4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords eIF5B
publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
3SHWA 5FBRB 2XJ9A 2JLYA 1E4VA 4DQLA 1G4AE 5TY0A 1KI6A 1F60A 1SGWA 1EFCA 3CRW1 4QGFA 1E9DA 2SHKA 4TSFA 2REBA 1ZUHA 1PLKA 2WJJA 1R8SA 3CCQB 1B23P 1XTIA 1XMVA 1NY6A 2I4IA 3CNLA 4QBHA 1P75A 3QXHA 2Q0HA 3KXLA 2B7BA 1CULC 1WCV1 2F1IA 3CF6R 3ZVMA 2RGDA 2V54A 1JA0A 3SQWA 4FINA 4HZIA 1W47A 2B21A 2A3RA 1P2UA 2CCKA 2WAYA 1U2RA 3SNHA 1GVNB 2BHRA 5GJBA 2BCJQ 2EFHB 3SJAA 2BBSA 5C1BA 5JBQA 3NC1C 2OUKA 4NTZA 1AGRA 2FPMA 1KI7A 5CIQA 1OXSC 1TU4A 2O52A 3G82C 5CB8A 5FH9A 1E3MA 1GNQA 5JFGA 2HYDA 4BPRA 1JEDA 1X3SA 1D2EA 2CBZA 4HLQB 4PHFA 4KAXA 3VMFA 2OTJB 3KFVA 2BVNA 5EE3A 2GQFA 2HJGA 4TYWA 1OXTA 1KIMA 3K0SA 4OQLA 3VO2A 5HKKA 4XWAA 3NH6A 1LVGA 3D6TB 3R7WA 2QY9A 2ZSEA 4KO8A 3UG6A 1GRRA 1X8LA 5BXQC 1LFDB 1DPFA 5J4LA 4QOSA 2H1LA 4TYNA 3BB4A 3ZS9A 1JNYA 1TL7C 1E9RA 1KDRA 3IEVA 4IOLA 2QBYB 5E7JA 2AWNA 4F4CA 4QJ5A 5CYOA 2GEVA 1YJNB 3QF4A 1IM2A 1IAQA 2FNAA 3KX2A 3NEJA 2CE7A 4GOXA 1D9XA 5SZHB 5HE9A 2F3RA 4B3DA 4URWR 2G88A 1KSHA 3WNDA 1ZBDA 3SYKA 1B2RA 2DWPA 4NYMQ 5KPDA 1UM8A 2HMAA 2XITA 4LJ7A 3SEAA 1G17A 5FUVA 4KVGA 3R7WB 2NG1A 2FZLA 3T06B 2FA9A 2FMXA 4MYHA 1WRBA 2ZR7A 2KBEA 5J47A 1US8B 1MT0A 2B6HA 4OI4A 1VIAA 3CPJB 2IYSA 2JLWA 3AM1A 1ZINA 1OFUX 4YQFA 2D06A 3ZVRA 4B3XA 2MSDB 4WBSA 2J7PD 1P60A 3LD9A 1YRBA 1VYTA 4EPYA 3W5UA 1II8B 1W2GA 2ZRDA 3A1VA 3KKMA 1I2MA 1UMKA 3RANA 1NLFA 1GR1A 3IUYA 4BGDA 1DAGA 4OJQA 4RD3A 3CRZA 4NCHA 2HT1A 4ZKDA 3GJ4A 3RDPA 3WYFA 1IN7A 1CU1A 4M9XA 4R2HA 2RMKA 3VNVA 3BH0A 3TQCA 1F20A 2ONKA 2QA5A 3OHMA 1UEJA 5E4FA 4QC2A 4Q1DA 3BB3A 1NF3A 1XBTA 2VHQA 3NBXX 2GK6A 4ZDKA 2AKYA 1XCGB 3ND8A 1ZUNB 3E5HA 1AIPA 3RNLA 2O8FB 121PA 1JEEA 4WOPA 4URZR 3W3AA 3A6PC 2XGJA 2KI5A 3SC3A 4U9UA 1P9RA 4Q7MB 1SQ5A 3FYHA 5EP3A 4B71A 5JRJA 1IN5A 5GV7A 1G5PA 1XZQA 4YALA 2OXCA 4LYHA 1JR3D 5AR1A 3WMFA 1KMHA 1Q0UA 3CM0A 3M6AA 1G291 1E9AA 4FMBB 3GFTA 3ZZUA 1M2OB 5H8WA 1OGIA 1W1WA 4FI3C 3PUZA 2ZRPA 1YZQA 1I4DD 2Q9AA 1ZD9A 3OEHD 2ZYTX 4JLNA 4NYJQ 3SJZA 1XJ0A 1YZLA 2YOFA 1VQ7B 1GITA 3ZLJA 5FOXA 1TF7A 2XTMA 4PPFA 4JSYA 3ECCA 4QGAA 4QFMA 3ND9A 4A15A 3LX5A 2V8OA 4M1WA 1RRFA 2GAAA 3OZWA 4BLQA 2OK8A 1S8FA 1G8GA 1VYUA 5CK5A 1AMOA 1SKQA 2ZJZA 3B1YA 3I62A 1T0HB 2Q21A 1E2EA 4D25A 2ZRGA 3EPLA 4Q03A 5UKDA 2H8KA 2VBCA 3LBHA 4D80A 2CNWD 4A2WA 4PPNA 5FA6A 2PMKA 2UZ3A 3M1IA 4PZLA 4OL0A 1VYVA 1X86B 4XWOA 3DOEA 3VTKA 5JS7A 4RZXA 3MGCA 1BMFD 2FFBA 1U99A 3RS0A 2PX0A 2CEAA 1I4LD 2ODNA 4Q7KA 4QM7A 2OCPA 4GOJA 2ODWA 4B2PA 5L3SB 1ZAKA 3RC8A 3CB4A 1U8AA 1AS3A 3SFVA 2IHBA 3CCEB 4TTQA 5LD2C 3I8XA 2ZRIA 2OBNA 3SZRA 4F7WA 1SXJC 3WHLA 1IJEA 1EGAA 1UBFA 3VFDA 2ZYWX 4CT4B 4DCVA 3E1YE 1VQOB 3HU1A 5DISB 3ADDA 1TLLA 5GJCA 3MD0A 1E94E 4ACBA 4POAA 4RJLA 2HXYA 1PVOA 1IY1A 3DZ8A 3F5FA 1T3HA 4Q9HA 2DWQA 3M4YA 3EZ7A 3NHAA 3QVVA 4TYYA 1G64A 1E9FA 5FPYA 1FOEB 1NBMD 1E9SA 2JJ2D 3PUVA 1AN0A 2QSZA 3GEEA 1W0KA 2FG5A 