A 1PVOA 1VCMA 1N5JA 2GJ9A 2ZITA 3HP1A 2I1QA 2FEOA 2QI9C 1ZVQA 2C78A 1JR3A 3ICQB 4LSGA 5B57C 1ANKA 4TZ6A 4UJ5A 1S96A 1ZNZA 1C9KA 2XEXA 3AGQA 2GVZC 1UDWA 4CW7A 1U81A 1DADA 3DHWC 3OAAD 3EC1A 4A0RA 3IBYA 4AWXA 1NMXA 4BEJA 2QNRA 2WBLC 1U0HC 1EWQA 3WMGA 1M34E 5JHGB 3OEHA 5D3MA 3K0SA 2CL6X 1YR8A 4R2HA 1S8FA 1VG8A 1X8KA 3MCAA 4AKGA 4II7A 4OJQA 3RWOA 4JJZA 2F9MA 2BWJA 4LRWA 3EPLA 1VYVA 2GK6A 1ZYUA 1VCIA 2IYQA 2F7SA 1VTKA 1KY2A 1H8ED 4F4CA 4RZXA 3ND8A 4D0LB 2MSDB 4LCBA 4S35A 2IS6A 1UJ2A 4KBGA 1W4RA 4TWZA 5UKDA 4DLWA 2ZTSA 3DKPA 2XJ4A 1DG3A 2FFQA 2PH1A 1GTVA 5EZ6B 1P2VA 2JJ8A 2YC2C 3R8CA 4A0HA 1TF7A 2Q0HA 2QMUA 4ZO4A 1D2NA 4F93B 2X8AA 2XGJA 4C0JA 1QBKC 2QMEA 4LBWA 1S9DA 2XTNA 3OZXA 1R0YA 4MRSA 3A4NA 4TLEA 1N6LA 3F3YA 2C2HA 5TXGA 1J90A 3SYNA 1LVGA 4QHYA 1TQ6A 2EFGA 2BBSA 4ABYA 2QA5A 1F6BA 3QKRA 4MGYR 2AD1A 2NGRA 2OAP1 1HUQA 2ZS8A 3BFXA 2WSSA 4PPFA 5KNBA 3VR2A 1EXMA 1G19A 4M4SA 1Z0IA 1YJ5A 1OB5A 5G3YA 3C5HA 3C14C 5JS8A 2DWOA 1XXHA 4A2QA 5GVSA 3U6KA 2GA8A 3BORA 3NDBB 4PZYA 2JLWA 1BOFA 1KKMA 3O8RA 5DH9A 1W5TA 2JGNA 1N0UA 5L3SA 2ONKA 4I81A 3DOFA 1E2IA 1T3HA 1E0KA 1FX0A 3OF5A 4TZ0A 2BVNA 4B34A 4PSAA 4LWZA 3G82C 1QHNA 1TEVA 2XOKD 2X2EA 4YXWA 4AKHA 1KAGA 3GLFA 1NKSA 1U0LA 1KAOA 3UANA 1NBMA 4NYIR 4YMTA 3ZDQA 4Q7KA 3U2QA 4NMMA 3LW7A 1MRNA 3L2OB 1AGRA 1I4TD 1MO5A 1S9HA 2A5DA 2OG2A 3HYRA 4WXRA 2UZ3A 4E07A 3R9WA 1JEEA 2MSEB 3T1VA 2B8TA 1Z6XA 4JYBA 3W8NA 1YRBA 2ZJBA 3WNDA 2RGNC 1CU1A 1VCNA 1R7RA 1GRQA 3DMDA 3P1JA 3TAUA 2RH5A 4EFNA 5KDOA 1P4SA 5CJ2A 4BUJA 3AM1A 3NHBA 4LJ8A 2LWIA 5L3QA 2ORWA 1ZM4A 4M9QA 1D2EA 3NIBA 2PJRA 3QBVA 2ZYUX 2JDID 3O47A 5IF9A 3RSLA 3OIUA 3AKYA 3QF4A 1J2JA 1S4QA 2HUPA 1G291 3EX7C 1E4YA 2WOJA 1SHKA 5TVKA 1GKYA 4NHOA 2J7PD 2NIPA 4JJKA 2GDJA 4Q1BA 3QKTA 1M7BA 1T5LA 1I2DA 4D25A 1D9ZA 2GJSA 2ZSFA 4LYFA 5HE8A 2DFTA 2X19A 4W5JA 2G9NA 5BWMA 3ZYCA 1AQYA 2ZJZA 4M8NE 1CIPA 4NYJQ 5EJEA 3PEYA 3LH5A 3MLEA 1BYUA 2CK3A 4MYCA 3KTAB 5CM9C 4KCGA 2R6GA 1G3QA 4LHXA 4WZAE 4LGMA 2ZI6A 5EP3A 2WZQA 4JLOA 1ZNWA 2FPMA 3KL4A 4PZLA 3MWKA 2KB0A 1R4AA 3SHFA 1YQTA 2YOFA 1DAIA 1TQ2A 1KJYA 5KSZA 4A6XA 2BMJA 4HAWA 1NRJB 5BN5A 1JI0A 3TMKA 3I72A 2W0MA 1K6MA 3P20A 3H86A 3H2YA 2O8FB 3L82B 5JWOA 2G0NA 3M4YA 5EP4A 3AQ4A 4MGZR 1G18A 3SI7A 1VDZA 5HZHA 4QHTA 1BS1A 3DPUA 3LVQE 2FDCA 1L7VC 3A1WA 4MGKR 1FP7A 3LFUA 4AC9A 1WP9A 3FB4A 2DFKB 3JZMA 2HXSA 2AN9A 2ZRFA 3KX2A 2FFHA 3LNCA 3RDPA 2AWOA 4NYMQ 3VTKA 1ONBA 4HLUA 1OFIA 2VQSA 2OHFA 5FPKA 1KI3A 1DELA 3W5JA 3PJRA 1FUKA 3BB1A 2IYRA 1B23P 1CP2A 1SGWA 3K09A 2RHMA 4B3DA 2J5XA 4BLSA 1ZUNB 1CS4C 1JR6A 5KHOC 4DHEA 1VCOA 2HCJB 5B2ZA 2JLXA 3B1YA 5CIQA 2GAOA 2GZHA 3ZQJA 1UBGA 3DMNA 3FYHA 4FWIB 2CK3D 1TMKA 5JI3E 1MH1A 2F55A 3MD0A 4CEHB 4AY2A 4Q21A 3HPRA 1W4CA 2ASEA 5FL3A 4Q9KA 4MITA 4P4TA 4UXHA 4D4MA 1GRRA 5EXXA 4R71A 4Q4HB 1WBDA 2FJUA 5AWFC 4NKRA 3ZJYA 5FTMA 5AJVB 2EWWA 3AV0B 4TT3A 5FBRB 4TMXA 2CHQA 2LKDA 2XB4A 2XX3A 2ZRPA 4ACAA 4U00A 4JLDA 2XZPA 1OH5A 1TU4A 4PX9A 3U7GA 2ODEA 3GLGB 4J0QA 2WPDA 2C77A 3PUWA 3HPQA 1Q12A 2IF2A 2IEZA 2AKAB 3QY0A 4IDHA 2O8BB 1W2HA 1FMLA 3Q9LA 3VR5A 4D0GA 4C7OB 4NYMR 1G9XA 5K8LA 3KDSE 4BWYA 1XPUA 2O8FA 2ZRMA 1N3BA 3NC1C 1TQDA 5CJPA 4F4IA 1NLYA 5M04A 4ZKDA 1ZD8A 4EPXA 3GD7A 3LBIA 4DXAA 5CB6A 1NJFA 3G5UA 2P65A 4M1TA 4PHFA 5A0FA 2V54A 2VL7A 4ERNA 1UKVY 3MWYW 1IN4A 2BDTA 4HDCA 4ZCLA 2ZREA 4RZ3A 2J7KA 4IDOA 1KMHB 1VECA 1XMIA 3ZH9B 4NCNA 5JFGA 1AKEA 4LBYA 1G8GA 4V02A 4EFMA 4RY2A 1P2UA 4TMWA 5FUVA 3S1AB 3DL0A 4QL3A 2E87A 1M7GA 2BEJA 3QI2A 4B3GA 2YWFA 1K5GA 4N0EA 3MMPA 1E32A 3RS2A 4AG6A 3RC8A 1DO2A 3A58B 3B8HA 2W6ID 5FPTA 4UKDA 5FI0B 3ICEA 2ZRBA 1XCGB 1PLLA 3ZLJA 1TU3A 1IN5A 4JBYA 1ZUIA 2JJ1A 1QZXA 4RD4A 2Q3MA 2AFHE 3X1XA 3H0KA 3FKQA 3ADDA 2RGDA 4IVQA 4HATA 1KIMA 1YZKA 2GXQA 4GP6A 3T12A 2FPKA 2Q3HA 4M9XA 3M0EA 1LF5A 1Y3AA 3NDPA 4M9SA 4O0MA 1HQYE 3B9PA 1E2FA 2BM0A 4O2RA 2XNSA 2DR3A 1KKLA 1IONA 2FWRA 1ODFA 3EZ2A 1XEXA 3AVVA 1NMZA 3TUIC 5JECA 2IYWA 3GMTA 3I1FA 4H1UA 2JAQA 3FKSD 2J59A 5DISB 3MWJA 4MDEA 2NO0A 3VNVA 4A8JC 4V0MA 1KK3A 3AH8A 4DLRA 4Q5IA 1AS2A 2K5UA 3KKQA 2ZEJA 2ZE7A 1WQ1R 2D06A 3GCGA 4BFSA 2PMDA 4BPBA 3E2IA 1JB1A 2ZM5A 2ZRHA 3CR8A 4PAOA 1XDBA 1GRNA 2YWHA 3WHLA 3I4LA 1SXJA 2H17A 4JS0A 4PPQA 4RD3A 3BRWD 2OUKA 4HLCA 2QU8A 2GEDA 3AVUA 4BRWA 1E9DA 2ZRLA 1IQPA 1MO4A 3V9PA 1P2SA 4P33A 1KYIA 1RRFA 1YZUA 2E9SA 3X1YA 2ZRGA 3D7MA 4BLOA 5GJBA 4PXAA 1F2UB 4XD7D 1YE8A 3FMFA 2WIBA 2JJ1D 4A82A 