4TL8A

Crystal structure of n-terminal c1 domain of kaic
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
234
structure length
215
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 74
structure length 215
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl8A00
2D2EA 1MOZA 1HUQA 3TQFA 3NBYC 1FNMA 4B48A 4KYUA 5JECA 1DAHA 1GKUB 1ZIOA 4B2LA 1JR6A 4X8LA 1R4AA 4JSTA 5C2JB 3U6BA 3W6PA 3EZFA 1E4VA 2G77B 1ZW6A 1XMVA 4HLUC 5HZHA 5L3VA 1M34E 1VIYA 1S8FA 2Q3MA 1P9NA 2R6AA 2KI5A 4A0GA 5EP4A 2XB4A 1FW6A 1VTKA 2FA9A 4G5SA 4TTRA 1PVOA 4Q9KA 2PT5A 4AKGA 1T8TA 3HWSA 3IQWA 4EPVA 3CX8A 4HLQB 3I62A 4B3DA 4M22A 3SI7A 2QPAA 4NCJA 4NKRA 1U9IA 2EQBA 2GXQA 3CR7A 4IDPA 4L9SA 4Q4LA 4GZMA 1OE0A 2GJSA 1ESNA 2W2XA 2WWHA 5G41A 3SYLA 2FSHA 4OHZA 1Z22A 1Z6YA 3X1XA 1D5CA 1SXJD 4M1MA 3HYRA 3SDZA 3TUZC 1GFIA 1ZUHA 2IHYA 1OHHA 2QQ0A 5BYJA 3ASYA 4HYYA 2Y8EA 4ZCIA 3GFPA 1E0KA 4D2IA 1CIPA 2GCOA 2QTVB 2RGEA 2PLFA 2WM9B 1ZBDA 2EYUA 3FMPB 2ZE5A 4XJXA 4CIDA 5KDOA 3ZVRA 3QEJA 3AVYA 2ZANA 3CPJB 4OQNA 4MQBA 3ADKA 4DSOA 3EPJA 4AYTA 1AIPA 4G5GA 5DI9A 1NMZA 1YU9A 1NVVR 2H8KA 2ZREA 1W0KA 2DHRA 3PG5A 3M1IA 4BFXA 1NJGA 1XTIA 5L3RA 1YZLA 1JR3A 2W2TA 4IEIA 2VL7A 3AF0A 2J0SA 4KO8A 1YKSA 3CRRA 3EPHA 3LY5A 1OFTA 4OQFA 1GILA 4M1TA 3RANA 4DCSA 2JLVA 4L4UA 2BMJA 2GVZC 4HUQA 2IYQA 4EJSB 4TT3A 3UK6A 4FMDB 4AYXA 1XF9A 2HXSA 2F6RA 1RIFA 3P1JA 1SVIA 2GXUA 3UMFA 4PQFA 1JXOA 3U5ZB 1S2MA 4KSBA 2GAOA 3W9YA 3BB1A 3NG1A 2OBNA 4CRWB 4CEIA 3BD9A 1TF7A 3OIUA 1OH7A 3LH5A 2G6BA 1OB2A 4QFMA 1EESA 1OXSC 1CR0A 4DT1A 3AEZA 2C9OA 3X2SA 3HU1A 1NNEA 3GJ8A 4Q1BA 1PV4A 3TNFA 2DFNA 1CS4C 2A5YB 1F6BA 4C30A 3CPHA 2VHUA 1Z08A 5FOUA 1W2HA 4ZKDA 5C4GB 4NH0A 2B7BA 4KITB 2PMDA 3CUEF 4GT1A 3GPLA 4PHFA 5M04A 1G3IA 5JBQA 2QT0A 1CRPA 4LV5B 5B57C 4JYBA 5EE0A 2GXAA 5LD2B 3C5CA 3E2IA 1XPUA 1KYIA 1RYHA 2ZE7A 4RSGA 1D9ZA 1H8EA 3CIOA 4TLDA 3U61B 2ANBA 2F1JA 5H68A 1UBFA 1WBDA 1VYUA 2NO1A 2QL6A 1TUEA 1IJEA 1EWQA 1B23P 3IILA 4Z51A 1S1CA 4GFDA 2HJGA 4TMTA 4B2IA 2EFGA 4B44A 1Z6AA 5BWMA 2CNWD 1M7BA 3W6NA 2B7CA 4KFRA 2R8RA 3I32A 4DLWA 1RE0A 1KDTA 3AUXA 3E5HA 3THXB 1E2GA 2Q9BA 4II7A 4US2R 4QGGA 2W83A 1GRQA 5FPSA 4V0MA 1RZ3A 2OT3B 3KXLA 1XRJA 4M9ZA 2QBYB 3T35A 2GBLA 2V1UA 1IXSB 4P3YA 1KY2A 2B6HA 4DWJA 1CTQA 5P21A 5F3WB 1ZCBA 3OESA 2UKDA 3JVUA 3N2IA 4LYFA 3D7MA 3PR1A 4RCYA 4ZI3A 2OAQ1 4MUAA 1R5NA 1NP6A 4BWYA 4PANA 1AZSC 2VSOA 2IWHA 3U60B 1BH2A 1VCOA 3DHWC 1DVRA 3MMPA 4BZPA 1L7VC 2RHMA 1FTNA 1SQ5A 2X1VA 1NN1A 4PR0A 1E2IA 2QP4A 1E1QA 1US8A 3I4LA 2BCJQ 1NMXA 3IIKA 3ZQJA 3RS0A 221PA 1G5PA 2BEKA 1FP7A 1TU3A 2JCSA 4K8OA 3ECCA 4PFSA 4OKSA 3ZIAD 1I4DD 3TLXA 4EUNA 4QGAA 1XEXA 3LNCA 4Z8YA 2QP3A 3A4NA 3LV8A 5FFMA 1W46A 4A2WA 1PUJA 2WMNB 4J0QA 5FBQB 2GWHA 4KV9A 4LC1A 3VQTA 4R2HA 1OHHD 4WAUA 4GOJA 2W6ID 1DS6A 2QTHA 4URWR 2KWIA 3L2OB 1CKEA 2CHVA 3SJAA 4LWZA 3VKHA 1HYQA 2WIAA 3UWKA 1WDTA 4LSGA 2P5SA 2SHKA 1ANKA 3UATA 3A1VA 1HTWA 1YZTA 4KLZA 3OF5A 3TW8B 2QTFA 5JS7A 2EFHB 5LB2A 4N1AA 4O2LA 5G40A 3ND8A 4IOKA 1N5KA 1Z2CA 3AVWA 3VX3A 2V3CC 5GJVC 1P6XA 1XTRA 1XXHA 4JL8A 1KHTA 1L8QA 4G3XA 5H1YA 3LLUA 4IDHA 3EZ6A 4Q4JB 821PA 1J7KA 1Z0KA 2CVFA 3LO5A 1T3HA 4E22A 4TYNA 1SXJE 1U8AA 2CBZA 2C96A 4WVFA 3WNDA 4MDEA 2V6IA 4P0TA 1HT2E 2ZI3A 3GJ4A 5AR1A 3AB3A 4TT3D 3W90A 4A0FA 1ONBA 1OT3A 2V55B 2R6GA 5FTMA 4L15A 3IO5A 3GEHA 2B8WA 4F4IA 2XTMA 2R6FA 2O52A 3AQ4A 4C0AC 1CJTC 4Q4HA 2WJHA 2P65A 1XPOA 1XWIA 3THXA 4PHGA 2R6CA 1IM2A 2V7QA 1FOEB 1U98A 4A2QA 1OFUX 1ZP6A 4IJMA 4F38A 5F98A 3GLFB 5JHHB 4PSKA 1F2UB 2DWQA 1LW7A 3VNUA 2PZGA 2O8BB 1PLKA 1T3LA 2FEMA 2JASA 2RGBA 2QA5A 3EASA 2CK3D 2G83A 1P75A 2VIIA 4Q02A 3MWJA 1UBCA 4XSHA 3DKPA 3OEED 4LDJA 3V4RA 3MSXA 5E4FA 2AXNA 1LVGA 1QHGA 1T6NA 2VHQA 2WSSA 2CXXA 3X1WA 3FPAA 3V4FA 4L5BA 1W49A 4XTRA 1BKDR 4URZR 4B75A 2XZOA 1UPTA 2REBA 2YOHA 4WA7A 4TMVA 5DHAA 4MRPA 1D2MA 2ZI5A 4PO8A 3ZQ6A 3MG9A 1NIPA 1R5BA 2QE7A 5KNDA 1CEEA 3LFUA 4Q1DA 1CJUC 5FBVB 3I1FA 1G41A 3RYTC 3GJ5A 2C78A 2HYIC 4C2UA 2QRNA 4KCGA 2WKRA 1C4OA 5TY0A 1A2BA 1OYWA 4CEIB 3KKQA 2ZYWX 1W47A 1VHLA 4MYTA 4GBMA 3SJBA 2CCGA 2NPIA 4PAOA 3V00A 1T5IA 3U4QA 1KSJA 3SFVA 5AUQA 1NN5A 4LCBA 1OXUA 4MYCA 1Z6GA 4Q7JB 2AFHE 5LBIA 2E87A 2RB4A 1KI2A 4HZUB 2Z6VA 5CM9C 2FGJA 2H1LA 4OHVA 3WYGA 1R8QA 4BLSA 5HKKD 1ZM3A 3AH8A 5L3SA 2QNRA 4WIAA 2IS1A 2FN4A 1QHHB 5TB5A 2QAGC 2B92A 2H18A 3B5JA 4EPTA 1TQ2A 2GETA 4LYHA 4TYPA 3SYNA 3MFYA 3OE7A 1G6HA 1IOZA 4P32A 3NC1C 2ZUDA 1DAIA 2GILA 2GJ8A 3B1YA 1IN4A 4A9AA 4DUGD 2JJ8A 4U00A 2QN6A 3GJXC 3TBKA 2ZJBA 4OI2A 4M4SA 1E0AA 1XTJA 3KUCA 3MLEA 4DSTA 3DEFA 2QM7A 3NKVA 4F4JA 4LYJA 2QROA 4NU0A 1SKYB 1RW4A 3T5GA 1AS2A 1JQLB 1XB2A 1XCMA 1G64A 4EPRA 4V02A 3RSOA 4NYMQ 3AF2A 5SZJA 1R6BX 2ZRHA 4K46A 1KMHA 1TX4B 3T1OA 1AK2A 1G19A 4ESHA 2VP6A 3NDPA 1P73A 2ZITA 4ZV4A 2XNDA 5D3MB 1JXMA 4M8NE 2GF9A 4P4SB 4JL6A 4FMCB 4LHXA 121PA 2QZ4A 4DLRA 1L2TA 5KUTA 1KGDA 3VHLB 5CM8B 2WICA 2OO7A 1E2NA 5KSZA 3P32A 4FMCF 1E2QA 1U8ZA 3QY0A 4V0NA 3MRSA 1SVMA 1G17A 2OM2A 2J87A 3C5HA 1XCPA 1NY6A 2VP4A 4KLNA 4V0ME 4DXAA 1XTKA 4LZZA 4IRUB 4DCVA 1QZXA 2Q9CA 2CHQA 