1Q7YD 3PXGA 4KCGA 5JLJA 1Z2CA 2R9VA 2AXNA 4Q01A 1MKYA 1XTSA 4C4PA 3C8UA 3NBFA 3E2IA 4FXPA 3I56B 1H8ED 3AUYA 4LBVA 1KDTA 3GLHA 4DSTA 1FNMA 3H0KA 2J0UB 1VG8A 5EUMA 5JCPA 1LS6A 2AFHE 4I1UA 1WXQA 1VQPB 5D3MB 4NYJR 3VHXA 2OBLA 3CZPA 3W9YA 3IPXA 4OHWA 5FBVB 2VNJA 1KDOA 2ZS7A 2OK7A 4D6PA 5J5CA 3P4YA 4PHTA 5AUQA 1XXHE 1SXJD 1M74A 1FQKA 4DDTA 5LB4A 2PLRA 1Z08A 2W58A 2XTNA 5CIWA 5DN6D 2WSSA 3HP1A 1CR1A 2ZM5A 4B48A 4G5SA 2DFKB 4P4SA 4WZBE 2AK2A 4ILEA 2CK3A 3IO3A 3AKEA 2KSQA 4JZKA 1DDIA 3NHBA 5KNDA 5JSZA 3K1JA 3AF1A 2JIZA 1UFQA 2BCGY 3WYAA 1P2VA 4B43A 1QGZA 3B8HA 4ZV4A 1WE2A 3M0EA 3THOA 1B0UA 1F2UB 2OFWA 1S1CA 1XXHB 3U3RA 3BIFA 4A8JA 2HT6A 4JS0A 4EPWA 1KK2A 2TMKA 5KNCA 2ZI3A 3WXMA 3ASZA 5M04A 1JR3E 4Q66C 3WMEA 5G41A 4CIDA 3TMKA 2HF8A 4UAJA 4JYBA 2MSCB 3SBEA 1E4YA 2YYZA 3PEWA 1W35A 2RGAA 1E2MA 2ZREA 2WWGA 4XWKA 5JI2E 3C5HA 4PC1A 3QIAA 4YMTA 4WXPA 2J9RA 1YJWB 2J0SA 3V4RA 2A5YB 4KLNA 3WRXC 1OFTA 2Z6VA 4EPRA 1J9ZA 1QHYA 1KGDA 2YWFA 2OO7A 3AP2A 2OESA 2QA4B 1KY3A 1M6NA 2ZQ5A 1GIAA 2G1KA 1GFIA 1KO4A 2HCJB 3LXRA 2WJGA 3BORA 3FDIA 1TTTA 2VHUA 3MLEA 1HTWA 3RS7A 1KMQA 2CDNA 4IOMA 4JLMA 1H65A 2WVJA 2XNSA 4DCUA 2RKOA 1YI2B 3FOZA 4O2LA 1AQUA 1FDRA 4ZIRB 4L9WA 2YWGA 4D0LB 5J4VA 3A1SA 1EX7A 3ZQJA 3GLFA 3THWA 1RVDA 3T35A 5BN5A 2QE7A 3AP3A 5P21A 1ZRHA 1NJID 4LRWA 1W44A 1XEXA 4LHVA 4LZZA 4B76A 3CR8A 1A82A 4V0KA 1Z0KA 3LNCA 3U7GA 1XJCA 1VQ5B 2FGJA 5FL7A 1G3MA 5E7IA 2H57A 4QBFA 4C0AC 2FH5B 1GG2A 4OI1A 4HB0A 1GAQA 2FWRA 4IEEA 2R65A 5SZKB 1RJ9B 4NCJA 3U61B 3EWSA 4JVMA 3U44B 2A9KA 2FDCA 1UDXA 1RIFA 1KQSB 3QY0A 2R2AA 3REFA 3QVUA 3UXMA 1W48A 4A82A 3T5GA 2WWIA 4DCNA 1ZM7A 3FVQA 2GWHA 3GEHA 1H8HD 2RGNC 4A2QA 5JZVA 1M34E 2DBYA 2ORIA 5C4GB 2J0VA 1EESA 3EWAA 2VNKA 4IVQA 3FMFA 1KI3A 1E32A 4W7SA 1FX0A 3VR6A 1TPZA 3GLFB 4JKYA 3EARA 2JDIA 4JMPA 2O8EB 2FE4A 2ZE6A 1Z0JA 2VHCA 2J45A 1XZPA 2JATA 1JB1A 4BRUA 2W0SA 1G8YA 2ZRAA 3X1WA 3K9GA 3LLMA 4PAOA 1OB2A 2EYUA 2PH1A 1HE8B 3MSXA 1HA3A 3U7EB 2WJYA 1DG3A 5FI1B 1SHKA 3OF5A 4QGHA 2GESA 3AH8A 3BD9A 3CZQA 3O47A 2HCBA 3SYLA 4BZPA 5B58C 2QBYA 3BS4A 3G5UA 4B33A 3QXJA 2QTHA 4B32A 5CDFE 1XU4A 2J1LA 3LAWA 2UVQA 3T1OA 1CRQA 1U0JA 4PAMA 4YAUA 1D6JA 4KFRA 4HDCA 3I5YA 2IXGA 1VG1A 4CW7A 1J70A 1XF9A 3K9HA 2ZETA 1ELOA 4TLDA 3VX3A 3B2EA 2GPJA 5L3VA 3QNUA 1I2DA 4URYR 4TTPA 2QSYA 3UATA 4G5OA 4BQSA 4IDQA 5FPKA 1A8PA 3AKCA 3AV0B 3FKSD 4FMCF 2FPLA 4EFMA 1GWNA 1RJ9A 4C7OA 1G5TA 3SJBA 3ZD7A 3GJ6A 4UJ3A 3CC4B 4YXWD 3X2SA 4I99A 5A5GA 4YMUA 1HQYE 4W5WA 4DLYA 4EPXA 1E1QD 4KODA 1YR7A 2OHFA 5KSWB 3AUXA 1W4BA 5EZ6B 4U00A 3W6PA 1DAEA 3SBDA 5DIFA 1E2IA 2QP9X 1CNFA 2FEOA 2H92A 3Q5EA 4LI0A 3MCAA 3EZ2A 3MUFA 2OBMA 1P61B 2QENA 1XNJA 4NU0A 4DEYA 2EWWA 4YONB 1SVMA 4MKFA 1QGYA 1GILA 4WVFA 4BFTA 1AM4D 5TXGA 4BZXA 1SVWA 3NDBB 2BPOA 2CCGA 5DI3B 2CVFA 3PIRA 3KFXA 4DLSA 4US0R 2RC5A 3QBVA 1U98A 2AWOA 3FHOA 4DCTA 3AP1A 4EJSC 2ZS9A 5HPYB 1RFLA 2FSFA 1FP7A 2N1BA 1X1RA 4FD2A 3THYB 1UEIA 1OE0A 3KJEA 4OQFA 