3PV0A 4NP6A 1EX7A 1P3JA 1DAGA 2CCGA 1N2CE 2CHVA 2IHBA 2PCJA 4PHHA 2ZUDA 2R6AA 4DDWA 1Q0UA 3D8BA 5JS7A 1DAKA 2JA1A 4TSFA 4XJXA 4IDNA 1W2GA 1LB1B 3NTUA 5EUMA 2IYTA 4XWKA 3GJ0A 2GCOB 2OCAA 4DSUA 2ZXUA 4ZCMA 2ZE5A 3X1ZA 3MJHA 1JAIA 2R6FA 2ZI3A 5FI1B 5KDDA 1PV4A 3REGA 3L8ZA 1XEXB 3PQCA 2O8CB 3H1TA 1F48A 3B1VA 1TUIA 1AKYA 4RD0A 1W49A 3CRMA 2IYYA 4IDQA 1OPXA 2QRNA 3C4JA 4IOJA 3U3MA 1LFDB 1A5TA 4KJZA 4DLVA 4LDJA 4LPKA 2N1BA 1LF0A 2WHXA 2GK7A 3SFZA 3TLXA 5LB2A 2ANBA 3LX5A 4D81A 3KKNA 5LB4A 3UWOA 1ESNA 2HEIA 2BOVA 4FINA 5KSPA 3CX7A 4KHZA 4B6FA 3NWJA 5EE3A 4K81B 5FTJA 1M74A 3Q7PA 1PLJA 4P4UA 1AN0A 1KMHA 1U8AA 4L16A 3BXZA 4W7SA 3AP2A 4C0HA 1XWIA 1P75A 3Q3JB 3QEOA 3R7WB 3SBDA 1SXJC 3Q7QA 3NBYC 2X1VA 2DPXA 3T1OA 1E2DA 4EPWA 4NTZA 2VP2A 2BMDA 2QT0A 1AQUA 2HLDA 2YVUA 1XMSA 1Z28A 1ZBDA 1E6CA 4D4JA 2W2XA 1RYFA 3VKGA 1XD9A 3F8TA 4CEJB 2H8KA 2ZJ5A 4DB2A 1OSNA 4IDPA 1Z3IX 1NVUQ 4IFEA 3FHCB 4Q4HA 3UKDA 3Q8XB 3ZVLA 5LD2B 1G7RA 1EESA 1KSFX 2XAUA 2XTZA 4PANA 4A8JA 1V5WA 4YDSA 2AXPA 5HTKA 4FWTA 3SQWA 2BJVA 3JVUA 4YLGA 1X3SA 1N6PA 2QT1A 3KZ1E 2IX3A 3CB4A 4KFRA 4PQFA 2ZIAA 2IWHA 2R9VA 4Q02A 1OB2A 1G3MA 4HI0E 1WXQA 3AUYA 4DDVA 4OQLA 1FMJA 3GLGE 1BO6A 5AJYA 3LBHA 3WYGA 2G1JA 4JBXA 1NBMD 2CLCX 2FF7A 3ASZA 4GPTA 5TDHA 5L3RA 1CJUC 5FR1A 5KU1A 4KSCA 5IDVA 3CF6R 2FFBA 3ADCA 1E1RD 2G83A 2WWIA 4DT1A 3TUZC 3A1TA 2NO1A 3QUSA 2BMFA 2ZUBA 3K53A 2ZE6A 1KI2A 2XSZD 2ZUCA 3FHOA 3ZIAD 3NXSA 4PTLA 4A0GA 4MRRA 4URWR 4AD8A 3DM9B 5P21A 1E1QD 1N0VC 3VR6A 1RIFA 3CUEF 4Q9HA 1Z6GA 3P27A 3CNLA 4LJ9A 3W5IA 4QKQA 3B7GA 4MH0R 5F2EA 4XVQA 1KSGA 1KY3A 1CR2A 1G5PA 4BZXA 3QPUA 1Z22A 4GL2A 2VH5R 3QPWA 3U4QA 5DIFA 2OO7A 5GJCA 2WWXA 5SZKB 3KTAA 1ZCBA 2FX3A 4FMDF 3ZS8A 1AZTA 5CYPA 4LYHA 1DO0A 2C98A 2ZJ2A 4PAQA 2W2TA 1GG2A 5CDFA 4RJLA 1XNJA 4UXIA 2XZLA 3D6TB 4TLDA 1RVDA 5JZVA 3OIWA 5FUXA 4HB4A 1BH2A 2HJVA 1SQ5A 4C0LA 1G5RA 1P9RA 2A3RA 2H18A 5G53C 5JBQA 3IIKA 3BC1A 1CTQA 4L9WA 2QSYA 3RLFA 1Z0FA 2ZVPX 3A6PC 2QE7A 2EWVA 2JCSA 3E1SA 3NEYA 2REXB 3PCRB 4HAXA 5EXPA 4OQMA 4QM6A 3ND9A 2BIFA 1H8EA 2RGXA 1KI9A 4G5SA 3FMIA 1DTSA 2ONJA 4CT4B 4V0OA 5BW8A 2IYLD 3UPUA 4P4SB 2H57A 2QAGB 4IXNA 3UIEA 2FH5B 4Q4AB 5BXQC 4LC0A 4C2UA 4LBVA 4XWOA 5IK2A 2QY9A 2ZJOA 1VG1A 3PR1A 1A82A 3K8YA 3UXMA 1AK2A 4C30A 4LBZA 4JVLA 1R5OA 4LJ4A 1EFHA 2WMOB 3QKSA 4EQ6B 3DVLA 4HYYA 2ZYVX 1DVRA 3GFPA 1GOTA 1W36D 4HAVA 4HZIA 3RNLA 3IQXA 4TN1A 4WVFA 2VP0A 2FSFA 4QJ4A 1ZD9A 5G41A 4ZI3A 2PLFA 1RC8A 3TJZA 4D80A 2ZVQX 4BFXA 4OYHA 2WWHA 2QMOA 4DC9A 1L4YA 5CDFE 1YR6A 3PVSA 1XTJA 1NL3A 4JL5A 5J5CA 2RMKA 1R5NA 2NPFA 4GDFA 4QBFA 2WKQA 1GKUB 3CPHA 1KO1A 2G88A 3PUXA 4L9SA 4IXMA 3DZDA 1YKSA 3CO5A 4Y0VA 4PC3A 1HE1C 2OCYC 1Q3TA 1FTSA 1JAHA 4G5QA 1AZSC 2N42A 2W83A 3K9HA 4URXR 2O5VA 1P72A 2AHOA 1H8HD 3OEEA 3B60A 5FBQB 4EJSB 3C41J 3GEIA 4RZ2A 1IJEA 1JEDA 4POAA 4UXJA 3GLHE 2NG1A 2J9RA 4C0AC 1HV8A 1W5SA 2GJ8A 4ARZB 4OK6A 2NTYC 4XOIA 1W48A 3KJEA 2IYSA 1E0SA 3FMOB 2QEQA 2ODWA 4DDTA 3GPLA 3F5FA 1NN5A 3I3SR 2J0UB 4JLPA 4GFDA 4OJKA 3RVBA 4H9GA 4ZPXA 1G8PA 3QXCA 5FR2A 3PUZA 2W2VA 4DIEA 3CPJB 2QE7D 3AP1A 4XD7A 4DWJA 4Q4AA 1IY2A 2P6NA 4F38A 1N6IA 4BZQA 3ADBA 3GEEA 2QG6A 1MRSA 5L3QB 1X1SA 2OE2A 2ZSBA 1NVXQ 1O87A 3BAFA 3ETLA 2JLUA 1OKKA 3E70C 4MYTA 2PT5A 3HU2A 4KITB 1UKEA 3RS4A 4ASUD 3OESA 1WA5A 4QBHA 4B74A 5JWRA 1FPMA 3SQXA 3E5HA 2Y8EA 4E09A 3W3AA 2OILA 2W6JA 2C8VA 4IOMA 3NVAA 3Q5DA 2GWHA 4OHYA 1U90A 3V4FA 5IK2D 2HDNB 4H1VA 1A2KC 1OYWA 2YINC 4Q9JA 1RRCA 3QXHA 3GLHB 4NE2A 3EIHA 4GNKA 1X8JA 1IY0A 5CLQA 3DZ8A 2MSCB 3QVVA 4CEHA 3RS0A 2ZRIA 3CH4B 2WAYA 3WNCA 1W0JA 2G1KA 1SKQA 3MGCA 4WBSA 5AJZA 4KLNA 2XTMA 4B71A 3CZPA 3TE6A 3AF3A 1OH7A 3ASYA 4OQXA 5CITA 1QF9A 4S2EA 1XXHE 1N6OA 4DKXA 4JZKA 1YR9A 5EE5B 2MMGA 3CNOA 3D3QA 5LPNA 3K0AB 4DIDA 3A8TA 3GLFE 4JIMA 4QGFA 4OI2A 1N6HA 2R6CA 4TMTA 5BN4A 4Z8YA 4B76A 3K0CA 2IF0A 4TYQA 1JR3D 4Z1MD 4LX0A 4E03A 1Z5ZA 3L0IB 5AR1A 3QSYA 2EQBA 3VU9A 1UKYA 2AL7A 4B43A 1DG1G 1LS6A 4A6PA 2BKEA 4A9AA 1JJ7A 3K09C 3UWKA 1T8TA 4ZI2A 4BFYA 1GL9B 4GBMA 2V55B 3TBKA 1COWA 1KI4A 2VSOA 4FMCB 1KO7A 1G3UA 1KSJA 1H65A 1ZM2A 5EQTA 1YZTA 3HR8A 5GVRA 3IKJA 4CYMA 3T34A 1R0XA 2F1RA 3P26A 1VPLA 2F1IA 1KO5A 4WA7A 3BK7A 4GRAA 4RFVA 2RHDA 4DJTA 4ON9A 2L0XA 3WRXC 3OFND 1LY1A 2HXYA 2IK8A 3DM5A 1XTRA 2IWRA 4ZIRB 2A2ZA 3HYTA 1NSFA 1T91A 4MRNA 4QBGB 2P67A 4UNSA 1Q22A 2QP3A 4ZV4A 2F43B 2P6UA 5FTNA 4FI3C 5DLQC 4BGDA 2FZLA 1QHSA 1OFTA 1IN6A 1Q1QA 