2EU8A 2GJ9A 1NMYA 3KJHA 3LRPA 3NEJA 4Q01A 3VU9A 4B6FA 3ZS8A 2HYDA 4D4JA 4A6XA 1OF1A 4M0LA 2IUUA 1JB1A 5JSZB 5DGXA 4Q19A 5H70A 4UNRA 3U6KA 4CEJB 1IN6A 3O8BA 1FMJA 3QF4A 4TYQA 5E3HA 1ZU5A 2V7QD 5FTJA 1K6MA 1YR9A 4P33A 1J2JA 3SU8A 4B73A 1G4UR 3T5DA 1AA9A 2WOOA 4H1VA 2RGDA 4B35A 1KI9A 2IYYA 4TLCA 4G1UC 5CK4A 4CVNA 3P27A 5JFGA 4CW7A 4QBIA 2WSMA 4Z1MD 5BXQC 3WRXC 1KK2A 5KSYA 3PUXA 4G0NA 3GLIA 3LBNA 3NHBA 1K5DA 1A1VA 2G3YA 1F2TA 2CLCX 1MO3A 4E5UA 1IXZA 2FJUA 4QJ5A 4EIWA 1R0XA 2ODWA 3SFZA 3A1WA 2JLZA 4Y0AA 1YR6A 4HB3A 4XD7A 4OK5A 1XCGB 1V43A 5GVSA 3L8ZA 2ZSEA 1G20E 1ZC3A 4DCTA 1G4AE 4BLRA 1W0JD 4PPNA 8OHMA 5H8WA 3FDIA 4R2IA 2DB3A 4NYJR 3TK1A 3AVUA 2KBFA 4A8JB 4CZ2A 4KXFB 2PZEA 3BORA 3GJ0A 5LB4A 4JBWA 2RKOA 1R5OA 2JJ1A 2RGNC 4LHVA 5C4MA 3EX7C 2AHOA 2BIFA 5BN3A 3LW7A 4A82A 4NDZA 5FOXA 4QXAA 4ZIRB 5C18A 4LJ8A 5F9FA 1E79D 3VNVA 4CDGA 4NYIR 4KFUA 4PO9A 1G8HA 1N6PA 1U9IC 1FFHA 3EIEA 3RS7A 1KK3A 3F8TA 1X3SA 1XD9A 1NLZA 4JLDA 2H7VA 1WRBA 1R0ZA 1NSFA 4LRWA 2ZETA 4LGMA 4YXWA 2QGZA 2OV2A 1EFUA 4RKEA 4F92B 5L8VA 2BVNA 5J4KA 4PXAA 4TZ6A 4A0HA 3BB4A 2QPTA 5IF9A 2AL7A 1CR2A 2ZRGA 4OI1A 2JLUA 4MKFA 4IOJA 5HPYB 2CJWB 1IY0A 1COWD 2ATXA 2FH5B 2OZEA 2ZQ5A 3U3JA 4NCIA 4CYMA 3DZDA 3LW8A 3THWB 3I8SA 1P62B 5K8LA 1QBKC 2F7SA 2O8FA 2WTUA 2CCJA 4F4CA 5J40A 1R0WA 1KIMA 1R8SA 1XEXB 2BBOA 3KX2A 3MUFA 2IUTA 4M53A 3AVVA 4P4UA 1OIXA 1G9XA 3MJRA 2JDIA 2NZ8A 3E1SA 4LJ6A 4AG6A 4AKEA 4BASA 1AQYA 1ZCAA 4P31A 3JVVA 3NBFA 1JQJC 2FE4A 3B13B 3IPYA 4LBWA 4DSNA 4DLXA 3KXIA 2ZRBA 3ICQB 1CJKC 4YMVA 4DC9A 2F9LA 4I4LA 1I2MA 1KO5A 2XX3A 2EWWA 3K0AB 5EUQB 3SQXA 3B82A 1QHHA 2BHRA 1SHZA 1QHIA 1FUUA 1YZQA 3G5UA 2ZRMA 3U7GA 2IS6A 3QI2A 3UIEA 4NYIQ 2NO9A 1KMQA 2X8AA 4WXRA 4PQYA 1YZUA 2PL3A 3GLGA 1GNQA 2PH1A 3LLMA 2J3EA 2FFBA 4BRWA 5LPNA 3TRFA 1D9XA 5JWRA 1N3BA 2IC5A 2W0MA 3L0SA 3GP8A 4KU4A 1YQTA 3AP1A 2OFXA 5FBWB 1T0JB 5JJLA 3K70D 4C0LA 2YVUA 3F3YA 3V9PA 4NCKA 1FNNA 3KKMA 2XJ4A 5AUOB 3K8YA 4TQAA 2GZAA 4GZLA 1EFRA 1TQDA 1U8YA 2A30A 1BOFA 1VG8A 2H17A 4TL6A 2ZYVX 4BFUA 1SXJA 3RVBA 4Q7KA 2JAQA 4UJ5A 1XTQA 1MO4A 4GMXA 1XEWY 4B3BA 1P7CA 3QEOA 421PA 4TL7A 3P4YA 5EXPA 5TXGA 3C41J 4EPYA 4JLPA 2C03A 4RD0A 4BFTA 1J90A 3IBGA 1TUIA 4UNNA 5B2ZA 2JLXA 2BM0A 2N1BA 1OB5A 2DPXA 2P2LA 3DM9B 4AD8A 5IDVA 1E9DA 3F0TA 3HR8A 3QOFA 3P4XA 4FCTA 3WMGA 3Q5DA 1VPLA 1NI3A 3EW9A 2FGKA 3EA5A 3TSZA 1W0JA 2HLDA 4HAUA 1DAFA 4JVLA 3ZZ0A 4B33A 4NTZA 4OBEA 1UAAA 1LF0A 1OIVA 4RFVA 1E2EA 4A4DA 2WWFA 5EUMA 5EP1A 4EQ6A 4PSAA 1KZGB 3VR4A 1ZNZA 2HF8A 4Q7LA 3KKOA 3I73A 4BFYA 2JLWA 1TADA 4IW3B 5BYKA 1E9FA 4Q5IA 2D62A 4ACAA 1W4BA 3TR5A 3I3SR 4YXWD 1XXHB 4M21A 4I1OA 3EPLA 1W36C 3TR0A 3VKGA 2QUZA 2VSFA 5KOYA 3BC1A 3NTUA 2IX3A 3NXSA 3SOPA 4AKIA 1JECA 2VP2A 3A36A 3CRVA 3TH5A 1Z8FA 2C5LA 5SZKB 3DOEA 1NKTA 3AVPA 4RD6A 4ZCMA 1H8HD 3REGA 3ZDQA 2JGNA 1U94A 2OCYC 3NHAA 5JS8A 3VR3A 3RS3A 2IXGA 1S4QA 1Q3TA 2QY9A 1R0YA 2VHJA 2CJWA 4NP6A 4D6PA 3TQCA 5FH9A 2ZE8A 4HAVA 3SQWA 1CXZA 2Q21A 3JZMA 1RVDA 2JDID 4C7OA 2BMDA 2GK6A 4WZBE 5AJVB 4URVR 3GFOA 1F5NA 4DB2A 3ZZUA 3QNUA 1CJMA 1WE2A 3GLGE 3UWOA 3IIJA 5EP3A 4Q9IA 1G5RA 1AM4D 2RGXA 2AKAB 3LA6A 1N25A 2C95A 1YVDA 1M6NA 1G5TA 1XDBA 3A4MA 3OZXA 1EFCA 4YDHB 4QKQA 2F55A 2EYQA 1CULC 1D8TA 4FW9A 4KODA 1KTVA 2CL0X 1NBMD 2GF0A 1MO6A 4UNQA 3EXAA 5GVRA 3QBVA 2WWYA 3KTAB 3THOA 4BRUA 4LI0A 2V9PA 1DO0A 3R9WA 5LDDC 1EFHA 5E7IA 2O8DA 5FPTA 4DDUA 4MITA 4OJKA 4U02A 4UXHA 1E98A 4AWXA 5HKKA 4Q1EA 2ZJ2A 5CJPA 1CR1A 3W8NA 3AGQA 1W44A 5B64A 1AS3A 2ZI9A 1KO1A 4CGZA 1N6LA 4JLKA 4XVRA 2WWWA 4GP7A 2JATA 5CIQA 3RC8A 3RDPA 1GRNA 1TU4A 4LPKA 4C2TA 3MWYW 2UVQA 2F3RA 3NDBB 3R8FA 3HYTA 1ZNXA 1OKKD 1E0JA 1P4SA 3EZ2A 4PPFA 3W6OA 4DDVA 4BUJA 1BMFD 3NEYA 3DPUA 3ND9A 2V6JA 1KI3A 3SZRA 1UDWA 2CE2X 3WMEA 1N0UA 2VLIA 1N6RA 2G1JA 3BFXA 3DKVA 1NRJB 2HJVA 1II0A 5CITA 1YZNA 2DBYA 4WW0A 1YRAA 3S1AB 1N6HA 2XJ9A 2IK8A 2D06A 4HAWA 4LHYA 4Q4AB 4KVGA 1IXRC 5CB8A 4RD1A 5FUYA 3RSLA 4BQSA 2Q3HA 4DLYA 1GTVA 2IYXA 1W36D 3K09A 4QGHA 1G3MA 1AN0A 5JSZA 1V5WA 4QJ3A 3AGPA 1ODFA 3A1TA 5DI3A 4NL4H 1RRCA 3QF4B 1L4UA 4X8MA 4CEJA 1NN3A 2HXYA 3EWAA 2ZYTX 2ZRNA 4G01B 4Q1FA 1E4YA 1Q1EA 3O8CA 1SKQA 1EK0A 1NG1A 1VG1A 4FCVA 1KK0A 2C98A 5A4JA 2AX4A 3M4YA 2EVWX 1E9EA 1GDDA 1DBSA 3EZ9A 3LWNA 3BJIC 3GQBA 3OFND 1TF5A 4DB4A 1E32A 1XJQA 2GCPA 4IOLA 1GAJA 1IHUA 4OHWA 4RJLA 2WPDA 2OG2A 4ILEA 1EX6A 4P4SA 5KHOC 3GFTA 5EE9A 2IF0A 1OW3B 2HCBA 2OBMA 4WXPA 3EWSA 2J59A 2ORIA 4IFBA 3ZZTA 4C7OB 3IQXA 3CR8A 4ACBA 1P3JA 2FFHA 4BEJA 5B58C 1RC8A 3TW4A 2JIZD 2HV8A 4LJ7A 4D4KA 2VHTA 3R8CA 2WVJA 1IN5A 2P67A 3K9HA 3W5JA 4DCNA 2R44A 2ZAMA 4HLCA 4JLVA 1JPJA 1LS1A 5TVKA 4XWKA 4R98A 3KB2A 2YZ2A 1XTSA 1HE8B 2CMKA 2QORA 4HZUA 4BLPA 1TF2A 5FBRB 3RAPR 2BKEA 1FTSA 3KL4A 4BLQA 1QF9A 2YC4C 4H9GA 1BYIA 5AUNB 2P6NA 3RS5A 4RZUA 2FSIA 2O8CA 1NKSA 2GXSA 3MWKA 4JT2A 2CL6X 5J47A 4QOSA 3IDQA 4JS0A 4TN1A 2ZSDA 1XU4A 4EDHA 3IO3A 1ZNYA 1P2VA 1R10A 2BOVA 2GVDC 3NH6A 2DFLA 2XOKD 3TMKA 3B7GA 5KTYA 4D81A 4JBXA 1KKLA 1RRGA 1NLYA 2XEXA 1R7RA 5DYGA 5E7MA 3CB4A 3IEUA 4L9WA 5HTKA 4M1KA 3SYKA 3I5XA 