2HLDA 2WWHA 4Q21A 3NG1A 2GEUA 1LY1A 5DYIA 1L2TA 1CNEA 1TVCA 2VYQA 2OV2A 4UNSA 4WZ6A 2JA1A 3A4MA 4MUBA 4TQAA 4URVR 1F6BA 3A37A 4TT3D 3LV8A 1ZC4A 3C41J 4MRNA 1AKEA 5FFMA 1Q1BA 4RVCA 4EFNA 8OHMA 1KO1A 2BIFA 4LHXA 1RYFA 1KO8A 1CJMA 1E9EA 3WYGA 2GAOA 2VTKA 2NO7A 4OJKA 1P4SA 1E9BA 4JLOA 1R6BX 4Q4AB 2UKDA 4NE2A 3OAAD 3KQUA 4DT1A 4QM6A 3HR8A 1Z8FA 4Q4HB 4NCNA 2PEYA 2VRWA 4LYAA 2CL0X 4ZIRA 2PJRA 3CIOA 4PC7A 2NIPA 1M7BA 1YHNA 2NO6A 4LV8B 2A5FA 1EFHA 4A9AA 2LCFA 3BOSA 3C15C 3S1AB 5KPJA 3K09C 3AVYA 4IVRA 2IWRA 4F4IA 1KMHB 3IDQA 4ESHA 1VQ4B 1W0JA 4XSGA 1TEVA 1VPLA 4RZUA 4C9BA 1T3SA 2F43B 2IHYA 4LJ9A 3N2EA 4QNMA 5FOTA 1AZTA 3RRYA 5BYKA 4LJAA 5HKKD 2ZJ2A 1FL9A 4BASA 4P4UA 1N5IA 1R10A 4P4TA 3AQ4A 3IBYA 3QOFA 4JBXA 1GAJA 3CC2B 1R5OA 3ZBUA 1SHZA 1G3QA 2V7QD 1KSGA 2GJ9A 1D1NA 5IF9A 2WOJA 4Q18A 4Q5IA 2QTFA 5EXPA 4D0NA 1KNQA 3EAQA 2ZIAA 4DB4A 1XTJA 3QXSA 2CRVA 3CPHA 4GOKA 1JAIA 2QZ4A 2ZSBA 4AK9A 4JT2A 2HDNB 3NIBA 3TUIC 1HE1C 3W5VA 3OEHA 4DLXA 3UMSA 1HURA 2GZAA 2IYRA 4A8JB 2QMOA 2WJIA 2NTYC 3B60A 1Z83A 4PQYA 3SFZA 3EZ6A 3W5IA 1E2HA 4URXR 1P5ZB 1MO6A 5E7MA 4DHEA 3ES9A 1YITB 3DHWC 3W2EA 2OCBA 1X8KA 1GVHA 3GLGE 3I61A 1OHHA 1U9IA 2GETA 1F2TB 2JIZD 4NONA 3TK1A 1QZXA 1KI4A 1GDDA 3CONA 4KFSA 5DNYB 5JJIA 3GLHE 3EC2A 5KSYA 3B1ZA 4PPQA 1W36C 4YMVA 3VR5A 5BWMA 1YZGA 1FRQA 3DKPA 1COWA 3NC0C 4BZQA 4G1BA 1XMJA 2QORA 1JXOA 4LBWA 4ZGNB 4I1OA 1BH2A 2A30A 521PA 4B3BA 3PEYA 4JT4A 3WP0A 4R98A 4QHYA 4US1R 2O8DB 1E2LA 4WXRA 3AVOA 3B6EA 5CJ2A 4NZYA 2IS6A 1T6NA 2FX3A 1M7GA 2BM0A 2QRNA 2IXEA 2W6ID 3A36A 1R0WA 1U0HC 2CHQA 5L3RA 5IK2D 1XTKA 3KKOA 3G71B 1OIWA 2NZ8A 4HI0E 1DDGA 4Q7JB 4OI2A 1IY2A 2QGNA 4ZDWA 3JVVA 4IDHA 2O8FA 1D2MA 2OEPA 1OHHD 4B75A 1VCOA 4B35A 4DEXA 4MRSA 4ITRC 4TLCA 2NZJA 4DRZA 5KNBA 2IW3A 2BEJA 1OW3B 3EIQA 1QHNA 1E2GA 3CUEF 2PZGA 4PGOA 1ZM2A 3ADKA 4MKGA 2VSOA 4TQ9A 3LH5A 4JLPA 1SKYB 2C96A 3MAAC 1BIFA 1TF2A 2BBOA 3A1WA 4WIAA 3K70B 5JWOA 1FNDA 2ZSDA 3LWNA 4XIGS 3H2YA 2NMVA 1HYQA 3BB1A 2O5VA 3LA6A 2C9OA 4W5JA 5F98A 1YR6A 1ZCBA 2FU5C 2OG2A 2VL7A 2QE7D 4GZMA 4JLDA 4QKQA 1A1VA 1OXXK 4G1UC 3V4FA 4Q4AA 1N6LA 4B3GA 2CNDA 1HY3A 2V3CC 4BPBA 1BS1A 4PC2A 3PUWA 1QUFA 2IYUA 2AL7A 4MH0R 4P4SB 3A4LA 4HE5A 4G5QA 2VH5R 1ZMXA 2ZE7A 2GCPA 4JLJA 3O8RA 4GL2A 2G6BA 4Q4JA 4BRWA 1CR4A 5EMNA 4OHVA 2QROA 1KI6B 3CMAB 1BMFA 1OXVA 2W83A 4P3YA 1E79D 4HAXA 2OILA 4JL6A 2A78A 3THYA 5TB5A 3GLFE 3MWLA 5AJYA 2BKUA 3VO1A 3I4LA 4OHZA 2IBMA 3MJRA 1C9KA 3OZVA 4UXIA 5KYKA 3Q85A 5EUQB 5D3MA 1E0KA 3X1DA 2XNDA 2VF7A 4V02A 4LCBA 1KK3A 2VPPA 3C16C 2KWIA 4M1YA 2IXFA 4FMCB 1JBKA 3QF7A 3NBZC 1T4GA 1XD2A 5EZ5A 3OZUA 1YRAA 3LQQA 4MGIR 2ATXA 3CBQA 2QRZA 3I3SR 5C18A 3J81k 3K9LA 2ZS8A 2ZPTX 3TAUA 1V5WA 2Q3MA 1UKZA 4TL8A 5KSZA 1J2JA 1E2FA 1NSTA 2AK3A 3EA0A 3KJIA 4YXWA 2C77A 3Q5DA 2GVZC 4UNRA 3LO5A 1XTRA 1OYYA 1VKJA 2J3EA 4QHTA 2A5DA 4D4JA 3OE7A 4AI6A 1DO2A 1ZD1A 4UXHA 2QAGA 1G16A 2GJ8A 1ESMA 3RRZA 4L8GA 1VIYA 5KSOA 1KI2A 1KAGA 1E99A 2CXXA 