2PJZA 5F3WB 1J8YF 4V0NA 4QNMA 2BV3A 4WAUA 1ZM7A 4C0BA 5FBLB 1N25A 3U4QB 1FQKA 2AR7A 3KB2A 2G6BA 4QGGA 2GCOA 4TQ9A 1ETUA 1QHGA 4JYCA 2GF9A 2OBNA 5J4HA 3VR4A 1CJVC 4V0KA 4FMDB 5KPJA 4AG5A 4Q7JB 4OHZA 3UMRA 2XITA 3CONA 4EPVA 1II8B 3ZZTA 1RFLA 5JEEA 4O3MA 1RRGA 2VSFA 3SC3A 4TTQA 1WRBA 3CRVA 4XTCS 1IN8A 2Z0MA 3X2SA 3GP8A 3H84A 2FSHA 3EASA 4UNRA 1KDTA 3LQRA 4X8MA 3CR7A 4PHGA 3GJXC 1L8QA 3NBXX 2Q9BA 1XB2A 2PX3A 2Q21A 5JRZA 2RCNA 1OHHD 1Q1EA 2CBZA 1F5NA 1G17A 4A92A 1L2TA 3W8RA 1ZNXA 3SOPA 1AGPA 3JVVA 1UEJA 4HDOB 4AIIA 4OI0A 3X1DA 4KU4A 4NONA 3C16C 1W36B 3GJ8A 4X8HA 1F60A 4HZUB 4YDHB 1NY5A 3TQFA 4HDQB 1SVKA 4US0R 1P9NA 2YKGA 1KNQA 1SVIA 2X2FA 1G7SA 4HSEA 2B7BA 1WDTA 5J4YA 3Q85A 4KYIB 2QRZA 1XP8A 3LA6A 5FOVA 4EAQA 2WWGA 4URYR 3B1WA 5AUOB 1KI8A 4FMBB 1XXHB 3GJ5A 4DEXA 2ZYTX 1E98A 3TK1A 2CJWA 4FW9A 4Z1MA 1Z6YA 4A4DA 4LJ5A 3R9XA 2BMEA 2P0EA 4OK3A 3O8DA 3QXJA 3RHFA 4C3ZA 3T5GA 2BHRA 1JXMA 2D3WA 2VO1A 2BM1A 3QBTA 4D0NA 2ATVA 5GJVC 3T1QA 4TYPA 2JLZA 3U7HB 3M6AA 1RJ9A 5EXTA 2HYIC 3QEJA 5B58C 1SXJD 5TMPA 3K0FA 4LV8B 5HCIA 1RW4A 2VHQA 3KXKA 4TSFD 4UQOA 5TV2A 1T8UA 3KFVA 4BLQA 2ZJYA 2NO9A 1ZIPA 2CLSA 2EVWX 3CZQA 5TARA 3FTQA 3NG1A 2WMNB 3A1VA 4DSNA 2BCGY 3MG9A 4RSGA 2QBYA 2GILA 1DPFA 3EW9A 4DZZA 1E9SA 1G5TA 3R8FA 4PQRA 3EZ6A 3CLVA 3QOFA 1G3IA 2NZ8A 2A78A 4B3FX 4XVUA 5HCNA 1G4UR 2ZAOA 5KTYA 3T1TA 1G6HA 1E69A 4PPGA 3U3JA 4C0KA 4KFSA 4TTPA 2F9LA 4OQNA 4BFTA 2FV8A 3PEWA 1YU9A 2ATXA 1NIJA 5JCZA 1H8HA 3CIOA 4FD2A 3U3KA 1QDEA 1ZM9A 4RFSB 4TL6A 2BBTA 3WBJA 1OXUA 4DSTA 2PCLA 4B35A 2ZI9A 3MWLA 1ZM3A 5H1YA 4KFUA 2BJWA 2Q3FA 1UAAA 1RRPA 1G7CA 2V7QA 3FMPB 1QG2A 2PEZA 4Z8XA 5DI9A 1PZNA 2CHGA 4JL6A 2FNAA 1IOZA 3F0TA 4JBWA 2VIIA 2VYFA 4B47A 2IS2A 1E79A 5DYGA 2IUSA 2FN4A 1EFTA 1HE8B 3CRRA 5CYOA 5TB5A 3I32A 2N46A 1N6NA 2JASA 5BN3A 4KI0A 4EIWA 3GJ4A 2XOKA 4KXFB 4YXWD 1W1WA 2VHTA 3IHWA 5JJIA 1W46A 4M21A 1QRAA 2YNMA 5J47A 5L3SB 1X8LA 1YRAA 721PA 2OZEA 1ZNYA 4HAYA 1OXVA 3K0AA 3RS3A 4M9ZA 1GL6A 3OEED 4AI6A 5HKKD 5E3HA 1R0ZA 1P61B 2XXAB 2DYKA 2REBA 5FL7A 2HF9A 5GJWC 5HE9A 4Q48A 2A5YB 4CT5A 1KOFA 4JVMA 4JSYA 2QP4A 3QG5A 4LK2A 2WTUA 3FOZA 3CH5A 1XZQA 1X1RA 3SHWA 1K8RA 2DBYA 2R65A 2ZR7A 4IVRA 1BKDR 2H7VA 4M22A 2FMXA 4V0LA 5FOSA 2O8CA 5H70A 3PIRA 1G8FA 3BFVA 5DGXA 2ZANA 4ZKEA 2JLRA 1SXJE 2GZDA 4ZDIA 3T15A 2V7QD 3FFBA 5KSOA 1VG0B 2BEKA 1IXSB 2IS1A 2BCJQ 2IEYA 2B7CA 2G0TA 2QTVB 3B2EA 4G5OA 3QXXA 5DE3A 5C46F 3BB3A 4C0SA 2CE7A 4GZMA 1ZJ6A 2Z43A 4IJMA 3TVDA 3EZ9A 3OIVA 1NBME 3QF4B 2H5EA 1CJKC 1E2JA 4GI7A 3UG6A 3B5JA 1EK0A 1F2TB 1M8PA 4NH0A 3I8SA 2RGEA 2UVQA 4HZUA 4LYAA 1U8ZA 4BZPA 3I73A 2QMHA 1J70A 1XCPA 2HT6A 2JLYA 2PZGA 3M1IA 4RKEA 2DHRA 4F91B 1QVRA 4N1AA 3VX3A 2WSMA 2IT1A 3CWQA 2QGNA 3TKLA 4BFZA 2WJGA 3IIJA 3IUYA 3MSXA 4R2IA 4BFVA 1EFRD 1XBTA 3RSOA 4KODA 2ZRJA 4YC7A 2IUTA 1XJQA 1NSTA 4XSGA 2EFHB 4M0LA 1CXZA 1HURA 2QENA 2IUUA 3GLGA 3CBQA 3KXIA 4IOKA 5AJWA 2C03A 4Q01A 3BGWA 2J45A 3JZAA 1JBKA 4RD6A 1JJVA 3EAQA 3W9YA 1XRJA 3W90A 2ZRAA 2R44A 4IEEA 3SYLA 2ZRNA 1T0HB 3VHXA 5DI3A 5A5GA 4TT3D 4Q7LA 3NH9A 3T35A 1GKIA 3KJIA 1MOZA 1D5CA 1QHHB 4V03A 2RGNA 5J4KA 4JKYA 4NU0A 1BMFA 1FTNA 1UEIA 1XZPA 2OFXA 1P2TA 4HUQA 3ZVMA 2ZE8A 3TQCA 4XWAA 1IAQA 3SE0A 2B6HA 2DFNA 3GJ7A 1KTVA 4Q1EA 3K1JA 3VR3A 1JECA 1E1QA 1PLKA 1TF2A 5K8IA 3TSZA 3QPVA 3K70B 1ZRHA 4PC7A 5C4GB 5JRJA 5LDDC 1LNZA 4GP7A 4ZDWA 1G41A 1GM5A 3MRSA 1WBBA 3U3OA 1TQ4A 4Q4JA 1P5ZB 3BS4A 4DCSA 2CVFA 3AVQA 1KJWA 4V0ME 3WRYC 1Z07A 2NO6A 3IPXA 1SVSA 1Z47A 1VYUA 3RYTC 1GNRA 3CWZA 3AF4A 4YQFA 2V1UA 3BBPA 4Q1FA 1EFRA 2R62A 4U5XA 4XVRA 3VHLB 1IJFA 4I1SA 3EA5A 3AUXA 4Q18A 3TAHA 4QJ3A 1OT3A 1KZ7B 2I4IA 4KAXA 1XU4A 5KPDA 2MMCA 1BMFD 3WNBA 1V43A 2WOOA 4CEIB 1UBFA 1Q3HA 3N2EA 1YZGA 1MV5A 2FPLA 4JLVA 1PUIA 3BB4A 2GXUA 1E0AA 1R8QA 1RPZA 3THYB 1UPTA 5E95A 2OFWA 2W6JD 3KQHA 2VTKA 4DLSA 3K0FB 1TL7C 1ZC3A 3AEZA 4BE7B 2CL0X 2GRJA 2HF8A 3LY5A 4LHZA 5KO2A 1QHIA 1J7KA 4UNPA 5AJXA 2XJ9A 2ZI5A 4KLZA 4DCVA 2NO7A 2WJYA 4Q47A 4M53A 3I62A 3W3ZB 4Z51A 2P5TB 5FUYA 1SZPA 1XX6A 2ZS7A 3U60B 1X6VA 3PG5A 3ZVNA 4JL8A 4PO9A 5DYIA 2Z5FA 4PC1A 1GUAA 4CIDA 3SFVA 3I61A 2J7PA 4G5RA 4BFUA 1GITA 3WP0A 2G3YA 1D6JA 4ZDJA 2CL7X 4LZZA 4Q19A 2DFLA 3SR0A 1R0WA 2ZU6A 4EQ6A 2JDIA 1J99A 5HKKA 1Q20A 2FFAA 3TSOA 2GCPA 2RKOA 5EUQB 2NMVA 1TAGA 1E9BA 4TL7A 4KVAA 3HU3A 2VF8A 3I8XA 2IL1A 2UZIR 5FOUA 3ADKA 3SJZA 3OE7D 3LQQA 4M1SA 3TH5A 5KSYA 2GJAA 4EKDA 3QE0A 2Q9CA 