1HH4A 2KJQA 2J5XA 1VMAA 1Q44A 4LJ4A 4Q21A 4A36A 2HT6A 4LJAA 2F43B 2C99A 4MRRA 1E79A 4PO1A 3RNLA 2NTYC 4B3FX 2ODBA 3FHTA 3L0PA 4TYWA 2BC9A 3WNCA 4HLDA 1PLJA 1M2OB 3RRMA 3K9GA 1QVAA 3T1TA 4GP6A 4QL3A 1Y3AA 2GAAA 4I1SA 2J41A 2WZQA 2XXAA 4Q66C 4YDSA 2F1RA 3GD7A 1XEWX 2ONKA 4HB2A 2PX3A 2ASEA 3HJNA 2FPMA 1JJVA 4K81B 5DISB 4BGDA 3R20A 2ZYUX 4FWIB 3FMFA 1JEDA 1LV7A 2IF2A 3FKSA 5TMPA 1M7HA 4URUR 2QMEA 3FKSD 1XFAA 3GJ6A 1DARA 2WSSD 3WP1B 2OESA 5HZKA 3K0AA 4IXNA 2P0EA 3PUYA 5FUWA 1VYVA 4EFLA 3BH0A 1E6CA 2WBLC 1XEFA 2NO7A 2VQSA 3WHKA 4UXIA 4A92A 1W4AA 3W3AA 5FI0B 5KYKA 4EPWA 5JRZA 3ETLA 5AJXA 3AKYA 5IK2A 3SHWA 4QNRA 3D8BA 4GSYA 2JA1A 1OXVA 1MABB 1P60A 4LK2A 2L0XA 1Z6TA 1T5LA 3CH5A 3WMFA 2VSXA 3QKUA 2ODEA 1E2FA 2IYWA 3TIFA 4AC9A 5EXTA 2ZI4A 3BFVA 1U81A 1FX0B 2UZ3A 1W5SA 1E9SA 3ONWA 2Q9AA 4XTCS 4BPBA 2Q3FA 1VHTA 2VO1A 2F1IA 3ASZA 3OEHA 2ZI6A 2A9KA 3Q8XB 5L3QB 1XD2A 2OHFA 1NVUQ 4DLUA 1KOFA 2ZR9A 3WY9A 4W5JA 3DL0A 3G82C 2ZRIA 621PA 4PC2A 4LBYA 4MDFA 4LY6A 3AUYA 2J0UB 1RJ9B 5FOVA 2IWRA 2YINC 1N6KA 3U7FB 2PT7A 2OUKA 5BW8A 1G1MA 1NJFA 2OXRA 3KFXA 5F2EA 2W2VA 3OHMA 2IEYA 4RZXA 2R2AA 4PHHA 2V4ZA 4PZZA 3ZVLA 4UNSA 5AJZA 2JLYA 4Q4JA 1Q21A 2JIZA 1MRNA 3LVQE 1AGRA 1S3GA 4M1OA 4DDTA 4LX0A 3H0KA 4AK9A 5CB6A 3CZQA 1ZM2A 1OPXA 4I1VA 4IDQA 4HEJA 4MGYR 1U2RA 2H16A 1OIWA 2J0UA 3U44A 1Z07A 2OEPA 1K8RA 2A2ZA 2AXPA 1E9CA 2OCAA 2P6UA 4ZIRA 4C0SA 2QQEA 1J8MF 5G3YA 1Z83A 1S9DA 2FU5C 2AWNA 2I1VB 1N6OA 3PEWA 2W58A 3E70C 2DCUA 3Q5EA 5GJBA 1J99A 3QIAA 5ANRB 1NL3A 2D3WA 4KFSA 4RD3A 1KO8A 1FUKA 2KB0A 4LJ5A 3NIBA 4MGZR 1XD2B 1II9A 2CHGA 1XXHE 1G3UA 3QBTA 2O0KA 4OQXA 1P9RA 1KNQA 2JJ1D 2BBTA 3SJCA 2Z4RA 3BIFA 2ZUCA 3DM5A 4Q03A 1EGAA 1SHKA 2J9RA 1MR3F 5AJYA 4HB0A 1ZINA 4ABYA 4G5RA 4JVMA 3CW2A 2EWVA 5JI3E 4KBFA 3IIMA 5E95A 1DAEA 1VYTA 3KQHA 1ZM4A 4V03A 2CEAA 1XD8A 5CYOA 3CNNA 4HDOB 1WCV1 1E2KA 2ORVA 3SE0A 4EAQA 4QGFA 1Z28A 2ZRJA 3ZLJA 3K09C 4GOKA 3VR2A 3CNLA 4JLMA 4D4MA 3IBYA 1N0WA 2WWIA 2CVHA 5B30A 2AN9A 2FSFA 1UBGA 4BZQA 3TE6A 2D74A 3AVXA 3PUVA 3B1VA 3ADCA 3H2YA 1E0SA 5JHGB 2B21A 1ZM9A 3C16C 3TKLA 2NO6A 4DIEA 4AYWA 1VECA 1WXQA 2AD5A 2XXAB 3I92A 4ZDWA 3SBDA 4B74A 2FV8A 3B60A 4MKHA 3MGCA 5FPYA 4LC0A 2F9MA 4LV8B 1E2DA 2XZLA 4AKHA 2E1RA 1Z0IA 4TL9A 3K9LA 3QXCA 3Q7PA 2YWEA 1UBEA 1YE8A 1LNZA 1XZQA 5DYIA 4V0LA 4AG5A 5LD2C 1J8YF 2F43A 1HQCA 1C9KA 3T1QA 4CT5A 1TL7C 1T0HB 2C9CA 5KNBA 3REFA 1T4GA 1TQ4A 3DMNA 4B32A 4TYYA 3GLHB 2JJ2A 2WJGA 1KSFX 4NCNA 3CKLA 4RFSB 1UDXA 3M0EA 4NZYA 4DEYA 5DHFA 1AZTA 1NVVQ 3U3MA 3WRYC 1CLUA 1DELA 2XTZA 1X8LA 4YMUA 4ARZB 1E2PA 1I2DA 3LX5A 3EIHA 1W2GA 5DE3A 1XMJA 5TARA 1E1RD 1QDEA 1XMIA 1M8PA 4TSFA 2IYVA 4MKIA 1AS0A 2KE5A 2O0HA 2K5UA 2GRJA 3FMIA 2QAJA 3LQRA 4X8OA 5JJIA 1ZJ6A 3X1DA 1G8PA 1JAHA 1U0JA 4TLAA 1N5JA 5EP2A 2VTKA 1UKZA 2GEDA 2XITA 3BERA 2NO0A 2AK3A 5L3SB 2MSDB 3CBQA 1QHSA 1HV8A 2IYUA 4D4LA 3TUIC 1HA3A 1N6IA 3HP1A 2ZRDA 1GM5A 1H8ED 1Z0FA 1HT1E 3GEEA 5DI3B 2J0VA 1KDPA 4B47A 3THYA 4D25A 4FXPA 2ZJZA 1ZUIA 2CNWA 3LAWA 3B9QA 4PC3A 3O8RA 3CPEA 1SVSA 2GA8A 3QG1A 2HDNB 1ZUNB 3QG5A 2LKDA 3NWJA 4Q48A 3CX6A 1T8UA 2AD1A 4QNMA 2OCPA 4FWTA 4LYAA 3EG5A 1LS6A 3CM0A 1M1YE 3N2EA 2G88A 2RGNA 2BDTA 4O3MA 4M1WA 4W5WA 3IEVA 2YJTD 3EAQA 3EZ7A 2FNAA 2G1KA 4ON9A 2C8VA 3CNOA 4OQLA 3D31A 3Q72A 2HLDD 1UKEA 4A15A 2QU8A 4ZDIA 1IN7A 1NVXQ 2XGJA 2ZU6A 3FFAA 2BCGY 1ELOA 4MYHA 5DNYB 1KI7A 3KKNA 2EW1A 4XSGA 2VP5A 3FFBA 4KAXA 3AP2A 1YR7A 4MH0R 3PXGA 3VMFA 4YMTA 3QVUA 1FZQA 1D2EA 1IY2A 1VDZA 4F93B 3PCRB 4A2PA 1CBUA 3NBXX 1X8JA 1FL9A 3K9NA 4OK3A 4IHQA 1U0HC 1FMLA 2XAUA 5JZVA 1YHNA 4HSEA 5EE5B 2ANCA 1CF4A 4ZDJA 2YHSA 5K8TA 5JLJA 3U4QB 3TSOA 5JEEA 1DOAA 4Q1CA 5FTKA 4N0DA 3QXHA 4JKYA 4CT4B 3RLFA 3FKQA 3GLGB 3AKCA 1YZGA 2WJVA 3DO6A 3PEUA 1OYYA 1NG9A 1SGWA 3B9PA 5J4LA 5A5GA 3FHCB 2YWHA 3C15C 3UMRA 3G0HA 2O8EB 1X6VA 5EZ6B 4B3GA 2ZRLA 1PLLA 2W00A 1KI8A 3WHLA 4B43A 4DZZA 3KJEA 4NCHA 2IBMA 4UNPA 3GJ3A 2IYSA 3B6EA 4UJ3A 2R62A 4RD4A 1SKYE 3GLIB 2TMKA 2BJWA 3QKSB 5DLQC 4LHZA 2IXFA 5KSPA 3UPUA 4TL8A 2YC2C 5J5CA 3DDCA 5BN5A 1F3OA 1SVWA 3QENA 2A5FA 3VTKA 1E99A 1OXTA 3EPKA 3K70C 1CRQA 1JR3E 4PAMA 3IGFA 1H65A 2NOAA 3HPRA 1JBKA 2DFTA 3VHXA 1KI1A 1UM8A 2R9VA 4M1SA 1YZKA 4YLGA 1TMKA 2IEZA 1F2UA 1DAKA 1II8A 3A1UA 3X1ZA 4YMWA 3VX4A 3IHWA 5FR2A 1Q0UA 3TVTA 2OE2A 5CYPA 3THWA 1U90A 1IJFA 1IBRA 4ZDKA 4PC6A 5FR1A 3NVAA 2OBLA 5KSOA 3WYAA 3RHFA 1PZNA 1N5LA 5D3MA 3B78A 1U0LA 2Z83A 3MCAA 4QM6A 1QHNA 3KZ1E 1E1RA 1X1RA 4KSCA 1Z47A 4NYJQ 3ZD7A 4YQFA 2XSZD 2GNOA 5EE1A 3QJYA 4C3ZA 2QMUA 3QF7A 2LKCA 2XSZA 2XB2A 1G8FA 4C0HA 1ZD9A 3MD0A 1TAGA 3CRQA 5AWFC 5SZIA 3QKRA 2J7PD 5L3QA 1VCIA 3DMDA 4M9SA 3WBKA 2QPOA 2J7PA 3M6AA 1A82A 5DIFA 4ZO4A 1A7JA 1Y63A 3K70B 4Q18A 4X8HA 1GITA 3SNHA 1AKYA 2FZ4A 2Q0HA 4B6EA 1QHYA 1RJ9A 5FBLB 2QG6A 2JLQA 1OLOA 4UQOA 4LHWA 1CJVC 2GEUA 3NBZC 4BFSA 2A5JA 4MRVA 3RRZA 4BE7B 4IKEA 3BH7A 2YWFA 1BMFA 2H57A 2FSGA 1G7RA 2H5EA 4L16A 3I8XA 3H4MA 2DFKB 1U99A 3JZAA 1GVNB 1UFQA 2REOA 2ORWA 5KPJA 1JI0A 2J0QA 4RFSA 1G6OA 2BBWA 2NGRA 2RHDA 4Q7MB 2QE7D 4LV6A 1XPRA 3RABA 3RWMB 3PIRA 