1CBUA 4JVNA 3SJCA 4EJSA 2KBFA 1VHLA 1GUAA 4A0FA 4WQMA 1Q86D 3FWYA 1MO5A 3QXCA 2ZRMA 1W5TA 1ZM9A 1ZD8A 3CCMB 1TQ6A 3D8BA 1G1MA 2MSEB 2RGNA 1DO0A 1M1YE 3HWSA 4KLZA 4GRAA 5LD2B 3P27A 5EP4A 2A2ZA 2J41A 3QEJA 1SULA 1I7PA 2CLSA 4QXAA 1DAFA 2FOLA 5JMTA 4PO9A 5CYPA 1UDWA 4AURA 4BFVA 2RHDA 4IW3B 5AUNB 3ZBTA 1Z2AA 3H86A 3ZVNA 1TEXA 3T1TA 2O8BB 3RHFA 3THXA 3IGFA 2R6AA 4BLSA 2OFXA 3KXKA 4Q4HA 2IS2A 1NN1A 4BLOA 4LC1A 5EXXA 2VEDA 3BFKA 3NKVA 4M8NE 3U60B 5FOVA 3U3JA 5DI9A 2ZAOA 3CR7A 2F6RA 1XEFA 2WMNB 2DWOA 3CPEA 3VR3A 1QVAA 2IYVA 2W6JD 1XPRA 1AA9A 3E70C 4KVAA 2XNJA 3X1XA 3DPUA 3FFAA 2KE5A 4I4LA 4Q1EA 4RD2A 1QGAA 1X1SA 3OFNA 4Q00A 2HEIA 4P32A 1OH5A 5E3HA 3VKHA 2QTLA 4N3NA 1O3YA 2VP6A 2E87A 5G40A 3OE7D 4TL6A 2HYIC 2IX3A 5DGXA 1PZNA 4MUAA 3TW8B 1I4TD 1NP6A 4B6FA 1W36B 5JWRA 2G9NA 3ZQ6A 2UZIR 3Q9LA 4IJMA 3FPKA 5K8UA 3QKSB 4US2R 1P3JA 1ANKA 3RABA 1XCMA 3ZIAA 1G7RA 1E62A 2IA5A 1W87A 1KK0A 5IT5A 5G3YA 4DSOA 4L5BA 2ZVQX 2QMHA 1VECA 1WP9A 1EP2B 1W4CA 5GADl 1Y63A 2ZJBA 1E0AA 3EA5A 4GMDA 4UKDA 2R6DA 3GJ7A 3AEZA 1CQXA 4ACAA 4YHBA 3JQQA 1OFIA 3K09A 4PO8A 4PPGA 3RS2A 3RS5A 2ODBA 3TR5A 1U0LA 2WKPA 2VP5A 1QH0A 4EDHA 3I8SA 3ADCA 2Z83A 2FV8A 4RD4A 1IJFA 4ERNA 1G7SA 2XXAA 4C30A 3CKLA 1C1YA 1U9IC 3U7FB 1Z5ZA 3U3MA 1NJGA 3K8YA 3KDSE 1UADA 4TMTA 4X8LA 3WBKA 2I3BA 4D4MA 3FFBA 4ARZB 4CDGA 4DLZA 4CF7A 1H8EA 1Z07A 4C0HA 2O8CA 2V7QA 4DDUA 1A2BA 3JZAA 3ZS8A 2OXRA 2VQSA 1OH6A 2XEXA 3LLUA 4C0KA 4D26A 3G0HA 1JA1A 3Q3JB 2WMOB 1LW7A 4DLTA 3SOPA 1S4QA 4LUCA 1NI3A 2GILA 2QP4A 1JQJC 3I73A 1CP2A 2VYFA 4IKEA 1S3GA 2OT3B 4XD7D 2JLVA 3MHPA 2RGGA 2O8DA 1OF1A 2QAGB 2JLUA 1F5NA 2AKAB 2G1JA 4IXNA 2ZJ8A 1TAGA 1QHHA 1EWYA 3RYTC 3AVQA 5LDDC 2O8EA 5EE9A 2XZOA 5CLQA 1RRCA 2RGCA 4O25A 2QT1A 1J8YF 2PCLA 3KQNA 2BBTA 3CWZA 5CITA 2AR7A 2ANCA 3CRRA 1FRNA 1Z0FA 2WOOA 2IL1A 1VQ6B 2V55B 1BX0A 2Q6TA 4LDJA 1T5IA 3AVXA 3X1ZA 5AUPB 1IQPA 4TYPA 2EIXA 3VQTA 2DCUA 2BN4A 5H59A 2QMUA 1BYIA 2GHIA 5L8VA 4DZZA 2CVHA 2VIIA 3L0SA 4QGGA 1NNEA 4MGYR 1E2JA 3TBKA 1UPTA 2QM8A 3VKGA 3IPYA 1E2KA 3FMOB 4G5RA 1HUQA 1VHTA 2BBWA 1N6NA 3SR0A 2J46A 2GEDA 1QX4A 2YINC 2BMJA 1H42A 4W5HA 3FE2A 4XD7A 5SZJA 1ZJ6A 4TLBA 1Q1EA 5B57C 2GZDA 1YIJB 1Z0AA 4RKEA 1GAWA 5EXTA 1MO3A 1SXJB 1SVKA 3NWJA 3CNOA 1A5TA 4OI0A 4GSYA 2DB3A 1ZP6A 2D74A 3PFIA 4ON9A 3GJ0A 1N5JA 4HZUB 3NXSA 3TE6A 4C2UA 4XJXA 2DFLA 3LXXA 3RLFA 4IHQA 421PA 3Q7PA 2BOVA 2NOAA 4MRVA 5EXSA 1NSFA 3VR2A 2H7VA 4DBLC 1LTQA 1W2HA 4GP6A 4YDSA 3R8FA 5HCIA 3HYRA 2PIAA 2D7CA 2WIAA 1KI9A 1AS2A 3CX7A 3K0CA 4GZLA 3WHKA 1P2SA 2Z4SA 1QG4A 2YZ2A 3OIYA 4HB2A 2O8BA 4BFYA 3B1WA 3W3ZB 3E20A 2G83A 2OTLB 2WKRA 2XNDD 2XZPA 3QI2A 5KTYA 3IKJA 1E1RA 1VG0B 2CL6X 3JQPA 3B9QA 3OEEA 3PUYA 4QL3A 4FWTA 2P3SA 4BLRA 3QUSA 1K8AD 3KKPA 1E63A 4M9SA 2ZR0A 721PA 4KYUA 1E98A 4X8HA 2RC6A 1VDZA 1GKYA 5A0FA 3C7KA 4N0EA 1CXZA 5AJWA 3IIMA 4JL5A 1VG9B 3V9PA 1G18A 1WQ1R 5GV8A 3U3OA 2D2EA 1NVVR 3GPLA 1G3RA 1N6OA 4HEJA 1DVRA 1TQDA 4JKIA 5DYGA 1L4UA 