4I99A 4N3NA 2IS4A 1E4VA 1GVNB 2QM7A 1YHNA 1ZW6A 4LV5B 4MKGA 4NCJA 5FTLA 4ZCIA 5B30A 5FPHA 2OCBA 2YC4C 1TPZA 3L8YA 2GVDC 4TL8A 3UATA 4ZDKA 3ZVRA 1DARA 2ZI4A 5JSZA 1ESMA 2C99A 4PC6A 2HYDA 1S0UA 1NLFA 2IW3A 3BH0A 4LJ6A 3EXAA 5G3ZA 1S1MA 2YJTD 2XXAA 1OXXK 4B3BA 4FMCF 5FOTA 1FOEB 4Q1CA 4ARZA 2ERYA 2GXSA 4IRUB 5EE0A 2ZSAA 1FFHA 3HR7A 2C5LA 2EW1A 1W0JD 2LKCA 2NQ2C 3KKOA 1R2QA 1P73A 4IFBA 3IQWA 4LOAA 5D3MB 4EUNA 3GLFB 2IXGA 1ZC4A 2JIZA 2QP9X 1N5LA 3Q5EA 2JIZD 4WZ6A 3SJBA 1EFCA 3FKSA 4AYTA 4OHVA 4A1FA 5CLLA 1GNPA 1JR3E 1JPNA 1II0A 2ZU0C 1VMAA 2C04A 2ECKA 2VP6A 4UNNA 3TR5A 3SYKA 2VHCA 4Q4JB 1R6BX 1Q57A 5E4FA 1UKZA 5F98A 2ZRDA 3LAWA 3L0SA 4M1KA 2J46A 3EWSA 1E2GA 2DB3A 3BERA 1MABA 1VHTA 1GDDA 2IYUA 3AB3A 2OT3B 2VP9A 1F2UA 3LRPA 2Z83A 1HEIA 4NYJR 5DN6D 1UBCA 2FG5A 5EP1A 2VP5A 3P4YA 1G8YA 1S2MA 2ORVA 3FWYA 1Q21A 1O3YA 1HA3A 4MUAA 1JQJC 4DVGA 521PA 4JLKA 1VG9B 4B2LA 2V1XA 3R9IA 4QJ5A 2QM8A 1GFIA 1F2TA 4IOLA 1OIWA 1Z2CA 5CIWA 1Z6TA 4A15A 5LBIA 5LD2C 4TLAA 4DLUA 4A2WA 4IEIA 1SULA 3U3RA 1CBUA 1CLUA 1E2HA 3NBFA 5AUPB 4NCKA 3AF2A 1G1MA 2ZSDA 1NG9A 4I1UA 4TL9A 4DRZA 4QFMA 2VSXA 2EYUA 1NIPA 1NN1A 5JI2E 1SVLA 1L4UA 121PA 4AKEA 5JHHB 1TEXA 4RCYA 2ZR0A 5AUNB 1N6KA 1P6XA 3RABA 1E1RA 5DI3B 4GOXA 4X8LA 3RRNA 3ZGXA 2J87A 4KVGA 5FH9A 4F4JA 3BFKA 1W4BA 3I92A 1MO6A 1UF9A 3BWDD 4LHYA 2OM2A 4DUGA 3EIQA 5DHAA 4KFTA 1K5DA 4M2LA 1OJLA 1SHZA 1WE2A 2F3RA 1KJZA 5IRCD 1GIAA 4JLBA 1DBSA 4E22A 1KMQA 2C95A 2UKDA 3QENA 4KYUA 4OBEA 3A1SA 1UADA 3IEUA 2A7QA 3EC2A 4I4LA 1Z0DA 1Q44A 1XTSA 1C1YA 2XNDD 3TW8B 4A36A 3L0OA 3I5XA 4Q4LA 3MAAC 4YMWA 1S3GA 4MKFA 3PXGA 4DDUA 1XPRA 1E2LA 3R20A 4NPHA 1KDPA 4FCVA 3EZFA 3TNFA 3B85A 4B75A 5IT5A 4NDZA 2IBMA 4GMXA 4DCNA 1U98A 4X8OA 1OE0A 2XB2A 1KI6B 3HDTA 4RZUA 4WZBE 3VNUA 2CVHA 4G1UC 4PC2A 5JEDA 4LPSA 2ZJAA 3X1WA 2PLRA 2Z4RA 2GKSA 5FTKA 1GILA 2GCNA 3A4MA 3KB1A 4Y0AA 3NH6A 1MKYA 3FPAA 1EGAA 3OIYA 2FGJA 2YYZA 2ZI7A 4D6PA 2ZAMA 1W0KA 3KJGA 4P0TA 4JLAA 3G0HA 2CJWB 1TF5A 2OLKA 2VPPA 3CRQA 3FE2A 2FA9A 1CJMA 3RRZA 1Z08A 2WV9A 5GADl 1OXSC 2BBWA 2VHUA 1OH8A 2I1VB 3TGPA 1XJCA 3LBNA 2C9CA 2O0KA 1C4OA 3CF0A 3THYA 1GP2A 1TUEA 1VIYA 2C96A 3C7KA 5L3VA 2ZQ5A 5AK0A 1OYYA 2QAGC 3IDQA 2PZFA 1FQJA 3U7FB 4QXAA 1II9A 2FOLA 2FEMA 1QVAA 4MDFA 1E99A 4TMVA 2PZEA 3EWAA 2V9PA 1KDRA 2EU8A 2GESA 5D3QA 5FPSA 5F9HA 4AK9A 1JALA 4QC2A 1U2RA 4RCZA 4G0NA 4UJ3A 4P4SA 2KI5A 4NCIA 4IVPA 1Z06A 3FDIA 1TADA 2ZPTX 1CF4A 2CMKA 3MUFA 3OFNA 3BD9A 1N0WA 2FZ4A 3KJHA 4GOJA 4BECA 5AUQA 621PA 1XFAA 3PUYA 2VLIA 2P5SA 6Q21A 5KDLA 1AIPA 3ECCA 1JPJA 1OXTA 2NOAA 2WJVA 2CEAA 1OIXA 1KK0A 4DT1B 5BYKA 1T9HA 4D4LA 4PR0A 2AD5A 1HYQA 2CE2X 4OKSA 4HB0A 2QROA 1DS6A 2OXRA 2FE4A 3GLIB 3GJ6A 4TQUS 5FBVB 1FL9A 1ELOA 2AK2A 3RANA 3AKCA 4W5WA 4IKEA 5DO9A 3KQNA 1E2PA 2HCBA 2J0SA 2Z6VA 3K0CC 3T5DA 5CM8B 4A2PA 3WMFA 1U94A 2ODNA 3AVXA 4I1VA 3IIMA 2QTFA 1XMVA 3KUDA 5JJLA 4A8JB 5FOXA 5E7JA 3BE4A 2EFDB 2QZ4A 4C7OA 1J8MF 4MQBA 1CR4A 1G7TA 1I4DD 1NMYA 3O8CA 4PPNA 2O8BA 2FU5C 2O8EA 3KQUA 5EE9A 2R2AA 3LD9A 2H1LA 2D7CA 4PO1A 1GZSA 3L43A 4E5UA 3CM0A 3VKHA 2F6RA 4MYHA 2D7DA 2WAXA 4LUCA 1ZU4A 3SNHA 2H16A 3FHTA 1ZUHA 2JLSA 1Z0KA 4ITRC 2VP4A 1E94E 1XD2A 2WM9B 3K9LA 3LX8A 4B6EA 1X86B 4MRPA 2GNOA 1QHXA 1ZMXA 4I1OA 2O0JA 2J0VA 3KFXA 5EXSA 1T0JB 1XD8A 8OHMA 1ZCAA 4ASUA 4HUTA 5H8WA 1E2KA 1CR0A 1FNNA 1OKKD 2EFCB 4Q1DA 2WJIA 1COWD 4TTRA 3GLHA 3PENA 1QHYA 3SJAA 4PSVA 1DOAA 1N6RA 2RGBA 1CR1A 1D8TA 1R5BA 3TW4A 4EPRA 1OFUX 4M1YA 2X77A 4G01B 5KNCA 3I5YA 5ANRB 2WSSD 4AYWA 1AA9A 4KO8A 4URVR 1LS1A 4AURA 4LJ7A 3VAAA 1VIAA 3TVTA 5DN6A 1RZ3A 5JCPA 2O8DA 3QJYA 3ZD6A 1XJ0A 4NYIQ 421PA 2PMKA 1Z29A 1RJ9B 4KV9A 2V6IA 1RYHA 3CPEA 3IEVA 4L15A 2GXAA 3WMEA 1JNYA 2QPOA 3KKMA 1KI1A 1Z0JA 2F1HA 2D74A 2YWGA 4Q9LA 3B6EA 2DY1A 2V4ZA 1IBRA 5KYKA 2XZOA 2HV8A 4JT2A 3KUCA 1VKJA 3BIFA 1E2MA 1Z83A 2NZJA 4OI4A 1RE0A 2P6RA 1XPOA 3KXLA 1WMSA 3K9GA 3K0EA 2HJGA 3BH6A 4ILEA 2ZJ8A 5BQ5A 5FFMA 1P7CA 4BLTA 5C18A 1SXJB 4GMDA 1XF9A 3BH7A 3U61B 3CF2A 4NZYA 1NP6A 4B33A 4MA4A 2WWWA 4OK5A 4FXPA 3LW8A 5JJKA 2ORIA 1M1YE 1MR3F 2GF0A 3GLIE 1FNMA 2Q9AA 1KNXA 2AFIE 2GAAA 5CB8A 2FGKA 2LCFA 4C4PA 4L4UA 4G5GA 3LLMA 1XTKA 5IHPA 2ZR9A 4JVNA 3S1AA 4ZIRA 2D2FA
chains in the Genus database with same CATH superfamily