4MRNA 3O47A 4DCUA 2QBYA 3L43A 1T9HA 2HEIA 4DVGA 3EIQA 3A58B 4KYIB 4US1R 2OLJA 4IDNA 1ETUA 2WKPA 3TSWA 3GLFE 2A78A 1NBMA 3QSYA 1E94E 2GESA 5TDHA 1SZPA 4FINA 3EA0A 3EC2A 2VPPA 2WV9A 2HUPA 3OAAD 4XIGS 5CLQA 4RZ3A 1PUIA 3PEYA 1QHXA 2FPKA 4KFTA 2RH5A 1LY1A 1TEXA 1ZRHA 2F3TA 1M7GA 2O5VA 3FVQA 3GLHA 3H84A 3ZIAA 2R6DA 3WP0A 1F48A 2QMOA 3R7WA 4FMDF 4XVQA 1IONA 2ZM5A 4DUGA 1Z0DA 4Q47A 3RRYA 2IUSA 3FMOB 4C0KA 4DT1B 1GNPA 2O0JA 3PV0A 2WWXA 4DLSA 2KBEA 4E09A 4ESVA 2OFOA 4P4TA 1MO5A 4R71A 3CF6R 2P6RA 1W4CA 3CRW1 5CK5A 1DADA 1I4TD 2QM8A 3HDTA 1HEIA 2GK7A 4GPTA 2ZR0A 5IK2D 4QM7A 2RCNA 3A4LA 1MRSA 4GL2A 5FL3A 4EKDA 3LXXA 1GOTA 4KBGA 2R65A 4Q9JA 2VBCA 1OJLA 2CCKA 4MA4A 1Z06A 5HR5A 1A2KC 3KXKA 3QE0A 4JSYA 2GZDA 3AVOA 4MGKR 1BYUA 5EQTA 5JCZA 1KO4A 3AVTA 3Q3JB 1VCMA 4Y0VA 2D2FA 3IUYA 3AF3A 4RCZA 2WAXA 4PPQA 4V0OA 4C4PA 4JKIA 3VAAA 3TVDA 1AJEA 5KPDA 521PA 4O25A 4FN5A 1S9HA 2GCNA 2VH5R 3R9IA 4U7DA 5FUVA 2H92A 1I4LD 1WP9A 5CDFE 1FQJA 3X1YA 2ZSBA 3CZPA 1TNDA 4RD2A 4DLZA 1LFDB 4JZKA 5GADl 5C1BA 1KI4A 4FI3C 3K0CA 4EJSC 2A5GA 1KAOA 2P5TB 3BAFA 4M9QA 3SBEA 1Q22A 3PUZA 4JJKA 1WB9A 3ZGXA 4GOXA 3I5YA 2BV3A 2WJIA 3A6PC 1XMSA 5G3ZA 5FTLA 2WJYA 4PC7A 2ERXA 2IW3A 2WHXA 4HATA 4BZXA 4JVNA 1CP2A 4QBHA 5IT5A 4M2LA 2HT1A 4BLTA 4Q9LA 1OH8A 1B0UA 1DG1G 3PVSA 4B76A 5JCPA 2NIPA 4L8GA 4KHZA 2QMHA 3QVVA 4C0BA 4PPGA 1OXXK 2NG1A 2ZJ8A 4JIMA 3VKWA 3PJRA 1VKJA 1GIAA 3ZJYA 4NE2A 2A7QA 4US0R 5JJKA 2J7KA 4QHTA 4R7ZA 2CDNA 3U2QA 4AI6A 2IYLD 3K0FA 2N42A 5GJWC 5SZHB 2O8FB 4N0EA 4JT4A 4IOMA 4NBSA 1SULA 4IXMA 2MMCA 2VHCA 3QQ5A 3AM1A 1G3RA 2ZJ5A 1R2QA 4MGIR 4S35A 2AFIE 1ZU4A 6Q21A 1WF3A 1II8B 4Z54A 4QHYA 1KO7A 4WOPA 5A0FA 4ASUD 1W1WA 1XZPA 1HY3A 3AV0B 2ZROA 4ZI2A 3B2EA 4G5OA 4B3CA 3J81k 2AKYA 2DWOA 1KJWA 2FWRA 1FQKA 2Q6TA 2ZIAA 2O8EA 1N0VC 5DN6A 1W7AA 2QEQA 2IS4A 1KNXA 1BIFA 1GZSA 1ESMA 5DN6D 2JLRA 4OQMA 3VR1A 1TEVA 4TTQA 2W6JD 1J70A 1X8KA 4JLBA 3TGPA 2J46A 4OYHA 2DY1A 4V0KA 4E03A 4B34A 2VP0A 2G0TA 3ZS9A 3OAAA 3QKSA 3LXRA 4WZ6A 5CIWA 4ZPXA 2FPLA 1ZAKA 2V8OA 4QJ4A 3BWDD 4Q4AA 3LQQA 5EE3A 3W8RA 1W4RA 2HF9A 3CF0A 5HCIA 4D82A 2ZTSA 3U7EB 1COWA 1Q12A 3DOFA 1KSGA 1DAMA 1XBTA 1MABA 4PX9A 1RKBA 3D6TB 1JEEA 2FFAA 4JJZA 4URXR 4W5HA 5D3QA 5HCNA 1P61B 4KVAA 3K0SA 1UF9A 3TAUA 1G7TA 4EPXA 1DEKA 2IXEA 4B71A 2WOJA 4XVUA 4PAQA 1NIJA 3RS4A 4BLOA 3C4JA 4TWZA 1S0UA 3KQKA 3LX8A 4HUTA 2CLDX 4HAYA 4GI7A 2ECKA 2NPFA 1E9AA 4C0QC 4XWOA 2D4HA 3GLIE 3Q85A 4YC7A 5CLLA 3WNBA 1P72A 5DH9A 2VF7A 4DEXA 2JJ2D 3ZVNA 3U3RA 1YRBA 4LOAA 4ZKEA 2FEOA 2ZRFA 1TPZA 3T12A 1NY5A 1RRPA 4PTLA 5C46F 3ZVMA 3C7KA 5TV2A 1G3QA 1W36B 3UXMA 3LDAA 4HLUA 1GL6A 1DAGA 2WWGA 3OEHD 3KQLA 4GMDA 3QPUA 2PJZA 1OH5A 1SVOA 1P5ZB 1ZIPA 2P3SA 1KY3A 4YMSA 5BQ5A 3K0FB 2OFWA 3A1SA 2IYRA 2GKSA 2ZRKA 4RY2A 3K0EA 1G8YA 4A6PA 1NVWQ 1WBBA 1Z0JA 3L0OA 1KI6B 2GZHA 1K5GA 2ZPTX 1E9RA 3BOSA 1OFHA 2QP9X 2ZJOA 5EJEA 1IAQA 2DYKA 3N5CA 1FP6A 2AWOA 4NONA 3KQNA 3T34A 4TZ0A 4HDQB 1QG4A 2Z43A 3RRNA 4H1UA 1E2JA 4QRHA 2YKGA 2J1LA 3FWYA 3T15A 4IEEA 1O87A 3SN6A 3AVQA 5JI2E 4GRAA 2I3BA 4DDWA 1JALA 4XOIA 2C2HA 1D2NA 3GMTA 3GLHE 4QBGB 2DR3A 5ELXA 2W6IA 5K8UA 2A3RA 2GCOB 4JMPA 1Q1BA 1HURA 4U5XA 1GWNA 4DKXA 4XWAA 2FX3A 4FIDA 1YR8A 4OHYA 3QPWA 5E7JA 2NQ2C 4W7SA 1JAIA 1A4RA 3AP3A 1E9BA 3OIYA 5DO9A 2C77A 1OSNA 4ITRC 3K1JA 5KDDA 2RGAA 2YOFA 2ZS9A 1MV5A 1RYFA 2DWPA 4MKGA 4UXJA 3OIVA 5FOSA 3MAAC 4PC1A 5J4VA 4R9UC 2NZJA 2Z5FA 1JR3D 3QXSA 1XX6A 1G291 1KJZA 2FMXA 2YWGA 1ZNWA 2PEYA 5UKDA 2Z0MA 2BM1A 2CE7A 4O0MA 4AURA 1SVLA 3LBHA 1IN8A 2D7DA 3EC1A 3IHLA 3IKJA 2FF7A 2GJAA 3AKDA 3BXZA 1G21E 2PEZA 2QENA 1Q1ZA 1O3YA 2ZU0C 2QSZA 1EXMA 2PBRA 1T91A 4Q00A 4DHEA 2PX0A 1GRRA 1XJ0A 1EWRA 2YNMA 1SXJB 1W5TA 2IHBA 3MWLA 5CJ2A 5CDFA 2ONJA 1C1YA 1DPFA 3RC3A 4XH9B 1H8HA 4DJTA 5AJWA 2WIBA 4WZAE 3GLFA 1DTSA 2GEVA 1N2CE 3SR0A 2B8TA 4OJQA 3T06B 1SVKA 2D7CA 4POAA 3FE2A 4HUQB 1Z29A 4QBFA 1ZVQA 4RVCA 3SJZA 3WBJA 2FG5A 3KKPA 2C9YA 2BMEA 4PSVA 1XP8A 2EFDB 2IT1A 3KUDA 1BO6A 4E07A 1EG7A 2BMFA 3ADBA 3B1WA 3CWZA 3VR6A 3FYHA 1OV4A 1FPMA 4AIIA 2O8BA 1G16A 3PITA 5J4HA 5F9HA 3PUWA 2XOKA 5FPKA 3PFIA 4DIDA 3BB3A 4LJYA 3LVRE 2AK2A 4M1YA 1P2TA 4CEHA 2VF8A 2ZUBA 2NMVA 1KDOA 1CU1A 2ZS7A 3PQCA 2RGGA 2PMKA 3CONA 4OI0A 2QI9C 2RGCA 4TSFD 5IRCD 5FPHA 4IDOA 1YJ5A 3BS4A 2FZLA 4W9MC 1ZM7A 2JLSA 5FI1B 3F5FA 3U44B 3L0IB 1JJ7A 3Q7QA 4ERNA 3GEIA 2IA5A 1E1QD 2OCBA 3ICEA 3BFKA 1UEIA 3W34A 1GNRA 1MT0A 2VA8A 1US8B 4NYMR 3H1TA 1BS1A 1A5TA 4OHXA 3ADDA 3QXJA 4LUCA 3O8DA 4JVSB 3VR5A 4IFEA 2X2FA 2BBSA 4N3NA 1GKIA 1E2LA 2ZI7A 4Q9HA 3WXMA 3OEEA 4IVQA 5J4YA 4CEHB 2MSCB 3SHFA 1EFRD 4OI4A 4AY2A 2PCLA 3FTQA 4TMKA 2EFCB 1GKYA 3CH4B 1P9WA 2REXB 1OKKA 1QVRA 3FGNA 1AKEA 1EFTA 2ZJAA 2C04A 4HI0E 1OFIA 4FCWA 2UZIR 2BJVA 2ATVA 721PA 4FD2A 5AK0A 4CF7A 4JBYA 4TMWA 4EQ6B 1JPNA 3C14C 4FMBB 2QSYA 1AGPA 5GJCA 4DLVA 4JL5A 5DSZA 5FTNA 3TAHA 2ZVQX 3QPVA 3AKEA 1JNYA 3QKTA 2ZAOA 3K53A 1S3SA 2XNDD 4F91B 3PEVA 3HR7A 2PCJA 4DBLC 2V1XA 4URYR 1LB1B 4C0JA 5KU1A 1S96A 2YOGA 1FX0A 3B8HA 2F1HA 4MUBA 2VRWA 1QG2A 2VEDA 1Z63A 1KSHA 2ZSFA 2V54A 1OH6A 1AQUA 