1Q12A 1U8ZA 3HDTA 1E9CA 3VHLB 3VR1A 3GJ8A 3U44A 2D3WA 3R9IA 4NL4H 5SZIA 1SVOA 2JASA 4TYQA 3L82B 3LDAA 4IEIA 2BV3A 4G3XA 4TMKA 1QDEA 4AIIA 1VQKB 4N0DA 4YAWA 5FOUA 3RRMA 1LS1A 2QPAA 5FPTA 1YKSA 4Q1FA 1WMSA 1JR3A 4ESVA 3N5CA 4QHSA 5EP2A 3OAAA 2HF9A 1V43A 2REXB 4PC6A 5FUWA 1EFUA 4DCSA 2NPIA 3AVTA 2W2VA 2Y8EA 1QFZA 1UBEA 3RWOA 3W34A 3UPUA 2F3TA 2ZRKA 1R5BA 3PR1A 4YDHB 1OH7A 4BUJA 1KZ7B 4OYHA 4EQ6A 1BKDR 1MR3F 1FNBA 2QMEA 2WWYA 3TVTA 1NIJA 2JLXA 4AKHA 4F91B 2F9MA 3HU3A 5TMPA 2WAXA 3CO5A 3KKQA 1QRAA 2P5SA 3T15A 4C7OB 4GFDA 4LPSA 2FFQA 3LVBA 4U7DA 5FR2A 4DDVA 1A7JA 2V6JA 4NKRA 1XDBA 1ZNYA 2IWHA 1TUIA 1KDPA 4OQNA 2GXSA 2FSIA 4OBEA 4A0GA 2ZJYA 2BF4A 3WNCA 2CNWA 2V4ZA 4OHXA 5FL7D 3SI7A 2XB2A 1AGPA 4D81A 2O0HA 2W00A 3ZIAD 3SN6A 5IHPA 1XEWY 221PA 4ZGQB 3AVUA 2JLZA 3VX4A 3LX8A 2RHMA 1NKTA 3ASYA 4HDOB 3OIWA 4HZUA 1D9ZA 4MKHA 3U4QB 4Q02A 1MABB 1W49A 5HE8A 4UXJA 4OHYA 4HAUA 4F38A 3CXCB 2YHSA 2Z0MA 4MQBA 4NPHA 4TL7A 3V76A 4KFTA 5HR5A 1G8FA 1XD9A 2R62A 4KSCA 4M0LA 4P0TA 4Z1MA 1XPUA 2NPFA 5CK4A 2VF8A 1Q3HA 4Z54A 1TX4B 1S9HA 5D3QA 3MMPA 2G0TA 3DMDA 3WMGA 3BH7A 3RVBA 4JL8A 1PLJA 4URUR 2DR3A 4XOIA 2EW1A 4TMVA 4Q9LA 3RS3A 2BEKA 3QFRA 4MDEA 1J90A 5TVKA 1AJEA 5K8IA 3B7GA 4PTLA 4Y0VA 2X2EA 5KUTA 1VCMA 1N6HA 1R4AA 3WBJA 2P0EA 3EXAA 2R8RA 4Z51A 1ZIPA 4XH9B 2QT0A 2JGNA 4P31A 4B74A 4LV5B 3OW2B 1JAHA 1E1QA 3MWYW 3B1VA 4MITA 3TLXA 4V0NA 2GF0A 2ZI5A 3K0AB 4LV6A 2GJKA 5THXA 4C43A 1YU9A 3BK7A 4KFUA 5LBIA 4AYXA 4TZ0A 4V0MA 1YJ9B 1DAMA 2A7QA 4NMMA 3U4QA 1NVVQ 1YZTA 2FEMA 3L0IB 4WAUA 3B82A 1VQ9B 2YOGA 3TVDA 2FPKA 4R71A 1CTQA 4UNPA 4QJ3A 2GJSA 3GLGB 3B13B 1AQYA 2X77A 1L4YA 1P62B 4G01B 4A6PA 4AG5A 3MWJA 2OFOA 5JEEA 1GO2A 1NIPA 3EASA 1XMIA 4A8JC 5JRZA 1BYUA 2ORVA 3JZMA 2OCAA 2VSFA 4HAWA 1IY0A 2GJAA 4KHZA 1VCIA 4BFSA 2CJWA 1RC8A 1K8RA 2IYXA 2X2FA 3P32A 3AF0A 2RGEA 1D5CA 1ZVQA 1OH8A 3EPHA 1UJ2A 4R2IA 2PZFA 3L2OB 1EP1B 1OPXA 4LPKA 1M1KD 2ZI7A 3VNUA 1MOZA 3W6NA 3TJZA 4HE6A 2FZ4A 3VAAA 4BECA 5J4YA 2R6GA 1P7CA 5KHOC 3ZZTA 3W2GA 2B5OA 2KJQA 3BAFA 3DVLA 2D62A 3KZ1E 1G7TA 3QFTA 2J87A 3QKSA 5FUXA 1YZKA 1NVUQ 4LK2A 4MGZR 4NCKA 4BFUA 1Z6TA 2B92A 1IN4A 5FL3A 1BJKA 4LC0A 1UBGA 4TLEA 4ZI3A 1KO5A 3QKRA 3OIUA 2IYZA 2ZRLA 3T12A 1XMSA 1DADA 4EAQA 5JI3E 3TSOA 1OKKA 1EK0A 3KTAA 4X8MA 1E0JA 2IF2A 5DHFA 4KBFA 4KSBA 1L7VC 1MABA 2HUPA 3L0PA 1SXJE 5TV2A 3CPWB 4PHGA 5BW8A 3EPKA 2BDTA 3THWB 4JLVA 4IOJA 2IF0A 4MRPA 2PMDA 4Q47A 1TUEA 3MJHA 3VU9B 3EPJA 4OK3A 3I92A 4XVRA 4KI0A 2CLDX 2H5EA 3TUZC 1S2MA 2ZROA 3QPVA 2JEOA 3K0EA 4M22A 4MRRA 3CCJB 1MH1A 1G41A 2FF7A 1G19A 2QL6A 4CT5A 4DQKA 1T9HA 3H4MA 1N6KA 4TWZA 1IN8A 3SE0A 1XEWX 3NTUA 4CZ2A 2IT1A 1G20E 3IBGA 4FCWA 2DY1A 2QPOA 5HXBA 3AGQA 2C95A 4IRUB 4LSGA 5IK2A 2K5UA 4E09A 5F9FA 1M90D 1QFYA 4PR0A 2QAGC 2ZXUA 2L0XA 2KB0A 3QPUA 2DHRA 4CGZA 3RSLA 1Z63A 1ZNXA 2GDJA 3KB2A 2F1JA 1KKMA 4LBYA 1HV8A 4EQ6B 4UJ5A 1EFRA 3ZDQA 2H17A 1A4RA 1LV7A 4DSNA 3UMFA 2DFTA 3ZZ0A 3N70A 1PUIA 3V00A 1LNZA 