4DV6B 5DNDA 5A4AA 4HEJA 1Z4LA 2W2KB 1IVSA 4HNUA 3MJSA 3QWFA 4LZOA 4BFCA 4CMEC 1A72A 2AK3A 3WL6A 4W9RA 1F8YA 4GO1A 3A70A 1WNFA 4CTMA 5J2TA 1L7QA 5DBOA 3B6ZA 4ROTA 4P31A 4GP9A 3PITA 4WY5A 1B93A 3OUZA 4NOMA 4EI8A 5DBGA 1WVGA 4IQGA 1PEYA 4R9VA 3WDMA 1Y63A 3OQIA 1S1CA 4YIKA 4CZ2A 3B78A 2O8DB 5J2TB 1N2XA 3SZMA 3C85A 1WXEA 2PGNA 2JAUA 3NEJA 1NLZA 2OD9A 1ZINA 2WG1A 3MXOA 4UFPA 1Y5MA 2ZBPA 4GS5A 4C29A 2JCYA 2D5LA 4FGSA 3WIVA 4DUPA 1Z0AA 1DXOA 2HJSA 4X45A 2BFCB 1BGWA 1XEWY 3OTWA 2POCA 2OSBA 3DQZA 1AX9A 1PW7A 3PUVA 1XUOA 3L4BC 1H2BA 3K9NA 5FT9A 1C3LA 3AEYA 1XNGA 5HIMA 4DW8A 4G85A 1I33A 4E4YA 1SXQA 1RWQA 2VHJA 1ZGZA 2HWXA 2VJPA 3TFQA 4DJ5X 4RULA 4BWGA 1O96A 2C00A 4Z1OA 4N6GA 2R8XA 1XYYA 3C15C 3VU9B 1ZOPA 3AVWA 3PICA 5F52A 4CGZA 1MMFB 2J3EA 1SUWA 1BVUA 1EAMA 3BL6A 3HBFA 2D5AA 5B2FA 3P19A 4MCAA 3OTIA 4W7HA 4KN9S 3SZLA 2KSQA 1ZGAA 1XCMA 1OD6A 1KP3A 3OLZA 3GDFA 2QRKA 3GELA 3IBCA 3KD2A 4QDXA 3D81A 4U02A 1V25A 3IO3A 5L6MB 3I83A 1GADO 1JXOA 3GYGA 4DSOA 4EZEA 5IABA 3DKVA 3DUFB 2QLTA 3IJEB 4G5XA 2EBUA 1QC5A 2PR7A 2Z98A 4KZKA 4ZOLF 1KS2A 3OFKA 1GAXA 2CXSA 2C9OA 3HUTA 3RWBA 1PX0A 3RWMB 1I4OA 2IDKA 4XB6B 5EKUA 4U0JA 2Z08A 2DOKA 3RFVA 1Z5UA 1OU4A 1I1HA 1HRKA 2HRRA 4MARA 5JLJA 5ELXA 1JFLA 1GG8A 2ZAYA 3IXLA 3EVBA 2VAMA 5F21A 1QR6A 5J40A 1XQYA 1HFJA 3AW9A 3N7TA 2RGYA 5KQRA 1E0JA 1KHTA 2RH9B 3EZGA 3GC6A 4AP9A 4DLNA 3ADOA 4M1WA 3A4IA 1JHRA 1JP7A 1L4NA 5T8KA 3V97A 1NVMB 1T5IA 2RAPA 3FCEA 4RZIA 2IYVA 2BZGA 5CDHA 4B73A 2PYDA 3B9QA 3G3EA 4M0DA 5HJ7A 2B4QA 3W6PA 2Y76A 2TECE 1YBMA 1U28C 1CQZA 3A25A 4LQ4A 1J0BA 4QREA 4YK7A 3CUUA 4KE9A 5KBYA 5ICSA 2FK8A 3EMKA 4NK5A 3URMA 4EY7A 2AT1A 3LVRE 4TRMA 1WHSB 2GTPA 3IUMA 4JLMA 1ZGGA 3HCBA 1FX1A 2B25A 2GOYA 1T8PA 2H2WA 5LCXA 3O1IC 3RIMA 3T61A 5C0OE 5K8TA 1G4AE 2REQA 5B1HA 4EELA 3E9MA 1VMDA 2ACKA 4MUGA 4GPBA 4CCAA 1F4PA 5D00A 4ER6A 6LDHA 4L5BA 4LOLA 2A9KA 2CLIB 1V8BA 2NPIA 3VOSA 3AIIA 3QVUA 4I9NA 4I6EA 3JARB 1T3LA 3RFCA 3ES9A 5KQLA 5DWVA 1D2MA 4RH0A 5K6RA 5JATA 3CVOA 1KO8A 1PQUA 3PT5A 4MWDA 2EEZA 4EPTA 3MK31 3W5SA 5FFNA 4AL4A 3F6SA 1AKVA 4OHXA 2HU7A 3A4LA 1J0DA 2UZ1B 1OAOC 2C3MA 3VSEA 4ENRA 1PYOA 1YDFA 4LFBB 2QPAA 1Q92A 1VHQA 1RP1A 4O8CA 4BX0A 1WV1A 3CZAA 2B82A 3OZIA 4I5EA 5AKZA 5EWMA 4BC1A 1U3DA 1QG4A 2Q6TA 1R10A 2HREA 3DPSA 4MV3A 3WA6A 3WAJA 5LM3A 3WZ2A 2AW3A 1S2LA 4N0PA 2XA2A 3O4GA 2NSJA 2CV0A 3FYUC 4H35A 1QM5A 3FNFA 5ISMA 1WLSA 3WV4A 2XBMA 2QQEA 3DFMA 5KNBH 3BRWA 5FWDA 4U2FA 2OCGA 4K28A 1JH9A 3R7AA 3REFA 4B6JA 3BTOA 1OH6A 5I6DA 1CE8A 5HPYB 3QBEA 5AVYA 2YWEA 3HR4A 4I4TF 4CLRB 4PLGA 1PUXA 1E18A 2UVDA 3FLEA 3GEHA 3IVRA 4R7ZA 4DR4B 1LK0A 4RPLA 4UNQA 4HAZA 1KZ6A 4WXPA 5K09A 1VE3A 1JXQA 1KK1A 3JQRA 4YRAA 2VDUE 4LCJA 4W1PA 4E2FA 1UC5B 4JLNA 4JP8A 4TXNA 2XUZA 5A71A 1XEFA 3TDKA 5AQ1A 5IYZF 5JJBA 2JEOA 3RG2A 3VR1A 4XW2A 2IC5A 1UM8A 4J7XA 3GBPA 4JX9A 1QUEA 4X6YA 1T26A 4R2JA 2IY7A 1Q95A 3M1LA 3UV6A 2JLQA 1UWKA 2ZBEA 1UT6A 1T6NA 1YVRA 5DEOA 2C4VA 4LIPD 2D1YA 2ZYWX 1OFGA 2O07A 1W47A 4TRJA 5G0VA 1BD4A 3HXMA 3KB6A 5ICGA 2BF4A 5CDGA 1G5HA 3NHAA 2YJ3A 3GGOA 1AS0A 3PNQA 5LA6B 3OM9A 1Y8RB 3AF5A 4I9FA 1GU1A 2AG0A 2ERXA 2OV2A 3AEUA 1RPJA 3DB2A 4HQNA 3SJCA 3ASVA 4RKQA 1Z38A 2NUTB 1RAFA 3ESAA 1US8B 1P2GA 4MRVA 4BIIA 1EXNA 4F06A 3CZ5A 1YC2A 1G6KA 3RAGA 1P39A 2PZBA 4WJLA 3H9UA 5K6AA 3OFSA 4OY3A 2PVPA 4YAOA 3WL7A 2IDJA 3EVCA 3NHWA 2PUWA 3QNUA 4MLPA 1CQXA 1X1DA 2V5VA 3NW9A 3ZZ0A 1C80A 2AWNA 2W98A 3GVPA 4JSRA 3WRWA 4DM3A 2WWFA 1YBVA 1GUFA 4JELA 5GONB 4ITUA 1RSZA 5ELMA 4K46A 4AF7A 1X1CA 5HKAA 5DNYB 3T06B 2PZAA 3D3JA 3PRJA 3GY0A 3ZJTA 2VRWA 5J4LA 3KPVA 3DAYA 3GDGA 3D1LA 2BFFA 2VSNA 4PN7A 3LFHA 2I91A 4X3PA 4JXZA 5CA0B 4PEVA 2AUTA 1ML4A 2Q6VA 2EX4A 1GZHB 5FEUA 1QOQB 5BQOA 2XEDA 2A9RA 1D4OA 3BHIA 3LYAA 3ANXA 3FI9A 1V9CA 3NX4A 4H6VA 4W5HA 4ZI7B 3WNVA 1F8GA 3KQKA 2AFIA 4RETA 3MT7A 4DLTA 1OGYA 1IXYA 1KY5A 2F64A 4ZVQA 2JCVA 2JHPA 3QPCA 4HG2A 1ESEA 3DDCA 3U7EB 4M1OA 4YLYA 5A62A 3IGFA 1LEHA 1XALA 5EINA 2PRIA 3GW8A 3N86A 1J49A 4BX8A 2DETA 3KQSA 3L6DA 4S1NA 1P5JA 1OBCA 3G6KA 5KNDH 3ED1A 2AVNA 1AURA 1E9CA 1L5QA 3GA5A 3R2JA 2DLDA 4OXNA 4UUAA 4AJIA 4RFSA 4AROA 4XYLA 3RC3A 4X94A 1XK7A 2FZ5A 4CMEA 4GHWA 4DV0B 3ZQ6A 1E8DA 1S7GA 1B6SA 1WM1A 1VL2A 1GZ7A 1U3VA 2D4HA 3HJNA 1AXEA 1ZPDA 4LOIA 5FBHA 3EARA 4MEBA 3TFWA 2FI1A 1GXSA 3EGIA 4MWZA 1CZUA 3CXRA 4MMZB 4D42A 1ZMTA 4HBGA 3ZV5A 1FLAA 1KI6A 1UM9B 3ROEA 3V4RA 3ZDDA 4HXFB 4C2TA 4J7UA 4JVSB 5BWNA 2X4GA 1DAHA 2HU5A 2ZT5A 5CLIA 4DHWA 4BEBA 2B9VA 3R0XA 1C4WA 1BVHA 1SVOA 5GONF 4ERXA 4KPUA 5F9FA 5GIOE 4QQFA 1E77A 2YN0A 3I9JA 4CDRA 2C9YA 1JQEA 2WJHA 