1CR4A 3RWOA 1KAGA 4ARZA 2Z4SA 2ZVPX 4MRSA 1D6JA 2IYTA 1F60A 4KI0A 5EXSA 4DRZA 3B85A 4A1FA 3RS2A 3AF1A 1Z0AA 2CL7X 2QAGA 1G7CA 2X2EA 2YV5A 4NHOA 4B3XA 1IQPA 1F2TB 4D0LB 4WBSA 1UKYA 5KDLA 3BE4A 1MKYA 3AF4A 4KJZA 4MYUA 2ODNA 3QUSA 4QC2A 2CLSA 3R7WB 2EFEB 2ZRAA 2XTNA 1RFLA 4LBVA 3FHOA 3H86A 1VIAA 1ZC4A 4DLTA 4DSUA 2QT1A 5JMTA 1GSIA 4HAXA 3UKDA 4PQRA 2IL1A 2ZJYA 3TUJC 3U7HB 2XNSA 1DE0A 2E9SA 5EXXA 2FFQA 2CK3A 4HB4A 2I4IA 2HCJB 3QXXA 2OAP1 2RAPA 3NC0C 2PLRA 1Z3IX 4M9XA 4HDCA 3B1XA 2ZE6A 2JEOA 4GNKA 4RKFA 1HE1C 1E69A 4JLAA 4RZ2A 5IHPA 1E2HA 1P2SA 1QRAA 1KDRA 3L82B 2W0SA 4HZIA 2GHIA 3KQUA 3DZ8A 4NMMA 3KJIA 2GBLC 1Z2AA 2GDJA 5FUXA 3BK7A 2ZS8A 3N70A 1WA5A 1NBME 1EX7A 3CX7A 2XZPA 5FOWA 4JLNA 1ZD1A 3ZD6A 3FOZA 4I81A 4TLEA 4BECA 4ASUA 3B1ZA 4IVPA 2VYFA 1SXJC 5BN4A 1X86B 1Z5ZA 3HU2A 3VU9B 4ZCLA 3W5IA 2PJRA 3NH9A 3CLVA 3UANA 2QAGB 1KMHB 1G8GA 2GTPA 4TTPA 1GL7A 2O8CB 3I61A 4QG7A 4G5QA 1ZD8A 4JLJA 4EFMA 1LTQA 4GDFA 3KDSE 4YONB 1E2MA 3K0CC 3W3ZB 4EJSA 3THYB 4LBZA 2BKUA 2J45A 1TQ6A 2A5DA 1NSTA 1T3SA 2ZEJA 3DVLA 5JRJA 2WMOB 4A0RA 3CO5A 4JYCA 3U3OA 4LPSA 4QHSA 3SEAA 1IY1A 1KI6A 1WMSA 3CF2A 2QRZA 4BEBA 1MH1A 1XNJA 3HU3A 2RMKA 3BH6A 3MJHA 3BGWA 2ZR7A 3T61A 4BFVA 3D3QA 1XJCA 5JWHA 4UKDA 3UG6A 1WQ1R 3ZYCA 2ZXUA 5KO2A 3SC3A 1VG9B 3FB4A 3GJ7A 1W48A 3A8TA 3CWQA 5K8IA 3TJZA 4OK6A 3C8UA 1P2UA 4F7WA 2OXCA 4XD7D 3Q9LA 2YYZA 4TQUS 1NF3A 4EFNA 2ERYA 4Z8XA 3LD9A 1W0KD 4D80A 2I1QA 4HAZA 3UG7A 2QGNA 2BWJA 1ZMXA 3EARA 3HPQA 4NPHA 1G7SA 3IPXA 3QKRB 1KKMA 4A8JC 4D26A 2WAYA 2X77A 1Q1QA 3KFVA 2AR7A 2IS2A 2FDCA 1KJYA 1Z6XA 5AUPB 1GL9B 1GUAA 1VCNA 4JLOA 4D0GA 5HE9A 3P20A 2W6JA 4LJ9A 4BFZA 1HQYE 3BRWD 3ZH9B 2KSQA 2ZRCA 4D0NA 2LWIA 1ZYUA 1GP2A 2ZSAA 2OILA 5EZ5A 2VP9A 1X1SA 2WKQA 3I72A 1Q3HA 5JWOA 1UKVY 3LBIA 1S1MA 3OFNA 4Q1AA 3KJGA 2G9NA 1UADA 2ZRPA 4OL0A 3UMSA 2X19A 4TMZA 3T1VA 2WPDD 3OE7D 3VFDA 3PENA 1NN0A 5FL7D 4Q4HB 4BFWA 4B2PA 3BBPA 1N6NA 3CRMA 2IYZA 2N46A 5FL7A 4PZLA 5KNCA 1PJRA 1VG0B 3L8YA 4TMXA 1KK1A 2FOLA 1E3MA 2PZFA 2WJJA 4A8JA 3P26A 1NLFA 3SS8A 4O2RA 1M74A 4PZYA 4I1UA 3U3KA 3WYFA 1Q57A 4PHTA 1TTTA 4S2EA 2OSBA 1N5IA 4Z1MA 1KZ7B 5G53C 3A37A 1L4YA 1G18A 4IVRA 1UEJA 3KTAA 3S1AA 1UJ2A 3R9XA 3OIWA 1LF5A 3GCGA 3KB1A 1Q20A 1RRFA 2BEJA 5HE8A 2GJKA 1DG3A 2O8DB 2MSEB 4C9BA 2MMGA 1DO2A 2G0NA 4TQ9A 5JEDA 4TLBA 1GG2A 2OLKA 1RPZA 5FOTA 2LCFA 1E96A 4I99A
chains in the Genus database with same CATH superfamily
1PT8A 1WTCA 3IXLA 5IAGA 3TNJA 1MOZA 5KVAA 3H6HA 4M0FA 3C6BA 2H59A 3G7SA 1O5OA 3NOVA 4HNSA 1M0EA 1QBGA 4QQKA 4M0EA 5U9CA 1R4AA 3T6KA 1RE1A 4XB6B 3W6PA 3GFRA 3O93A 4CETA 4BTEA 5DNUA 2G77B 1T6YA 1XMVA 5HZHA 4JMLA 1GLVA 5JSHA 1RC8A 2Q3MA 5LP6A 3VNRA 1KFCB 2XB4A 4ZQIA 3RROA 4TTRA 4AICA 4EKNB 1FW6A 3VJRA 4TZTA 2IODA 1GTSA 4TZKA 3OF2A 2PT5A 3R7AA 3M6MD 3WA7A 4AKGA 1T8TA 3LYHA 1ULUA 5AM4A 4BO4A 1RRMA 3OZTA 3V4ZA 1PE0A 2AX3A 2IYNA 3QV1A 4NU6A 4R8MA 5HM8A 2O7RA 1EH5A 1JJBA 2A6PA 3L7AA 4U39A 1C8LA 3H1EA 5CVJA 3GFGA 3ZOKA 5HCUA 5LQJA 1C4XA 1B2LA 1PEDA 4EJ0A 1GPH1 4CFYA 1A2OA 4OEHA 2OC9A 4Z5XA 4L9SA 4GZMA 4BNLA 3OLYA 2VCEA 1OE0A 2D2XA 4C7JA 3NWBA 5F73A 4GI1A 2GN1A 5KC8A 4JGGA 3C3DA 1VBFA 3FCXA 3W9UA 5KQSA 2FPGA 1VA4A 2I22A 3ZDBA 4FNGA 1C8VB 3SYLA 2FSHA 2P75A 3BSYA 4XFJA 3OPXA 4WZAA 1WSBA 3X1XA 1NYTA 1QYVA 2HRZA 2AOUA 5LIPA 4F9TA 2WIJA 1T1EA 2X41A 2XUJA 1EPUA 1F2VA 2NVWA 3HN7A 4FFPA 4HDNA 4HYYA 4UASA 3WB1A 5JZSA 3MMZA 3A9SA 4HGZA 5CIYA 1WW8A 1EZ1A 1I4WA 4REQA 4BGVA 1SFRA 2RGEA 5B4VA 4G8DA 1ZBDA 2CJXA 3CZAA 3PNQA 1CY7A 1MIHA 1DJNA 1XDDA 2ZANA 5DDIP 3ADKA 4S12A 5E6UA 2DX7A 1WY5A 4AYTA 2XCQA 4N01A 4G5GA 5DI9A 5G4LA 1YU9A 5KX5B 4HVLA 3L4KA 2O6LA 3EGXA 3W8FA 4WZBB 3M1IA 3EMDA 4DIKA 2JAPA 3D6AA 1T1RA 1XTIA 3RIGA 1DJQA 5L3RA 5CD1A 2C5EA 3UUFA 2NU9A 4ZN6A 2NLOA 1BH6A 1XMXA 2P69A 4IEIA 2Y1XA 3AF0A 5K2OA 4KO8A 2J0SA 3WTCA 1FFYA 1VMKA 3QFHA 3RC9A 2BFNA 3PFHA 5J23A 3ZWWA 3RANA 1CEYA 2OP0A 3WMWA 1CERA 1EQAA 3IMGA 4FMDB 4TT3A 2VYVA 2BFFA 4Q9AA 1XF9A 1IZ0A 2HXSA 4HP8A 2PDAA 2GXUA 1MP0A 4KSBA 5M5BA 3A1NA 1OBVA 3NG1A 5HKLA 4A0QA 2QF7A 4FE3A 4WACA 1JEJA 3E9QA 3MBIA 4IHJB 2GERA 4P2BA 2PRZA 3ELDA 3H5LA 2C1ZA 1RXVA 4X85A 3UJ6A 2C9OA 2XF2A 3CLKA 3RTGA 1A9OA 1A9RA 2I7VA 3IOMA 1QAMA 2P4SA 2PLAA 3TNFA 5F7XA 1QOPB 5KTKA 3R6TA 3WIVA 1SXPA 1PV4A 4DRXB 4CIAA 5FOUA 3DD1A 1UWVA 2PX4A 1G5HA 3A0UA 1BCRB 5HF8A 2B7BA 5JS1A 1GTG1 4RVFA 2JCBA 4YCLA 1OPRA 5BV7A 2GKGA 5M04A 4IJQA 1CRPA 3K4HA 2WU0A 4UUBA 4JYBA 5EE0A 2GXAA 1ODJA 3JD2A 1XPUA 3KRTA 4PG8A 1KYIA 2ZAGA 1Q7EA 4TXJA 1Y6GA 4EL5A 3SEZA 1UBFA 1ZA2A 1VYUA 2JRCA 1WBDA 2BTEA 2UXCB 3IAHA 2ZWOA 2X5OA 3SEQA 3UH0A 2VAXA 3C1OA 1J0CA 3AEKB 4I1PA 3O92A 4B2IA 2EL9A 2R3SA 1Z6AA 2YYAA 2CNWD 3W6NA 1QHFA 3CNEA 2AMYA 4DDMA 2B7CA 3HM2A 1YFJA 4J0DA 4EL0A 4EO9A 4PXYA 4RVUA 3THXB 4JXZA 4HDRA 3CJTA 3KDPA 1E2GA 4US2R 5JY1A 1ZOSA 4QGGA 1GRQA 1FNBA 1J2YA 1RZ3A 3KXLA 2PUDA 4FBGA 4G0OA 3T35A 2V1UA 4P3YA 3H18A 3NMUF 4LQDA 4YDRA 1CTQA 4XLLA 3OESA 3IR7A 2HRRA 3I53A 1PSDA 4ETWA 5EWJA 4OUDB 4WBXC 3WGOA 4LYFA 3D7MA 4IHKA 4I0WB 4YB8A 2MJLA 3F8WA 2G04A 4RCYA 5ITWA 5JMPA 