1SXJA 3HJNA 3MFYA 3OZXA 4IDPA 3KTAB 2ZJOA 5DHAA 1FTNA 3TSWA 3GFOA 5KU1A 2V1XA 3BERA 4TL9A 5BYJA 4F92B 2QEXB 3BH6A 4V0OA 1DG1G 3RSOA 2P5TB 2Q3FA 5J4HA 3UWOA 2F1RA 1R8QA 3GJ3A 3GQBA 1JPNA 1F2UA 5FOSA 3R9XA 2FFAA 1GSIA 3PITA 4LJ8A 5IRCD 4GDFA 1SKYE 5F3WB 1EFTA 2X19A 4TLAA 1QVFB 3RWMB 5EQTA 3W2IA 3CH5A 4O0MA 2C99A 2D4HA 3WNBA 1VCNA 1XE1A 1KJWA 4K81B 4PFSA 2CMKA 4B34A 3CCVB 1XX6A 2ERYA 3P26A 1IOZA 3QG5A 1NVXQ 1EFRD 4L16A 2GCOB 3K53A 4V0ME 4EFLA 3HYTA 1N2CE 2W2TA 1K6MA 1OIXA 5JWHA 4G1VA 2PZEA 4FCVA 4LX0A 4M21A 5LB2A 3K0AA 2ZRNA 5FTJA 1OLOA 2WHXA 3AVPA 1NN3A 2JLQA 1BO6A 3U3KA 5JHGB 1S0UA 4RZ3A 3CCSB 5KDOA 1SM4A 3PQCA 4YLGA 1OFHA 4YMWA 1R2QA 3PG5A 4AF6A 1K5DA 621PA 2J7PA 1NMXA 2ZITA 4DUGA 1NRJB 2EFDB 3FMPB 4DJTA 4EKDA 1XPOA 3FHTA 2X3UA 1E0SA 1Z3IX 4PQFA 1Z6GA 5CJPA 1U94A 1KTVA 1O87A 3AF4A 3R8CA 3T1QA 2WM9B 1GJRA 1LF5A 1TU3A 3PEVA 3QPWA 1N5KA 3LW8A 1T3LA 4GP7A 1Z0IA 4PX9A 4A0HA 5JJLA 4N3GA 5KSPA 3IEUA 1DAHA 5FR1A 3L0OA 1AS0A 3CCRB 4JLAA 4HLUA 2IC5A 2WJVA 2WPDD 3BRWD 2ZSFA 3CF0A 4K8OA 5EJEA 2P6NA 3CWQA 1KZGB 5DI3A 3LRPA 1GM5A 1NN5A 1OXUA 2WWFA 1JECA 2DETA 1G4UR 4QJ4A 3TQFA 4A0RA 3DM5A 1QVGB 3CRMA 5CM8B 5FBLB 4P6VF 3GMTA 1OJLA 2IYTA 2OE2A 5TR9A 4ZO4A 5FBWB 2GZHA 4DIEA 1JR6A 5HZHA 2V1UA 2WWXA 4FMDF 4WZAE 1CJUC 2FN4A 3EW9A 3MWKA 3GLIB 5JSZB 1IXRC 2DYKA 2WSMA 2VLIA 2JAQA 4Q7LA 5BQ5A 4RD1A 2NO1A 4D4LA 5C4MA 5BN4A 1CLUA 3LW7A 3IILA 1IB0A 3CMEB 1FQJA 2BC9A 3GEIA 2C04A 1OV4A 4MYUA 3NDPA 3KUCA 2XNCA 4PZYA 4YMSA 5CDFA 3RAPR 5L3QB 2IS4A 1SVLA 4HLCA 2NQ2C 1ESNA 1CEEA 4XVUA 4MYTA 1NY5A 1QUEA 2YNMA 4DLRA 6Q21A 1KJZA 1P72A 3HU2A 1XP8A 5DO9A 3HR7A 3VKWA 3W6OA 3QE2A 5FTKA 2VA8A 4MYCA 3DM9B 4KITB 2EWVA 1NMZA 1QHSA 4Q9KA 1Y3AA 4DVGA 1QHGA 1NG9A 3U6KA 4XSHA 4NDZA 1E69A 5HTKA 3GLIE 2MMGA 1US8A 4GNKA 3QEOA 2J59A 3NH9A 5FTNA 2QP3A 3IHWA 1KHTA 2PLFA 4G0NA 4K1XA 2QPTA 4JLKA 1DARA 5HZKA 4ASUD 1CJTC 1JJ7A 4TSFD 5FBQB 1W5SA 3Q72A 5CLLA 2QTZA 5H68A 4AF7A 3QFSA 1K5GA 1QF9A 2ZRJA 5EP1A 4DLWA 4NHOA 4JIMA 4H1VA 2ZI9A 1P2TA 4Q4LA 4Q1AA 4RFSA 4R9UC 2QI9C 4JVLA 3ETLA 4DKXA 4S2EA 2NGRA 4I1VA 1E64A 2VNHA 1CR2A 4CEIB 2IYYA 1XJQA 3BGWA 3EIEA 1OIVA 1FZQA 2Q9BA 5KDDA 4HLDA 4EPTA 1F48A 1QHXA 1U81A 1WBDA 4B6EA 1DBSA 1DE0A 1S1MA 2W6JA 4E22A 3NVAA 2RGBA 3U6BA 4OQMA 1NBME 4LBZA 5FOWA 1GNRA 4QNRA 1QG0A 2NO9A 2QG6A 1N0VC 2BSAA 3B9PA 3NBYC 1IXZA 4C0LA 4DLUA 3B85A 2RB4A 1W7AA 1N8RD 1RW4A 4M9ZA 1W0KD 3AKDA 1E1RD 1NMYA 3OEED 2ATVA 5AJXA 5AK0A 1CIPA 1YVDA 1J7KA 1QHHB 1SVIA 1IXSB 4B47A 2HLDD 3UANA 1EX6A 1NVWQ 1ZC3A 1ZUIA 3AF3A 4H9GA 3W5JA 4DWJA 5ELXA 4AYTA 4B4DA 3T5DA 4AD8A 4YAFA 3I32A 4UNQA 1FP6A 4NH0A 1RYHA 1Q82D 4AWXA 2YKGA 2XX3A 1GL6A 2E1RA 1ZNZA 2ZRFA 2AFIE 4KV9A 1AZSC 3KJGA 5KDLA 2D2FA 2VP0A 1ZW6A 4BE7B 1GOTA 3TRFA 3IIKA 4L9SA 2OLKA 1QFJA 1N3BA 1KYIA 3JQRA 4Z8YA 2J7KA 2CHGA 1II0A 4LYFA 1ZCAA 4KXFB 3O8BA 4MGKR 4LGMA 2WSSD 3W8RA 4U5XA 1NKSA 4HUTA 2GBLC 2CE2X 2OSBA 2VP4A 1QVRA 2VO1A 3REGA 1T8TA 2VP2A 1FNNA 