4TV9F 2VKQA 4RVHA 4CEIA 4KTTE 3WISA 2KE5A 3HKCA 1DCKA 3OKAA 3BRCA 1C0KA 5DCWA 3CX8A 2FR1A 4O4JF 3KPUA 5IT4A 1GTSA 2B8WA 3TR0A 2O57A 4L08A 4HNGA 4P3YA 2IXEA 4RYLA 2YS7A 1I7DA 4CNQA 3U3DA 2WPDD 3ZYZA 4W9MC 1SD1A 2GLTA 4J0DA 2WT9A 2C5BA 3DO6A 2Q07A 1ULTA 3PVCA 4MMXB 1R0KA 3D02A 2Q1SA 2ZT8A 1Q0LA 1YFZA 1SC3A 2DGDA 2ZPAA 3HCFA 3MWDA 2OQIA 1BE1A 4EA6A 4EHHA 1HGXA 4RTJA 2QR3A 3A06A 3GFBA 3OPVA 4FCTA 4LHWA 1N1EA 4D9KA 4R5HA 3EPHA 1UXKA 2HBQA 2AX4A 3ELWA 3FPSA 2HA5A 2JEZA 3MJTA 5JNRA 5I9NA 1W9MA 5JC1A 3N0TA 3B6IA 5DKFA 1K68A 4X92A 1TXGA 1TX4B 3KQLA 2XUDA 2DQZA 4ZOEA 3B53X 5CK4A 3JW8A 3AP3A 4CF7A 3QJ5A 4DM4A 2EEPA 2FMTA 2QL6A 2O23A 2LZ0A 1WZEA 4N0DA 1YUMA 3FVWA 3NKFA 4ZRNA 4BN5A 4EY3A 4ML3A 1WCV1 1V41E 4F2PA 1T6ZA 3WYFA 1U9CA 3C1AA 2M1XA 1RRVA 1Z35A 2QGZA 3CRZA 3E18A 2IITA 4NY1A 4TQAA 4BLRA 4HP8A 5ITWA 2HK8A 1ZAYA 2FG6C 1WEHA 1QQ6A 4EGCB 5B1EA 3ETDA 3NC0C 3A05A 1C2YA 4G4IA 2Y1FA 1VYHA 3NWBA 2ZRKA 5AW6A 4LNUB 1YOVB 3WGNA 5K2MA 3WWEA 4L95C 4RO0A 1P62B 4D8TA 1GT91 2JGEA 2QL7A 1KSHA 2W43A 3CW8X 4XPZA 4YMSA 1DQYA 4MW4A 1W0CA 2QU7A 5BMVB 5KYNA 2CYAA 4NG5A 5AVKA 3VH2A 1JDBB 4BNFA 4WA8A 3QKRB 1R3UA 1V11A 2ZIUB 1WB9A 2WB4A 3WA7A 4HQ0A 4JI2B 2DUWA 4R8SA 1SUEA 5ALEA 1ZN9A 5HNKA 3AR5A 1Y3HA 3ESBA 3F98A 3PQ7A 3D7KA 4LRXA 1EVLA 1PZMA 3PFIA 4Y1FA 3CE6A 5K20A 1ILEA 1MO3A 1I6LA 2RGAA 2XGMA 4Z9AA 2BC9A 4EK9A 1NNEA 5ESXA 4UASA 1WAMA 3E5MA 2RH4A 5ALFA 2GB4A 3DYIA 1FDWA 1P1JA 1TGVA 2OA0A 3UOGA 4HH4A 3V4OA 1UAYA 1LTHR 1CY4A 1K0FA 1MT0A 3EA0A 3P5BA 3PL1A 4U8GA 5K0ZA 1X39A 1SVWA 3ETEA 1FXSA 4MQLA 1AA6A 4LJLA 4X24A 1IY8A 3QU7A 4RXTA 4L02A 1DHTA 3PYLA 1DEKA 2AFIB 1E62A 1UZNA 4LI0A 2G04A 2VS1A 4AJKA 1SHUX 3DE3X 3ILXA 1JA1A 4JP3A 5TQ0A 5DSZA 1CLEA 1RC1A 3I05A 4Q9IA 1DCFA 2VEDA 4J2HA 4JUAA 1YZQA 2BBOA 3MS4A 2RB4A 3CT4A 2DFDA 2CUZA 2R7NA 4FE7A 1DIHA 1L7XA 5LMNB 1ACJA 1MB2A 1HT1E 1IHUA 1CDOA 1E9EA 2PZJA 3AHGA 2P68A 4RLQA 1YJ8A 3LDAA 1W6RA 5E1OA 4XDYA 5TS2A 4AJHA 3HU1A 4B6SA 4L1KA 2JIOA 1Z82A 2Q1XA 4CM9D 4GLFA 5E0OA 1EESA 1SQ6A 2Q5QA 3EEQA 3JSAA 1G55A 3OPYI 1RR6A 1ZCFA 1ISRA 1N1MA 2QLJA 3FZEA 5CHYA 4FOSA 3ZPXA 4UE3S 4M7RA 2Z4SA 1XN1A 3AQIA 3H2BA 4LYEA 1G20E 1FP6A 3IUJA 3P9SA 4H2DA 1QIGA 4E2XA 3I12A 1RKBA 4CU5A 1KR2A 1KVSA 2YZ2A 1PVOA 3FIJA 1N5JA 2VA9A 2ZITA 3CJTA 2OORA 1XOIA 2XE4A 3IPCA 1BDBA 4PG7A 4LSGA 2H4FA 4TZ6A 1YHZA 4UJ5A 3BM5A 1ZNZA 2XEXA 5EIXA 1QTIA 4Q3AA 2O2SA 4WADA 3N0WA 5FADA 1E3SA 5JMWA 4ONEA 1PNOA 3ZCVA 3E7XA 4OXQA 2LCIA 1JLLA 2XWPA 3IBYA 2NT3A 3VPBA 1ZISA 2VG8A 2WR8A 2EF0A 3K0HA 3PTZA 4RE6A 3OHSX 1HOXA 2O4UX 5BNTA 3VZPA 2XCSB 1T9DA 5FLYA 2RKBA 4ISCA 3DHVA 1J22A 1GNTA 3EIOA 1DUIA 2P5UA 1SK9A 2FKNA 2R2GA 4RS3A 2QSUA 4OHMA 2BWJA 1O4VA 1TW3A 2GN4A 3P2EA 4CLXA 1ZH0A 2O2GA 2GK6A 5CDUA 3O83A 1B00A 1VCIA 2F7SA 3OJCA 4QAJA 2I2WA 1H8ED 2ID7A 3CX3A 5EVCA 5EWJA 3ND8A 3A6LA 4BNXA 4D0LB 4CXMA 1QJCA 3FSGD 4BYGA 1C7JA 3HM9A 3JR3A 2FCAA 3LYLA 4RQAA 1MIHA 3LO8A 1INLA 3R8CA 2ZAGA 4QPJC 4W9NA 1GTVA 4D0SA 1P2VA 2NZYA 1IUPA 3NVDA 2J5KA 4OSEA 2QMUA 3JQFC 5LXTB 1DT3A 4X64B 1N2GA 1VLQA 4B87A 2ZJ1A 4J0CA 2LV8A 2R6ZA 3OZXA 2YWCA 4AMVA 4QU0A 2MINA 2ZWPA 4XQ9A 3KJXA 3F3YA 3UZUA 4A8PA 2C2HA 4P58A 5TXGA 3UMGA 4RK5A 3LCUA 3DEKA 4EB8A 2P4QA 2QA5A 2QUJA 1TLFA 4I19A 1VXRA 4WESA 4CTKA 5AW7A 2PUDA 2C5HA 3G6WA 1GUYA 1I3LA 3I9FA 4MGYR 1Q1AA 2SKEA 1L8OA 1T2NA 2WYUA 4MV7A 5DHTA 3R74A 2R5WA 1E2BA 4MV8A 1IIBA 4YJDA 5FORA 5CIYA 2DXIA 4DXDA 2XTAA 4M4SA 2IH5A 5ALSA 4EA8A 3C8MA 4QEZA 5JC8A 5A4FS 5JS8A 5CB4F 4A2QA 3OHPA 4EVIA 4EYOA 3BORA 3DLTA 4CUJA 3GGDA 2JLWA 4R2MA 1FLDA 3PPYA 4DJFC 1Z12A 3DE1X 1DLIA 5DBIA 1JQBA 3AWIA 5BWOA 1ZRMA 2I6UA 1A8SA 2GPBA 3EULA 1E2IA 1T3HA 5EPOA 3KU4A 3ILYA 1T15A 3OF5A 1CVLA 1IDN1 3C5EA 4MEAA 4YDRA 1M0EA 4TZ0A 1O5OA 2Q29A 5J1TB 4KR6A 2BFDB 3G82C 3C45A 1A97A 1TEVA 3EXEA 3USZA 4AKHA 3MHPA 5EZQA 2M2IA 1U0LA 4MIEA 3UANA 3NUGA 3THRA 4AJJA 3KWMA 2IOHA 3ZDQA 2X7JA 4YMTA 1ZK0A 4J0GA 1MRNA 1PNVA 3L2OB 4WXRA 2A5DA 3RIEA 4KGZA 1T36B 1JEEA 3GRVA 3T1VA 1H3EA 4IXTA 3RTGA 4NXNB 1GZVA 2ROQA 3WHPA 2ZJBA 2JH9A 3MCZA 3PFHA 2Q4DA 1JSCA 1VCNA 3O8LA 5D5QA 3DMDA 1GRQA 1HRDA 5T41A 3ZKWB 3RBZA 3T3MB 3V8BA 5IUKC 4WEOA 3RVRA 3NHBA 3V1KA 4LJ8A 2O1WA 1C7QA 2JFUA 2YXPX 2OGWA 2ORWA 3M3PA 4QLBA 1D2EA 4G0XA 4OFWA 2VZLA 1I3MA 4K1XA 5EE5B 5EY5B 1FC0A 5KWEA 1UZLA 2DH6A 1U5CA 3CG0A 2QB5A 2FWAA 1K89A 4HWSA 3PQFA 2XODA 4BKUA 2WF7A 2J4CA 2Z9BA 3ZY6A 1Y3BE 1V48A 3OICA 4KKXB 4DQKA 4M98A 