4ZI3A 1E3SA 4Z3DA 2ZTVA 1HEUA 1B76A 4Y1EA 1G5IA 3DHWC 3MHPA 2FP4B 4S1PA 1QIMA 4BZPA 5F52A 5I5EA 1X15A 3E7DA 1YZFA 3PX3A 3QA3E 2REQB 4O59O 2RHMA 1FTNA 2VHEA 2X1VA 2B2NA 4ZQGA 1M2KA 4DCMA 2BCJQ 4GOLD 1BX0A 3EXG1 4Z0PA 4XEUA 5DCWA 1L5KA 1W6RA 3SY8A 1QF7A 1Y8RA 2JFWA 4JC4A 1FP7A 3QI7A 1GPDG 1DRWA 1QUEA 4GQAA 3VPCA 2Y76A 1YDMA 1YB7A 2CUTA 3GXOA 5IT4A 1PBNA 2LRHA 4P5PA 3TLXA 5IT0A 5A0TA 1L4LA 4HXGA 4Z8YA 1XEXA 4ALKA 1J1ZA 1NBAA 2HA3A 1QIDA 2QP3A 4A2WA 4N7BA 1ABFA 2BKXA 1TTHA 3EIFA 3HCWA 3OM9A 4KV9A 4KGDA 1K7FB 2HD4A 4MV6A 4R2HA 4ZV9A 5IT9A 4HYTA 3DDSA 5DYWA 1H9BA 5CDGA 1CQJB 3TLGB 3B6MA 1OD6A 5JTTA 1YI0A 2KWIA 3QX8A 3C3EA 4FQ7A 5ARDA 4LZWA 3SJAA 1HI9A 1LTHR 4K6OA 1H66A 4KAAA 3WWEA 1PNVA 2CDAA 3DF7A 1WDTA 2YYYA 3ISTA 4LSGA 2SHKA 4TXHA 2C2BA 2R1VA 2XTJA 4KXQA 3A1VA 3UATA 3E2MA 1OREA 1WG8A 1Z3CA 4DA8A 3IAS1 3CLSD 2W2LD 5TPWA 3ELBA 1XK6A 3PLRA 1LBIA 4XFKA 2PPVA 2Z8XA 4Z99A 1DU4A 4UU0A 1PWZA 3FUWA 3IQZA 2V3CC 1TW3A 3R09A 1P6XA 1RS0A 2CJPA 2HFJA 4YALA 2FMHA 4JL8A 5LU9A 2FQWA 1L8QA 1V5FA 3EMKA 3GI1A 3LCCA 1V1JA 2JJYA 3LLUA 2FP4A 4NZNA 3LO5A 2GLUA 4I50A 5LQSA 4E22A 3QEAZ 2W8ZA 1U8AA 3H13A 4ALLA 1HDCA 2C96A 3IAS6 2XCOA 3M6UA 4X97A 3FSGA 1XVAA 3WICA 2IHKA 3GJ4A 2FUCA 4B80A 4BJ1A 1KE2A 4FDVA 1FYFA 2B0CA 4D99A 1Y6RA 1XL0A 4TTIA 1WS6A 2C3UA 3JPWA 3GFBA 3N0WA 4IH9A 4DV4B 5BVGB 1VL6A 5BNFA 2L82A 1R6UA 2R6FA 3QLVC 1CJTC 4Q4HA 4KEAA 4NV1A 3WKDA 3R9KA 1V3TA 5DWDA 3THXA 4PHGA 3MMXA 3I6QA 4FFDA 2WJ3A 5ESWA 3IV9A 4AO6A 4R8LA 1IM2A 1FOEB 4A2QA 4IDEA 3KM0A 4Y9DA 3ESRA 5IULC 3WDSA 2O5EA 1H6CA 3P2KA 4D5EA 3VZQA 4PSKA 1F2UB 2RHWA 3K8ZA 3DA8A 4IV8A 1LW7A 1JHRA 3JS5A 1YCDA 3H1AA 3MUOA 3VNUA 3KEFA 4B2YA 3NAZA 1T3LA 2JASA 4B7CA 2FRXA 5IVDA 2VIIA 3OQNA 3V4RA 2IXDA 4WD3A 1PJ2A 1ULZA 2QX4A 3DMPA 5E4FA 1FC0A 4AAYA 4GR4A 3M6IA 3NHJA 1L8LA 3GGCA 3V4FA 1ZGJA 1W49A 1Q7BA 1HL3A 1I7PA 1NJ2A 4LK3A 4URZR 1NXXA 1Y3CE 2WQZA 4UVEA 4EJ6A 1UPTA 1VPWA 2NAPA 4TV9F 2R5FA 3PPVA 1D2MA 3JWEA 4MTCA 1NP3A 4S1NA 1LDNA 5KZMB 2HN9A 3MG9A 2IHTA 1KBOA 1R5BA 2DHCA 1CEEA 3QX3A 1CJUC 4NZPA 3KKZA 5IS2A 1QOZA 4C2UA 5EHNA 3ROXA 3IOEA 1A2BA 1UM9B 2MHCA 5F5LA 4DY4A 1QYCA 2PXHA 1SQ0A 2CCGA 2PKCA 5HJ5A 2QRMA 1IEQA 2O57A 2RH4A 3GYBA 2PAFA 3ZIDA 3FUXA 5FDFA 1KSJA 1DDGA 1TFRA 1ULSA 4GM4A 4H6VA 4RJIA 4U2FA 4YRTA 2GZSA 3AHEA 3UHFA 3NUQA 3ZE9A 2R47A 4R2WA 4JYZA 4RO0A 3ZCXA 5E4YA 5HNKA 1UK6A 2R6HA 4ZC8A 2RB4A 1KI2A 3GNTA 1A27A 4HZUB 1YOVA 2Z6VA 5CM9C 4V0RA 3LZDA 4OHVA 3WYGA 3HNOA 2O7NA 5AVOA 4K0KB 3AH8A 4Y6OA 1JBQA 2D54A 1LQ2A 4JJ8A 1OLXA 3UHJA 2B92A 4UCXA 2Q4EA 3EQ8A 3K16A 1N3LA 2GK4A 3MC1A 1P1RA 1UUFA 3NASA 4LYHA 3QIVA 1F4PA 2GBPA 3FDFA 1ND5A 2V7PA 2XUGA 3PEEA 4Y3UA 3SYNA 5FHRA 3I1YA 4RWZA 2QXYA 3EAGA 5AW1A 5A05A 1BJTA 4FK8A 3L18A 3GJXC 4OI2A 3G0OA 1E0AA 2WD9A 2FN7A 2O1XA 3UH1A 3EODA 1XTJA 3MLEA 3DEFA 2CFOA 4J1SA 1G9SA 2QROA 4Q7QA 3WRYA 3Q11A 1RW4A 3I6ZA 3TBHA 1PTJA 1E7YA 2WHEA 3EGEA 4K40A 1G64A 3N5KA 2C7VA 2E18A 2IW1A 3F9CA 5EPEA 3AF2A 5ED4A 4P84A 5FBKA 2ACWA 3RE1A 4EZBA 1U9CA 3LPNA 1TX4B 4I55F 4ZVOA 4FHCA 2VP6A 4UCFA 1P73A 1QAOA 1JXMA 3GT3A 1C9JA 4M8NE 2DBZA 4P4SB 4FMCB 4DLRA 1XRMA 5KUTA 3LHIA 1L2TA 2EATA 3K32A 1KGDA 3K3PA 3OSUA 3VHLB 4NENA 5CM8B 4P7JA 4G4GA 2E21A 4QOGA 3B5IA 3P32A 5EKXA 4FMCF 3VJLA 4V0NA 3MRSA 2FQXA 1G17A 1TM5E 1QG6A 1SK8A 1TJPB 3C5HA 3I9NA 4JHXA 2VP4A 3F6PA 3NUZA 5FLKA 4B45A 3GJRA 3T7AA 5EHGA 1UQRA 4N54A 2R8XA 4ZYZA 4YJGB 4Q01A 2CHQA 3TW0A 2OOSA 3IPLA 3UB3A 1P4AA 1C3VA 2EL7A 3GWGA 2HYDA 3ZS8A 3VBEA 3IQIX 5FA8A 1OF1A 1WB4A 4MWEA 2IUUA 1SHJA 2WWVD 3LQ4A 2IKSA 3UXEA 5JSZB 3WB0A 4N4AA 4G09A 4AZVA 4QU9A 3WK7A 4RIHA 3O8BA 1FMJA 1JTEA 3DEYX 1NURA 1QDUA 1HMYA 1BQEA 4IDAA 1ABBA 2C2ZA 1V41E 1ZU5A 2V7QD 5FTJA 5F35A 5FWAA 4B73A 5HOQA 4IJKA 2NXCA 1RSZA 1AA9A 2H2AA 2WW8A 4H1VA 4IMRA 3KJNA 4OM7A 4PIMA 3USCS 4B35A 1KI9A 1THMA 3AOEC 4N8SA 5AW3A 1XJ5A 3ROEA 3GCZA 1WXHA 1NNUA 2CHFA 4CM6A 3GZNA 1DQNA 4CF4A 2WSMA 2WV7A 3L0DA 4X1KB 2QHXA 5BXQC 3WRXC 1C7QA 1OBFO 3A6ZA 3LBNA 2CHEA 3NHBA 1V6AA 5EZYA 4KRGA 2G3YA 4GWKA 2I3GA 4TTJA 4D9FA 3FOAA 4LE1A 3M82A 1Z5PA 1IXZA 1OILA 2HSEA 4QJ5A 4U1RA 2QYTA 3B6KA 4MP6A 5EAIA 1ADGA 3A1WA 3DLAA 1ZVJA 4IH1A 4F60A 3VJMA 4P81A 4Y0AA 1U2QA 1KS2A 2O3QA 4HQRA 4XD7A 4B7ZA 4D9JA 1XQ9A 4AJ1A 3CKMA 5JMWA 1IOWA 4PFKA 5LA6F 2Q4OA 4RGQA 4TRMA 5GVSA 4RF5A 1G4AE 3FPFA 2P3LA 2YH2A 4YS6A 4PPNA 2EJCA 8OHMA 4GC5A 2IHZA 3WNZA 3TCXB 5H8WA 4BQQA 3WGMA 4ZICA 1HYGA 2X7XA 2KBFA 4K6KA 1CW2B 1T25A 4A8JB 4CZ2A 1AD2A 1MD9A 1Y4DE 2PZEA 3BORA 3OLVA 4CQLA 1T8PA 3DUFA 3HBAA 4JBWA 2RKOA 5LB4A 1WDWB 4LNAA 2RGNC 2ROQA 3A28A 3G79A 2ST1A 3P4UA 5EERA 4S24A 2A0YA 4R9SA 4EVIA 3V33A 5FOXA 4QXAA 3WAJA 5C18A 2W7TA 1A98A 4HWOA 2OK8A 1JV2B 3WJ2A 1IHDA 1JVSA 3ICOA 2YHIA 5FP0A 1UBUS 2BY4A 4L7QA 4UUNA 1G8HA 2M6LA 1N6PA 2HNAA 3P71T 2BLNA 2MR5A 2R5NA 4L5AA 2C97A 4OAQA 1U7ZA 4PYOA 5F33A 4MV0A 3H5IA 3TI9A 1YZYA 3F6YA 5I7WA 1WRBA 1F9AA 4J8PA 5GP1A 4EQZA 2ZETA 3HXPA 1A3CA 4F2GA 4F92B 5JZ9A 3EZLA 2BVNA 4PXAA 4TZ6A 1DIRA 2Y0CA 1XAIA 4BNKA 4W99A 2QZSA 3INTA 5F2OA 2ZIVB 2O3TA 1A4IA 3QE4A 2BMAA 3N2YA 