3B5JA 1JJ2B 3FKQA 1P73A 4LHWA 3W8NA 1OKKD 1Z6YA 3ZGXA 2XSZD 1TMKA 4O3MA 2VNIA 2VP9A 2BWJA 3HPRA 5LPNA 5L3QA 3FKSA 5FI0B 1EP3B 3X1YA 4LJ4A 1CJVC 4CRWB 2EU8A 1H85A 3SYNA 3TH5A 2DEUA 4JLBA 4ABYA 1M7HA 1CR0A 3IIJA 2Q9CA 2R6HA 3CX8A 1TQ2A 4LHYA 1R5NA 2ZYUX 4QRHA 3GD7A 5G3ZA 3O8CA 4TMZA 1D8TA 5KOYA 4HUQA 4L15A 4HAVA 3TW4A 2W0MA 3P20A 5K8LA 3U2QA 1LF0A 2GVDC 1DOAA 4IDOA 4KYIB 3QSYA 2FJUA 5GVRA 4HSEA 1YR9A 1KI1A 2O0JA 4CEJB 4AG6A 1G3IA 4KBGA 3C4JA 1T8UA 4NYIQ 2XOKA 4KJZA 1XWIA 2GNOA 2PBRA 2PX3A 1ZU5A 3IO5A 1XFAA 5FTLA 1KC8D 1PV4A 5AJZA 3FHCB 1QHIA 4RFSB 3FTQA 5TARA 3LFUA 1RRGA 3A8TA 4QBIA 2BMEA 1MRSA 1UKVY 2QU8A 1IHUA 3GFPA 3BC1A 4B3FX 4IXMA 1P6XA 3L43A 2QDXA 3W5HA 1GTVA 4EH1A 3RRNA 2P67A 4LYJA 4U02A 1CKEA 1WDTA 2QTVB 4M1OA 4KU4A 2OM2A 3Q7QA 4Y0AA 1Q3TA 3SQXA 1XD2B 3AVVA 4ZCMA 1LB1B 1YZUA 2AD1A 4ARZA 2O8CB 1W0JD 4OK6A 2VHJA 3BBPA 1Z6XA 3UIEA 2ONJA 4S35A 4EPVA 1Z28A 1M8PA 5BN3A 2ZRCA 1T5LA 2IEZA 3OJXA 3TKLA 2GF9A 1E2QA 1OYWA 2C9YA 2REOA 3P1JA 2GKSA 3F8TA 1E2NA 2JJ1A 2XSZA 4TZ6A 1NN0A 3K70D 2WPDA 1K9MD 4Q1BA 2C78A 1N6RA 4PSVA 3LVRE 3QF4B 4TTRA 3ZH9B 5B30A 1VQLB 1C4OA 4JBYA 3ZVLA 2FSHA 2OCYC 2J0QA 4D2IA 1VTKA 1COWD 3O8DA 2ZANA 4Z8XA 2F9LA 5JEDA 2NO0A 2OAQ1 2WBLC 4HATA 4A6XA 1YE8A 1F3OA 1L8QA 2N42A 2ZI6A 3A4NA 2XTZA 3LVQE 2HV8A 3BXZA 4F93B 5E95A 5FTMA 3R20A 1BOFA 3W90A 1NBMA 3CF2A 1X8JA 2R6FA 4NCIA 4EJSB 1Z6AA 2BM1A 3DZDA 4BLTA 1E6CA 2BMWA 3AGPA 3PUXA 4X8OA 3A1TA 4I81A 2EFGA 1D2NA 2YJTD 3KJHA 3QXXA 4FMDB 1ZM4A 1II8A 2YOHA 1S72B 5JCZA 1T0JB 2JDID 5AJVB 1WB9A 4LHZA 3MRSA 1W2BB 4HLUC 2YV5A 3BJIC 4C3ZA 1NG1A 1GRQA 4HAZA 3SDZA 1N0UA 4JYCA 4RD0A 3IHLA 2ZUCA 3UKDA 5JECA 3PENA 1EWRA 1CF4A 4A92A 1E96A 1GKUB 2JJ2A 3GLGA 5JJKA 1R7RA 2GXUA 2H18A 5L3SA 2W6IA 1FFHA 1Q1QA 3NEYA 3LQRA 4CEIA 2HXSA 2EYQA 3B1XA 1G8PA 2IS1A 1KI8A 1Z22A 1OT3A 3U5ZB 1VQ8B 2X1VA 4PHHA 3QQ5A 1WF3A 2QN6A 2A5JA 3KXIA 2LWIA 3FB4A 2J5XA 3PCRB 1VQMB 2N46A 2RGXA 3GJXC 4RCZA 1VQNB 2ODEA 2FFHA 3DMNA 4XVQA 4PANA 4CEJA 4N1AA 2V9PA 2J0UA 2IK8A 2F1HA 4XTRA 1ONBA 4ZDJA 2FGKA 5TDHA 3KQHA 3GLIA 2X8AA 3GCGA 1FW6A 4HUQB 2RCNA 3AVWA 2ZJ5A 2XAUA 4H1UA 2EFEB 821PA 5J4KA 2P6RA 3L8YA 5DN6A 1TADA 4PQRA 4FCTA 5F2EA 4A1FA 3EX7C 1YHQB 5GJVC 5F9HA 4FN5A 3W2FA 3D3QA 1G9XA 2CK3D 3QKTA 1HT2E 3A58B 1KK1A 3CCUB 3BWDD 4NP6A 4RKFA 4DDWA 3U7HB 3ICEA 2VZLA 5DSZA 3QBTA 2QUZA 1OGJA 2WZQA 2ZUBA 2H16A 2ZI4A 1IN6A 3CCLB 2EVWX 2AHOA 2JJ1D 4BEBA 4Z1MD 2R44A 2ZSAA 1ZNWA 4M1SA 1N6PA 4AKIA 4C0SA 1GL7A 3TNFA 1YR8A 3DOFA 3S1AA 1XRJA 4PC3A 4PXAA 2YVUA 3T61A 4CEHA 4M4SA 4FW9A 3DEFA 5C46F 3C5CA 1NDHA 1XXHA 2BJWA 1EG7A 5H70A 3DKVA 1JB9A 2GCNA 4Q48A 1HT1E 2BGJA 3ICQB 1HEIA 4G5GA 1EWQA 3BE4A 1QBKC 3KQKA 1G7CA 1UKYA 4UNNA 4A2PA 3ZC3A 4JJZA 4D0GA 4ZDIA 4YC7A 1HH4A 1S96A 2QNRA 3EIHA 4JJKA 4B2IA 2WJHA 3KL4A 4BFXA 3CX6A 3TR0A 4ZCLA 3EG5A 4CVNA 4AC9A 2BGIA 2MMCA 4II7A 2OAP1 4PAQA 4P33A 4D4KA 2C98A 4HAYA 4MDFA 3UWKA 3OIVA 4PSKA 4AYWA 2W2XA 2GTPA 4DSUA 3WP1B 4BLPA 