1GKYA 1ULSA 2NIPA 1XU9A 3EVEA 4Q1BA 4ZT2A 1JIVA 1T5LA 2NZ2A 1VKHA 5A4KA 1QO0D 2OQVA 4EB6A 4D25A 4LYFA 2X19A 3QX8A 3AFMA 3IMGA 3ZCQA 3ZYCA 1AQYA 1NI5A 3FBGA 5AVOA 5HMMA 4XQCA 3ITEA 4V3BA 1ZMOA 1Z39A 4IQ0A 3WFJA 5BY2A 2OLEA 2IE8A 1MDBA 5LOVB 1JHVA 3WL8A 2CK3A 3F3KA 3OCXA 3KHSA 3WLOA 3KTAB 3AM3A 1XQVA 4PLZA 2M6LA 4KCGA 2PU5A 2R6GA 4KV7A 2FPOA 1T6XA 1U4OA 4DNOA 1EFVA 2WZQA 5B1IA 3A31A 1K27A 3GRKA 1CJSA 3MWKA 1Y1KE 1L5OA 1QF7A 1TKCA 2DT5A 2VJLA 3HYSA 3IESA 5AIBA 3G8YA 5HKLA 3M81A 1Q7BA 1JQDA 3WGYA 4A6XA 4D8UA 1KE2A 3GJZA 5I9MA 3B3FA 1DQSA 1DJMA 3H2YA 2O8FB 3OECA 1QZTA 1Z36A 3KUKA 4IMPA 4MGZR 3HI6A 1VDZA 2B1IA 3QWHA 4Y2YA 1BS1A 3SR3A 2H07A 5IH3A 4LDZA 4G4GA 4MGKR 4BNUA 3LFUA 1Q83A 4KQJA 1EXVA 2DFKB 3ORHA 4PS1A 3FCSB 3RDPA 2AG1A 3KX2A 5L4NA 2OHHA 4MQUA 1W35A 3N2KB 1H23A 1WDLA 3RTBA 2OHFA 5FPKA 1KI3A 1NQVA 1JKJB 2H4YA 3P9CA 1FUKA 4UARA 4C3UA 3OTGA 5BQ3A 2JHFA 3LP6A 3H5IA 3K09A 2PO7A 3QWAA 4IILA 3QUCA 4BLSA 4D44A 2VJDA 3W9SA 2QUKA 4MW0A 5KHOC 1B43A 1KH2A 1NKVA 2HCJB 5G0TA 1Z37A 1G5IA 3BWMA 2GAOA 4RC9A 5CIQA 1GQRA 3OZTA 1GZ3A 4RVGA 4FWIB 4H60A 4OD0A 1TMKA 3G13A 5DRYA 3C98A 2F55A 1QF6A 4H7DA 2PBZA 2VPIA 1IRIA 3QIVA 4X60A 5I4CA 6ADHA 4CEHB 4AY2A 3BZBA 3GLRA 3HPRA 3KYBA 4QYXA 4G0WA 2W11A 3CLHA 5FL3A 3NWOA 1CF2O 2PWBA 1UMBA 1FTQA 5DW3A 5BW6B 5KQGA 3FNHA 1RAIA 4QU8A 4OGGA 2FJUA 2I76A 3N2ZB 1RWXA 1Y82A 1GN9A 2I5PO 4ZOCA 1DQRA 4WCDA 2X9GA 4OPMA 3VPFA 1K08A 2XX3A 2ZRPA 3HYLA 4UCWA 1VBKA 4FCCA 3EMVA 3PQ3A 3D5QA 2JRLA 2XZPA 3KK0A 4HRAA 5LZ7A 1UC8A 3WLLA 1EZZA 1TU4A 2BFFB 3N8KA 4B7ZA 3I9LA 4GPIB 4J0QA 2WPDA 1BEZA 4ZJUA 4AXBA 4C4YA 5ULLA 2AKAB 3WIOA 2A1UA 5IRCD 1YI1A 2ZIXA 3FWHA 4DA9A 5K8LA 4RV9A 2WM8A 5ESWA 2Y68A 1P2FA 2O8FA 4XX0B 2DPYA 2C3PA 3AERB 4G5YA 4RAOA 2GYYA 4F4HA 4F4IA 1ORHA 1E6UA 1ZD8A 4EPXA 4EQZA 3KSZO 3DT6A 3G5UA 4ZQHA 1M72A 2EKQA 1VSVA 2ZTLA 4Y1RB 2P65A 2BDEA 4YR7A 5A0FA 3QX9A 4ERNA 4M8LA 1UKVY 2AN1A 3LM8A 3OD1A 5KHAA 1TYDE 4RZ3A 2Q4EA 4BLUA 3F3MA 2JFBA 4KGVA 1VECA 1XMIA 3KDAA 3HWRA 3LUCA 4HWPA 4AMYA 5H5JA 4G0QA 1V3TA 1Y5LA 1OLXB 1HTTA 2CXUA 4RY2A 5AKLA 4YIHA 2ZJ6A 4Z9XA 1T2UA 1FY2A 1RD4A 2CUNA 3CSDA 3UK2A 2E87A 1IJBA 3B6KA 4JH0A 1K5GA 4N0EA 2P11A 1E32A 1W88B 3F6PA 3T3DA 2I54A 1DO2A 1W85A 2QUAA 4LMAA 1TRKA 2CB0A 3A58B 5FPTA 4ZYZA 5FI0B 2ZRBA 2B1JA 1P0QA 1PLLA 2H7YA 1L1EA 2FZVA 1TU3A 4UBKA 4MLZA 4UHKA 3D7RA 3OM8A 1V2GA 2NW6A 3TN7A 2B8EA 4HRVA 1GPWB 1JKFA 2QVYX 2PD6A 1O6FA 3AEQB 3GBSA 3KRTA 2VNKA 1P4JA 4HATA 1KIMA 5K3FA 2GXQA 1HDZA 4OA5A 3UWPA 2HBRA 1A9RA 4M9XA 1KAMA 4HHEA 1C9YA 2HGSA 1CWUA 2IE0A 3KE8A 4M9SA 4ZMRA 4MYSA 4LSMA 3T9CA 1ZJZA 1YCDA 3JQ8A 4EG4A 4BDSA 2C4WA 3MM4A 2FLWA 1IONA 5KKNB 1ODFA 4PG8A 2YX1A 5JECA 4RTNA 1SKAA 3I1FA 4UBLA 5IBRA 2Z2IA 4L5JA 1WF6A 2JAQA 3FKSD 4FUQA 2J59A 5BSHA 2XOEA 1NF2A 4A91A 5I7RA 2AZXA 1GV1A 4G23A 2E18A 2BAGA 1VP9A 1LLDA 3AH8A 3WAKA 3ZU5A 4B4OA 3SDBA 1DEHA 3KKQA 3UT5A 4NPAA 1I6MA 1RWWA 1QDLB 1WQ1R 2D06A 2GRUA 2PGLA 1UDBA 2ZEJA 3NALA 3OCWA 3ORSA 1U0SY 3LUKA 4ZZ3A 3D2CA 3IX7A 4PFJA 3VTAA 1ISFA 2ZWMA 3CR8A 4BB0A 2AJ8A 3WHLA 4TUYB 1MDFA 3I4LA 1NRWA 4WVLA 1N78A 4BNDB 3O4FA 4BNHA 4HLCA 2GEDA 4OFBA 2VHZA 4BRWA 4TVOA 1E9DA 3A04A 3PWTA 4YRCA 3A14A 1IQPA 1MO4A 1XDZA 3ZIUA 5KX5A 1Q6ZA 1JMVA 3X1YA 3D7MA 2FUG6 3FPHA 1P33A 4PXAA 2NUTA 1YE8A 1E59A 3PV0A 1RXIA 4HMQA 4P5EA 4YGXB 3KOWA 5JBNA 3V4ZA 1M6HA 2J5RA 1P3JA 4MVJP 5HDBB 1DAGA 2Y99A 2H51A 4FYKA 3VOAA 2CHVA 2IHBA 3D3KA 4WCFA 4GQIA 1RHUA 1PBNA 2ZUDA 2R6AA 2F1KA 3D8BA 4HADA 4LOHA 4UU8A 5FYDA 5JS7A 1OX4B 1PD0A 3B20A 1J9EA 4KR3A 2XYPA 5H82A 3ZC3A 1OX6A 1XQ1A 2JA1A 2R3SA 4XJXA 3BFPA 4O63O 4IDNA 2FQQA 2D59A 4H0NA 4BBPA 5FX2A 2Q8PA 1WS6A 4XM2A 3NTUA 5CW2A 4B5KA 3RVSA 4QIHA 2DR2A 5IC4A 5GINE 3G2HA 4DSUA 4ZODA 4J3NA 1A98A 1JA0A 2F8LA 2XF8A 2V7WA 3PYMA 4NJMA 4ZI5A 2ZE5A 3X1ZA 1I3OA 3GCDA 5C1OA 5CAEA 5F76A 4E6EA 2A59A 3REGA 1BCSA 2C2GA 5LP6B 4KRFA 2EQAA 4YFYA 3GDHA 1EDZA 1XEXB 3PQCA 1HO3A 4KXWA 4ZEWA 2A9OA 3RREA 3HRHA 4K40A 3WC4A 1F48A 3B1VA 4K9PA 1NPYA 1TUIA 4N3CA 1CB7A 1AKYA 1IBSA 3NHZA 3A32A 4O4JB 4Z3KA 2HR1A 1YTUA 5CDTA 1HLFA 3JTEA 4IDQA 3UNXA 1A9XA 2QRNA 3C4JA 5JBIA 2B83A 5JCJD 2COKA 3TPZA 1RLMA 3FZNA 4LPKA 4X91A 1NW6A 2N1BA 3RAJA 1JQKA 2GK7A 4XWWA 1ENOA 3TLXA 3A4TA 2ANBA 5F7ZA 2FYTA 2HEIA 2RAVA 1J9GA 4FSHA 3SJ7A 2VWHA 2G70A 2BOVA 5DP1A 3FNBA 3H2KA 1DOZA 2ATIA 3KT8A 2VR1A 2PQ2A 1B76A 1NDHA 1GR1A 2OZKA 2VDMB 3NWJA 3T9EA 2VXOA 2OGUA 2DBRA 