2X1MA 1L5HA 1PCXA 2E82A 2CJWB 2DAPA 4BGUA 5ARCA 4KR3A 1COWD 1JPUA 2XHZA 1TMGE 2GFQA 3U3JA 3TQIA 4NCIA 2QVYX 4LXTA 3ADOA 3LW8A 4JJAA 2X58A 1GKLA 1BS2A 3C3XA 3FX2A 3NHKA 4K2AA 3V3TA 3EB9A 4BKQA 4YUWA 5D6NA 1A97A 2F7SA 3OTHA 2ZBVA 2V58A 1XVTA 4JP5A 1XRQA 4KXUA 1KIMA 1R8SA 5D2CA 3V8EA 3MUFA 4M53A 4WY5A 4ZA2A 3V7WA 3R2JA 1G9XA 2L18A 4FHEA 4B9AA 4ZFNA 3E1SA 2NO4A 4LJ6A 1Q0HA 3KT6A 1RI3A 1X14A 1ZCAA 3GDWA 5AHRA 8GPBA 2WD8A 4E2FA 1JQJC 2FWNA 2QN7A 4P08A 3B13B 3TOVA 2XZDA 1H23A 5ALDA 4CM3A 1X92A 2YWCA 2QRUA 4E0BA 2DLCX 1CNEA 2ZBQA 1SXHA 2FZVA 1V5EA 1I3KA 4UFPA 4ND1A 1P5FA 4L95C 1Q15A 2WJPA 5AKKA 5TPZA 4Y2JA 4AP6A 2CLEB 1SHZA 1YB1A 1RJFA 2VZEA 1QHIA 3HB4X 4P6VF 4IIFA 3BQNB 3SAJA 2WVGA 3WKAA 3ZV3A 1ZVMA 1ZH8A 4NYIQ 3R7FA 1VGRA 4M89A 4DMHA 3T94A 4BO1A 4BFLA 3L8MA 3R0ZA 1YZUA 2N3ZA 1DUVG 4C7KA 2Q4RA 4LXYA 4ZVMA 1FU8A 1I8TA 4FB4A 3HVRA 4MHTA 1M2OA 3TD2A 4JGBA 2IC5A 1ZICA 3SQLA 3DR3A 4H59A 2J3LA 2OFXA 4RADA 5FBWB 3WZ2A 3WL6A 4CHGA 4C0LA 3JR7A 4PLWA 3AIOA 2GD0A 1QQTA 4M76B 3ZCQA 3EVFA 2BEVA 4DGQA 3KKMA 2FRDC 3R6DA 2HWYA 1HZJA 4ZI7B 2BAGA 4GZLA 3BCSA 1U8YA 1Q0SA 1UDBA 2H17A 2ZYVX 4NU5A 2NYAA 5AHKA 1XU9A 1SY7A 4I5GA 2JAQA 4UJ5A 3RVBA 2FWPA 3SZGA 3J80A 1QKIA 3GZ4A 3F7NA 4E2XA 3A6HA 1XAHA 2I80A 2GBIA 3B6IA 4EY3A 1KQ3A 4YLYA 4XCXA 5FX2A 1L1EA 4CMHA 2Q2QA 4RBNA 2B2CA 4QAQA 5MDHA 5JZMA 2FY8A 1YUNA 1F51E 1HFWA 3AL3A 4FILA 4HRYA 2DP4E 2BISA 4EPYA 2AN5A 3UWPA 2C03A 5CH3A 1S6YA 3KV3O 1PZGA 2MINA 4UNNA 2JLXA 2BM0A 2YR0A 3KR9A 3ZK9A 4MQFA 2X7JA 3GXBA 4EG6A 4P93A 4WK6A 4AROA 1ZISA 1KAQA 2PGLA 3KB6A 4ECAA 4B3SB 1LBSA 4EMBA 4LZJA 1RWWA 1IUOA 1XAGA 1G8KA 1PHPA 5B1SA 3Q5DA 3ROPA 3ZC3A 4CM4A 5TF4A 4RLFA 1HPLA 2QQ5A 5J9FA 5HTOA 1HTTA 2ZWMA 3DEIA 1FTWA 1TUGA 2JHGA 1W0JA 3TSZA 4DYVA 5DMXA 1D1PA 1DAFA 3HY6A 4H0NA 2X0DA 1KRWA 3UFXB 1NVKA 1LF0A 1OIVA 4J94A 3O1JC 3GJQA 4P7FA 3AHDA 2GYVA 2WWFA 3HJTA 4BO0A 5K3OA 3GZJA 3G8BA 1EFPA 1S2LA 5D3ZA 3UGTA 4IZHA 3VR4A 1QQ7A 1K2WA 1SHTX 2FI1A 2JLWA 2Z56A 5KCMA 5CA1F 5JPIA 5EHXA 1EHYA 3ME5A 3Q3IA 3QLTA 4WVLA 3HK2A 3GV0A 1E9FA 1MDFA 2QLLA 2C4WA 4C89A 1N5OX 4JOSA 1K4YA 4DMRA 3I3SR 5K0EA 4PNEA 3KXPA 5MN6A 2WEKA 2NVOA 3RHSA 4BMYA 2QUZA 2WA1A 3KBBA 3NTUA 5EWLB 4CTOA 1NAHA 1D0VA 1BC5A 1DI0A 1F6WA 1PJQA 1R6AA 2VOEA 1FXUA 4QODA 2OV6A 3WJ1A 5SZKB 5CYFA 4JI0B 3ZDQA 4REOA 2TMGA 3AFGA 2R8YA 2WFZA 3N7AA 4GPBA 1U94A 4E5DA 5CTJA 2H0AA 4V1CB 5IG2A 4KKXB 1KZYC 3EVAA 3TZQA 3VR3A 1SWVA 3A11A 1U6KA 2F59A 2XQJA 3RS3A 4B4KA 1EZZA 4O4HB 1E5LA 1X7YB 2HWUA 1Q3TA 2QY9A 4R1UA 4DNPA 4NP6A 1JHOA 4ROTA 1N2CB 3SIWA 1CXZA 3EQZA 1FF9A 1KJ8A 1XWWA 1T3GA 2JDID 5TVGA 2GK6A 4AZSA 3SM3A 1Q16A 3MNFA 3U40A 4EGFA 5KKCA 4DB2A 7MHTA 2ONZA 3H16A 1RTKA 2VSQA 3KB8A 5TT1A 5HIKA 4FVTA 3UWOA 5EP3A 3W05A 5E6RA 1AM4D 2RGXA 2ZVJA 2OENG 3GVCA 3LA6A 3V7FA 2F4VB 1XRNA 4NDAA 1YVDA 2G6TA 1I80A 5D01A 1G5TA 1XDBA 4AJ2A 4UDNA 1SB9A 4W1RA 2EYQA 4H27A 5AKLA 5LQMA 3V9AA 3T3GA 2GEJA 1NMEA 1NXWA 1DCMA 2I7DA 3BMXA 2FN9A 2GF0A 1MO6A 1U9ZA 2FPPA 3SCZA 3RUEA 3N3AC 5A6VA 1Q6ZA 4YP7A 2B5VA 3DTVB 4WCFC 4LOKA 1IRXA 5E2IA 3W2IA 3E7PA 3I6BA 3EGOA 3FY4A 1XSEA 3R9WA 4LMPA 3IIEA 5LDDC 4HTFA 5E7IA 4OXIA 2GMWA 2ID9A 4OOEA 3TDKA 3CWCA 4DDUA 4BUZA 4KWEA 3RBVA 4Y2VA 4YMHA 4MI6A 1P7WA 3ZWQA 4UXHA 4AWXA 4NI5A 5HKKA 1U3UA 3IHTA 5CJPA 2JVIA 4INOA 5BN5B 5FI3A 3BSWA 2SNIE 1KO1A 5G0UA 1N6LA 4HH1A 4TSRA 3TS1A 2WWWA 1LX7A 4GP7A 2JATA 1WHTB 2OL4A 3MMSA 5CIQA 3RC8A 1SVNA 3WGTA 3KYCA 4LPKA 4CTJA 1RFGE 4UMFA 4O2BB 3R7LA 2EBWA 2UVQA 5LP6C 1IU9A 4D3DA 4MUHA 3CURA 1PAUA 4RHTA 2AW5A 2IP2A 3DPIA 4NNJA 2XB9A 2A1TS 1E4EA 1JEOA 2CXQA 2WT9A 2PH5A 2XYQA 1W19A 2V6JA 4O2AA 3K9BA 2J3QA 3NGMA 2JCXA 4QXOA 4CCWA 2FW6A 4ERXA 2FPWA 1D1SA 2PZLA 2TYSB 2H1CA 2VLIA 2YIDA 3AY3A 3OQVA 4U9UA 4JI5B 3BFXA 3LFTA 4ZJZA 1NRJB 1PNOA 2HQRA 1II0A 2I2DA 2O0MA 3S1AB 3K9WA 2XJ9A 1ZOPA 2IK8A 3K35A 4K9MA 1GNTA 1N9GA 2PUAA 3T7CA 3HKBB 2Q3LA 4Q4AB 4D92A 4ENQA 4KVGA 1IXRC 2I6SA 4RD1A 5CB8A 3G2OA 4M83A 3UW1A 1MVNA 3BGVA 3JW8A 4QGHA 1CC1S 3O0TA 2FZEA 1ENOA 1AN0A 4GMKA 3N86A 2JARA 3ZIUA 1EDBA 2HUNA 3KDAA 4KQCA 4LVCA 3NWEA 4NL4H 1GZUA 4X8MA 2EBHX 1YOBA 3BHMA 2NSYA 1U7OA 2ZYTX 1E62A 3T3EA 4HUJA 1Q1EA 3I28A 3WX0A 2B4TO 1J97A 3WLRA 4F1JA 4FCVA 1RXEA 1KK0A 4OIFA 4DSZA 3HXTA 2WU8A 4J6EA 3BJIC 5FUBA 1TF5A 1E32A 1XJQA 2WD7A 2AXQA 4UZEA 1ADBA 1IHUA 3KELA 4Y1RA 5DGTA 5BYAA 4P7GA 3TLEA 5J3JA 3H97A 2B1IA 4XRGA 4PLPA 5EE9A 3PJFA 5DM60 4R1PA 1TA9A 2RB5A 1NW7A 5K3DA 3EE6A 1FLVA 3IQXA 1KOLA 2Q5QA 1Z7EA 3OOHA 1P3JA 3KD2A 3ODPA 3ZU4A 4BEJA 4EBFA 3SS9X 4DA9A 5L6MB 5B58C 4D4IA 2VZ9A 1POWA 3DW3X 4MW7A 3TW4A 4PU0A 2C20A 4Y1GA 1UK7A 2RG1A 1OA0A 2W2PA 1S89A 1SEPA 1T36B 4D4KA 5I7SA 1QXSA 2OHHA 2ZYGA 4PZEA 5CRIA 2OHVA 4AXXA 5LQUA 1IPEA 2ZAMA 4GGOA 4KWIA 1YB6A 4JLVA 1LS1A 4XWKA 1E1NA 2YZ2A 3VR5H 4FDLA 1HE8B 2EBUA 4HZUA 5ALXA 4YRSA 4E5KA 3AYXB 2PVSA 3VVCA 4QPPA 1NNSA 3RAPR 1NXSA 3KL2A 3TE7A 4MX8A 3RRXA 3DE4X 4ZPJA 1VIVA 2YC4C 2B69A 1BYIA 3MXOA 4LQ4A 4ROSA 5HJ2A 5AUNB 2WTAA 4JUIA 3ITEA 4MDHA 4ZO7A 4YMGA 1NKSA 2GXSA 3MWKA 4MS4B 1K86A 4UOQA 2F17A 3FBTA 2IY9A 3WLSA 4QOSA 3HBLA 1EIZA 4LGVA 5A02A 3E8MA 1GA6A 2ZT6A 4P4NA 5FLYA 4RUKA 3VR6D 2C7QA 3V1KA 1UR5A 1YQQA 1ODKA 2CYBA 2OBFA 1RABA 2OAGA 4IQ8A 2ZSDA 4OLFA 3E9MA 4V2IA 4EDHA 2XRYA 5CCDA 3TIIA 2FF5A 3ROKA 5F64A 5DJ5A 4E32A 5CX4A 1R8YA 4D46A 5DYGA 5E7MA 4TWRA 5HTKA 1V47A 2FUNB 3OJ0A 1IE3A 1NF9A 3STVA 3WO0A 2A1UA 4LECA 4ZO9A 1XKTA 5F5XA 1Z5NA 3D5EA 4A26A 3QFSA 4P3KA 4IGIA 2HT6A 4KPYA 2H5JA 2C99A 4IKOA 4PO1A 1E79A 2I0FA 1M1NA 1QCZA 1YC2A 4BVLA 3CW9A 5K3EA 1A5BB 4ZVRA 1X70A 2IOYA 2RCYA 3FGZA 1T43A 5C1IA 2BKLA 1QK4A 3M1YA 4GP6A 4GLJA 3KAQA 2YJZA 1NXOA 1S2GA 2WZQA 5GIOE 4OU5A 1JTVA 1N2HA 3EFHA 4OUKX 5B6IA 1OOEA 4CHTA 2ONKA 4BGDA 2FPMA 1AK1A 1SCBA 2NV0A 3LY7A 2ZR8A 5K1ZA 4ARIA 4XPZA 2RKBA 2WM8A 4FWIB 3UOAB 2DWUA 2VWPA 3FKSA 4ID3A 1D09A 2VZ8A 3FKSD 1XFAA 1DARA 3IBCA 3KHSA 4QDJA 1PW5A 2HF7A 3A14A 4E31A 4O2BA 2WSSD 3WP1B 4EY8A 1KFBB 5HZKA 2P0EA 3PUYA 4HEQA 5FUWA 1ZLYA 2IIVA 3GJSA 1IULA 4I4TA 5JAHA 3F46A 2Q3JA 2HPHA 2WBLC 1JEQA 2OO5A 3IVRA 4ZI7A 1JSXA 2VQSA 1QIHA 5K0FA 5FI0B 1SBTA 3ZHXA 4QM6A 1UH5A 5KNDD 2XBLA 2CD9A 3SXUA 1L3IA 3PFWO 4EPWA 5JRZA 4O5OA 3ETLA 5EPUA 3ENNA 3KU1A 3R0JA 2R1UA 3ETGA 3FCUB 3ON5A 2VPTA 3J7TA 1B15A 3SWWA 4G9GA 2DMRA 4OMUA 1QU3A 1J5PA 2JA1A 2R8ZA 2JVKA 3IAM1 1MABB 4LK2A 2L0XA 1RYNA 3C3BA 3CH5A 2C94A 1VHJA 1CDDA 4J0IA 3PIIA 2VSXA 3QKUA 1V7ZA 2ODEA 2R7AA 4EHBA 3KU4A 1E77A 1EDDA 2WVHA 3EJWA 3FAZA 1SCDA 2YQZA 5DBHX 5EXTA 2PUGA 3C7DB 3Q10A 4COOA 1RLJA 1U3GA 1WMAA 3KZNA 4HFMA 4CIYA 4QJBA 3VU1A 4XTCS 3L7LA 3PXAA 4FGUA 2X5JO 3AUUA 3RJTA 4RETA 4C04A 3LTNC 4MTLA 3LUJA 2ZI6A 1M9NA 3L6CA 1DC6A 5L3QB 2V6GA 5CR9A 4C43A 2OHFA 2YXPX 5CFNA 1XQVA 3KKKA 3MCVA 4DLUA 1CQIA 4FPXA 4KPUA 3RASA 2ZR9A 2NPOA 4W5JA 5DCUA 3DL0A 3VZRA 9ABPA 4A16A 2JFHA 5BNTA 1DBWA 4LBYA 2QUBA 3ZY6A 1G63A 3LCVB 4NNPA 1RQPA 2DQZA 4JXJA 4GX1A 2Z5VA 3BA6A 1ZXXA 5B7NA 3RREA 1P4HA 2HBZA 4OA8A 2BFCB 4ZQEA 2OXRA 4D6XA 3KFXA 2CXHA 4OG2A 3OHMA 5BW8A 4K03A 4Q05A 2QTAA 2IEYA 4RZXA 2R2AA 2V4ZA 1JR2A 5C35A 3ZVLA 4IIHA 3SHVA 3UAVA 2JLYA 1HFEL 3JZFA 5B58T 1BX1A 1MRNA 1T4DA 1Z2PX 2JIZA 4FJ1A 5B2EA 5TLSA 1ODTC 2GTIA 2LGJA 2GPTA 2QXTA 2WP0A 3NFYA 4MYRA 3CZQA 2AUMA 4LIPD 3CEHA 1RLTA 3N75A 4HEJA 5EWLA 1P3DA 2JPDA 3BWMA 1Y1LA 2HRQA 2H16A 4MMYB 1K8RA 4O5AA 2P6UA 5G3YA 1J8MF 1NATA 3Q0EA 4QRIA 5L3ZA 1N4AA 1S9DA 1U1DA 4PCUA 2AWNA 1Z68A 4GE3A 4ZARA 4BWFB 1MB3A 1TZKA 2OAEA 3FHLA 1LC3A 2W58A 2ZPUA 3OCXA 3EPRA 4NAHA 5F1YA 3VVMA 5ICGA 3Q5EA 2H4ZA 1J99A 3FH0A 1CRLA 3RKUA 1CZUA 3ZU3A 2JANA 1W88B 3TLAA 2A92A 2YWRA 2O1WA 1KO8A 2VXOA 3A1DA 3QVKA 4LJ5A 3THSA 4MGZR 2M6RA 4MLCA 5DWQA 1FDSA 5IKXA 1G3UA 2VA9A 2ZBGA 5LSAA 3GAZA 4FE4A 1VE6A 4KPUB 1R9GA 5JE8A 1ILEA 4AULA 4Q03A 3TTVA 4OQPA 4WBNA 5AJYA 1V16B 1SOUA 4S1VA 3U31A 4ABYA 1D2GA 3I12A 3PGXA 3O8QB 1RJDA 4KBFA 2WYOA 4P5EA 1I30A 1NX9A 1PG2A 1TVCA 3GH3A 3KQHA 3OQHA 2C54A 2CEAA 1C0EA 5BN4B 1PL6A 3AY6A 5CYOA 1PZXA 1CZOA 5EKTA 3VSDA 2IOHA 2ORVA 3BIWA 1DPGA 4EAQA 3MBOA 4C29A 4CKYA 3EXG2 4CXMA 1JLMA 1HDYA 1QOQB 1VJGA 4WFIA 5ESDA 1QG0A 3IBYA 2HX1A 3Q7SA 4HH0A 3T38A 3QLEA 2CVHA 4UHKA 5AJTA 3CZ4A 2HJHA 2AN9A 3PUVA 3Q98A 1O5TA 3R3UA 4KR7A 1ZM9A 1L7QA 4M46A 1L1QA 1UZNA 2NO6A 4FLEA 4PZ9A 5AOVA 5T4EA 3STHA 4AYWA 1IAVA 3I92A 4C7XA 1GO2A 5BSEA 5H4GA 2XXAB 3E05A 3SBDA 3HO8A 3AHGA 1USKA 2AV6A 2RHRA 1S5PA 1M2EA 2Q9UA 3B60A 3SS7X 4MUGA 1N8KA 1MX5A 1EAMA 3T8YA 4DC1A 1B43A 4WKNA 4WKOA 1RKUA 4BL5A 3OPYA 4WOCA 3BZWA 4LV8B 1Y8CA 4D3ZA 5EKDA 2P7HA 4Y2XA 4CM1A 1RMQA 5JD3A 4EARA 5L4LA 4IF4A 4MS4A 3Q7PA 3CLSC 1YE8A 2O2GA 3HQ4O 5CMLA 3VPBA 2N9UA 3DWFA 3IALA 5G1PA 1FBTA 1J5EB 3F4KA 2VNKA 3PVCA 3EGCA 1C9KA 4PNZA 1O9BA 4CT5A 1IQUA 1TL7C 2QRJA 5AW6A 2HU2A 2SKEA 4HFJA 4JQCA 3UAGA 5JSQA 2VK4A 3D6MA 2I2AA 2JJ2A 1OCEA 3C85A 1J8FA 3W78A 1KSFX 3COSA 2WZBA 3QEBZ 2IE0A 2Z95A 4DEYA 4YAIA 1DWQA 4YCNA 2FEPA 3O8NA 2PD6A 1O97D 1CLUA 1DJOA 2QJRA 4PE5B 1X8LA 1VKZA 3CYFA 3FB1A 4IV5A 3RBAA 4QDKA 4FR5A 4WKBA 4XGNA 3HXQA 1RKQA 1I2DA 2HCTA 2O2HA 2A88A 1W2GA 1YFZA 5TARA 2XE8A 1RNLA 1GZ3A 2YFHA 2I6GA 3Q1KA 2VK8A 2IYVA 1AS0A 3FCEA 3FMIA 4G0MA 2GRJA 3WBFA 5EIFA 2QZJA 3WS7A 1E3DA 1WEHA 1ZJ6A 2BHNA 2GPBA 4KOAA 3OT4A 1ESDA 2GJ4A 2N75A 1AN9A 5KNBH 4BUCA 1PWYE 5CH8A 1XVVA 1N5JA 1ZRSA 5EP2A 2R6JA 3NHUA 1UKZA 1JVBA 1ZUNA 3UAXA 1AKTA 4YAKA 5K05A 3R7NA 2MSDB 4Y18A 2Q27A 3UYKA 1K7CA 3H2JA 3CBQA 4IO0A 5F5NA 3HWWA 3HHEA 3TUIC 4CKWA 1N6IA 1RMYA 3MJ4A 5JVDF 2FHSA 1SEVA 1CSEE 2ZRDA 2IJGX 1H8ED 2R96A 1HK7A 3PWSA 4UFOA 2IV3A 1OWOA 3G1TA 3TXYA 1Z0FA 4A03A 1DL5A 1HT1E 3HCBA 4Y2UA 3L49A 1BROA 3V7UA 1YCHA 3W5SA 4B8YA 2PUFA 5DLDA 3QUTA 1KDPA 3THYA 1IVSA 1I13A 4X54A 1PVDA 1ZUIA 5LZ8A 3B9QA 4WXHA 3FJ1A 1Z8DA 4N76A 2V5UA 3QG1A 3T9EA 2IZ1A 1YKGA 2BEUA 3PHIA 2C4VA 4NX2A 1N1GA 3QZUA 2AD1A 3EXHA 4H6WA 4L2IB 4DOMA 3UTDA 1YA6A 1WMFA 2OCPA 3E7WA 4LYAA 3EG5A 4ZRMA 3COPA 4OAOA 3SGLA 1M6EX 3C6QA 2PQ6A 3H1GA 3PC6A 4M38A 3LJKA 4WNAA 3SMQA 4XX0B 2XYRA 2BDTA 1RWBA 4IQ4A 5FNVA 5KJFA 5C0OE 4M1WA 3HP7A 4AQYB 3EAQA 2G1KA 4ON9A 2XVYA 1RWMA 1KQOA 4A15A 3EXIB 2QU8A 1J25A 3UICA 4U9HS 1CHDA 1ZX1A 1PP4A 2C4MA 1VRVA 1XDWA 2BCGY 3FFAA