4P38A 1UBSB 4L16A 3A6DA 1XMQB 3AP2A 3GRCA 3Q3JB 2ZYSA 4I1RA 1T35A 5ITZB 3Q7QA 5PGMA 4YR9A 5EWLB 2X1VA 4G2NA 1E2DA 1NUSA 3EIUA 3IVMA 4BO4A 3IODA 3FB1A 2BMDA 1EBUA 1KOGA 1AQUA 1UR5A 4K26A 2Q5JA 4H6XA 3KSBC 3SDSA 1Z28A 1ZBDA 1OBVA 3QELA 4NV0A 1E6CA 1T9BA 3VKGA 5JNLA 4JT8A 2LP4Y 4CEJB 2OCIA 5K6AC 1JIKA 2C88A 4Z4QA 4YP9A 1U3TA 1VKNA 5LWHA 1YO6A 2W48A 4EATA 3FHCB 4P7KA 4MP3A 4W8HA 3VJLA 3K1AB 3Q8XB 3DBLB 1ES9A 1V95A 4LDAA 5KC8A 4QTZA 3UB3A 4G24A 4BKRA 4Y6OA 2XAUA 4PFKA 2XTZA 2HA7A 4JA2A 1V5WA 2CVPA 3SQWA 1E60A 4I36A 5HF6A 2BJVA 3EBOA 4AF8A 2QT1A 3KZ1E 3BE8A 3J7TA 5SY4A 5A2QA 4ZTBA 3JV7A 4CLOA 3ICCA 2IWHA 4R05A 4CKXA 1BGXT 1RWNA 2WYVA 3JD2A 4IHJF 4KIUA 2XCOA 4HI0E 1WXQA 3I34X 1C7IA 3U26A 3LKBA 4DQDA 1DV2A 3B36A 4FR5A 2FZKA 4IICA 1BO6A 5AJYA 1VI2A 5B7QA 3R8XA 3LBHA 1K5PA 1QGOA 3CEHA 3R3JA 4P9NA 5B7PA 1NBMD 1QFMA 2CLCX 3MYYA 3ASZA 3GARA 5TDHA 2WD8A 4LTNA 1UOEA 3LLSA 4CCYA 1CJUC 4QDKA 4KSCA 1WB5A 3DQPA 3VH3A 3M6MD 4NNOA 2HO4A 2WWIA 3P5SA 1GTZA 2BFBA 2L69A 4GM0A 3LUHA 4MW5A 4TTTS 4YP5A 4B46A 4Q3BA 3QUSA 4G4SO 4OG2A 3UOWA 2CV2A 3DZBA 3A2KA 1PN3A 2ZE6A 1KI2A 2XSZD 2ZUCA 3KLNA 4DG9A 3WGTA 1OI4A 2L82A 3LX4A 4DCMA 4UFNA 3FNEA 3Q0EA 4Q9HA 1LGYA 1JT9A 1USIA 1HI9A 2RJNA 2B1QA 2B9EA 2H9YA 2QN3A 3DEHA 3B7GA 3HMKA 4GLOA 2OV3A 4TV8F 3EGOA 3IQIX 4XVQA 4CKEA 3K32A 4I7EA 1QH8B 1DFIA 1X7YB 1TT5A 4FDMA 4OX9B 1XRSB 2VUSA 1GTJ1 3K96A 1BVRA 4BMSA 1G5PA 4V0RA 4EF4A 4NNJA 5HILA 1GTG1 1PIWA 2A1TR 3GP3A 1T10A 5IULC 4BO7A 3EEFA 1Z2NX 4RTQA 4OFZA 3KTAA 1KQOA 1RPAA 1TJYA 2FX3A 1NLMA 1OI3A 1HC7A 1DAPA 1BJRE 2GCEA 4RBNA 4XPIB 2ZDQA 3SXUB 3ZWDA 4PAQA 2ZJ2A 3ZXIA 5JYBA 1GG2A 1R6TA 3ZUPA 1XNJA 1XL1A 2XZLA 4TLDA 4WY8A 5AW1A 1I5OA 3G2MA 1YV9A 2B69A 3ABIA 1ZH2A 3OIWA 1EA7A 1BH2A 2I2DA 2QM3A 2QNBA 1G5RA 1P9RA 2DHCA 3SHQA 3UM9A 4C0LA 5JBQA 4L9WA 3BC1A 2II6A 1J0EA 4YP6A 4OLAA 2QSYA 2GFQA 1Z0FA 5K51A 4F11A 4PO3X 2QE7A 5HIJA 4N5HX 3SSOA 3A6PC 4HAXA 1BGVA 1Q16A 4QM6A 1U8UA 3ND9A 3WNQA 4BC0A 2XB8A 1C2TA 1KI9A 4OO3A 3FMIA 1DTSA 1R0LA 2C3OA 1PT7A 2ZTVA 1T1IA 3GJSA 4PAGA 3GPCA 5BW8A 2XUFA 3E3OA 3A9WA 3OLXA 5BXQC 2C61A 4LC0A 4RTMA 2PKQO 2QR5A 4DV3B 2BKLA 2C0PA 4AICA 2QY9A 4LXQA 2JGKA 1A82A 1J8DA 1RQXA 1VCHA 3K8YA 3RSGA 3UXMA 2YXDA 4U7WA 3ZTTA 3CNHA 3UGTA 4IO0A 1HZZC 3GT4A 3QM1A 4Z0NA 5DASA 2ST1A 4DIUA 4UM8B 3K9FC 1G63A 1K66A 2ZYVX 1K3FA 4YUZA 1E5QA 5IJ0A 4HZIA 3RNLA 3W5VA 1SAYA 4PYMA 4ZYXA 3OPXA 3C3KA 5CT9A 1ZD9A 5G41A 4ZI3A 5IZ4A 1RC8A 3TJZA 3NRJA 3GU3A 1V6CA 3L1JA 2FN9A 4BNIA 3EH2A 3ZWBA 4D80A 1UM9A 1BWQA 4W5QA 2WWHA 2QMOA 4Q0MA 1IBMB 4WNIA 3STXA 3PVSA 5CYFA 1QH8A 1X7YA 2I62A 3HEBA 1R5NA 1DKOA 3L07A 3A10A 1R12A 1KO1A 2G88A 2DKNA 4L9SA 4IXMA 3TD2A 3TF5A 1YKSA 4E08A 4HDMB 4OIFA 3A27A 1JAHA 5LN1A 4G5QA 3N3BC 2VTBA 3K9HA 1YB2A 4URXR 1V1MA 3C97A 4N49A 1M1NB 2UYOA 2WHEA 1J5EB 4DJJA 3LPAA 2AHOA 2R8OA 2Y05A 4IMJB 1N77A 2G1PA 1H8HD 1BCRA 2H3EA 1BH6A 3AZPA 1NTRA 3HNPA 3BEDA 3HUEA 1IJEA 4MB0A 1WETA 4LMPA 2NG1A 4XIJA 1IK4A 4AJLA 4N03A 1FFAA 1W5SA 1SBZA 2BZSA 4H7EA 4R4JA 4H3SA 1W48A 4R9RA 1L5NA 2ODWA 3GPLA 4OEHA 1RHRA 3L5OA 3F5FA 1B0ZA 4GFDA 3RVBA 1ZO8A 4E51A 2BHSA 2G9VA 1K88A 4E88A 4C03A 4ZPXA 3S44A 4Y2RA 2O2IA 5FR2A 1TC1A 4NZ9A 4MW2A 4DWJA 2WJ3A 2BY4A 2W22A 3E27A 4QO8A 1IY2A 3WFZA 2P6NA 4F38A 3W5DA 2HQSA 2UUCB 1ORWA 3BDVA 1ZEJA 4ICIA 4FB5A 1EGQA 3JQ7A 5CVJA 1OKKA 5T3UA 1Q7CA 5AOCA 2WDPA 4KITB 1IEQA 3WSVA 4ASUD 5K2OA 3N8NA 1TYAE 2Y8EA 3T94A 2OILA 3V32A 3DEAA 4D8VA 3Q5DA 1GCUA 1NJ8A 1YAHA 3B6JA 4GE0A 4H1VA 4WCFC 1W76A 2I80A 3D3WB 1RRCA 2XUOA 4UM9D 1PSDA 3GLHB 4NE2A 1H2AS 4RELA 4HWGA 3HMQA 2NU8A 1I7QB 4CEHA 2VAXA 2ZRIA 2WQ7A 3UJAA 1A1SA 3KBBA 1C4KA 2QTBA 4IF6A 3U1VA 2QKYA 3M6WA 1V11B 3AU8A 3JAWA 4FZVA 1NURA 5AJZA 2Q1UA 4B1FA 1PNRA 2VT7A 4DDMA 3IAFA 3NOVA 2PAAA 3CZPA 3HKBB 1VRCA 3KALA 3IV9A 3I37X 3NBMA 1YVEI 4H4DA 3TE6A 1SU6A 3FNRA 2TMYA 3W78A 3WDSA 3NJ4A 4I55F 4QLOA 3SM9A 2BFEA 4O3FA 5AW0A 1P5RA 1ZSNA 4EX6A 1G8MA 4S0XA 4ZCPA 3USCS 5A6VA 4DIDA 5LPNA 1PK8A 2R8ZA 3IEKA 5B1SA 3IUNA 3UHOA 2VVTA 7REQA 4COOA 4QGFA 2V6GA 4OI2A 1N6HA 2P9CA 2R6CA 3OC6A 4X7BA 3K0CA 4EHAA 1TJ3A 2C0CA 2IF0A 3CF4G 4BOYA 1UK6A 4E5SA 3QSYA 2ZIEA 4EY4A 4HX2A 1PFYA 2XUPA 3O3NB 4YRKA 3QU2A 4FJ0A 1EDEA 5ETJA 1SUFA 1SPBS 2WD9A 2L18A 3KS9A 4JC8A 5AM5A 2J3HA 2FN3A 3RT9A 1JJ7A 2AC4A 5DHAA 1T8TA 3O0DA 3RVOA 2J8ZA 2AFHB 3QKIA 4TVBA 4BFYA 5HFAA 2V55B 3RC2A 4BX2A 4CM4B 1COWA 3U49A 3ZN2A 4FMCB 3DGFC 4ZALA 3LDFA