4I1SA 2WICA 2F55A 1A2KC 2GK7A 1IBRA 4JVSB 3I55B 4RCYA 1MRNA 1PLLA 1RKBA 1YJ5A 4LY6A 2ZAMA 3N2IA 4PZZA 1VMAA 4RD6A 2WIBA 1N5LA 1KSJA 4ZPXA 2D7DA 4AKGA 1UBCA 1WBBA 2ZRBA 3FPAA 2GA8A 2F7SA 1YZNA 2C9CA 2VHTA 2C2HA 1RE0A 3B78A 2DERA 2JJ8A 5B64A 5HCNA 3KUDA 3MG9A 4Y7CA 1XD8A 3P4XA 2AX4A 5C2JB 3AKYA 1XB2A 2PJZA 2YWEA 2V6IA 2AD5A 2WV9A 2Z5FA 3AB3A 4ZKEA 3KKNA 2IUUA 1UAAA 1W4RA 2LKCA 4R7ZA 1FTSA 4BFWA 4LJ5A 1E2PA 1X6VA 1PUJA 2GXQA 3UMRA 2XOKD 5IDVA 1E2DA 4BEJA 3T1VA 1MV5A 1Q20A 3K0CC 5G53C 3KB1A 1G6HA 2Z4RA 1KD1D 3TUJC 3A1UA 1G5RA 2XZLA 4M1KA 2IYWA 2RAPA 5ANRB 3W2HA 1KY2A 4DLVA 3R9WA 4C2TA 2ZE5A 2XJ4A 3K0FA 1FUKA 1HQCA 4L4UA 4B2LA 5DH9A 1ZM3A 2DPXA 1Z06A 2OLJA 2ZR9A 5FUYA 2Z43A 4HDQB 1W4AA 4J0QA 1FUUA 4M2LA 2BKEA 4O2RA 1ODFA 3D7MA 2JLRA 2F43A 4TN1A 4HYYA 5GJWC 1G3UA 1XTQA 4QBGB 4E03A 4E5UA 1DELA 2IUSA 1G6OA 2I1QA 4DC9A 3E1SA 3PJRA 1N0WA 1WA5A 2B8WA 3I72A 3QJYA 3GJ5A 4NYMR 1OB5A 1Q22A 2XB4A 3PVSA 1Q57A 5EE5B 5EE0A 5DE3A 1JPJA 2ZE8A 1GL9B 5K8TA 4F7DA 1NLYA 4MA4A 3T34A 1TNDA 4ZI2A 3OFND 2WKQA 4V03A 1R0XA 4Q9IA 1GZSA 2G77B 2P65A 2QGZA 4TMWA 3FMIA 1TF5A 1Q1ZA 4NYIR 2EFCB 3ONWA 4C0BA 1PJRA 3ADBA 1R0YA 4Q4JB 4RSGA 1F2TA 4DB2A 4GT1A 3ZJYA 1GKIA 1SVSA 3D31A 1DAIA 1W34A 1G8HA 1UF9A 4TMXA 2ZEJA 3FJOA 3L8ZA 4F4JA 2ECKA 1DS6A 1JJVA 5H1YA 4DXAA 4AY2A 4FIDA 5CB6A 2ZRHA 3G6EB 1N6IA 1FPMA 1S3SA 1NJFA 4JSTA 5JS8A 1AKYA 3K70C 3LY5A 5AUOB 5H5JA 4ZCIA 2ZTSA 4Y9UA 1ZIOA 2E9SA 2RH5A 4IFBA 5JHHB 3TGPA 4M53A 1Q44A 1T91A 1E79A 3LO8A 1U8YA 2ERXA 2P2LA 2G3YA 3F0TA 2WTUA 2GXAA 2OZEA 1IONA 5FPSA 4GMXA 1FNCA 4GPTA 2VSXA 1J99A 4LWZA 5B2ZA 3BFVA 1Q21A 4JBWA 4WW0A 4EIWA 2Q3HA 2P6UA 2YC4C 3LBIA 1KJYA 4TT3A 1Z29A 3I1FA 3DO6A 3TIFA 1BQEA 2IYQA 1JXMA 4Q9JA 2PL3A 4Q1CA 1UKEA 1W46A 3H84A 2IEYA 2QAJA 4TQUS 3PEUA 1GP2A 1XCPA 1EXMA 1DEKA 1J8MF 2QM7A 3H1TA 4B73A 4BWYA 1ZU4A 3DL0A 4NBSA 1W36D 2QQEA 3RS4A 3QG1A 4DIDA 4LOAA 1DAKA 2B8TA 3CRVA 4LJ6A 4ASUA 1JALA 2C5LA 2C03A 2HJVA 3QKUA 1KNXA 2GCOA 3CRQA 5EE1A 2WWWA 4RZ2A 3CLVA 1RZ3A 1FMJA 3K0FB 2AN9A 3VR4A 1DTSA 4IVPA 3CD6B 4A36A 2AXPA 5J40A 3OESA 3K9NA 1GNPA 3F3YA 3CW2A 2ORWA 2G0NA 3AF2A 2ZYVX 2ZUDA 4HB3A 1RPZA 1II9A 2CL7X 4XTCS 3THXB 3C14C 4FWIB 1GRNA 1CJKC 2QQ0A 4YAOA 3CC7B 5DLQC 3ZYCA 4B3CA 1S9DA 2IYLD 4GI7A 2GRJA 4OK5A 2XXAB 3QFCA 3WY9A 4CEHB 2YC2C 4PSAA 3Q8XB 3GP8A 3JVUA 2ANBA 2ZJAA 4RFVA 1TQ4A 2B7CA 2C8VA 4AKEA 2BJVA 1KKLA 2PT7A 4PO1A 3TSZA 1G21E 1FX0B 1R0ZA 3BFXA 1NL3A 2CCJA 4M1TA 3ZD6A 1K73D 1CRPA 4MKIA 2QEQA 1YQTA 4RY2A 2JCSA 3UG7A 4QG7A 4HB4A 1Z0DA 3KQLA 4C0QC 1Z47A 4BFZA 4CYMA 2ZVPX 1Q81D 5CM9C 3TAHA 2EQBA 4M1MA 4OQXA 1FMLA 1KO7A 1SZPA 4Q19A 1KSFX 1MO4A 2DFNA 2BMDA 4E07A 2BMFA 2ASEA 1QG2A 3IQXA 4OKSA 3FGNA 3LBNA 4IDNA 3SS8A 1ZYUA 2CHVA 4A4DA 4B44A 4FK8A 3WRYC 4GBMA 3EC1A 4C0JA 4EUNA 3HPQA 4V0LA 5FPHA 4M9QA 1P9WA 4D82A 2YWHA 3G4SB 3QE0A 2R6CA 2PEZA 2CJWB 2ZU6A 5GVSA 3PV0A 1KOFA 2JLSA 2ZU0C 4IFEA 4UQOA 1NLZA 1XEXB 3UK6A 2FSGA 3DDCA 3GLHB 3CH4B 4DT1B 4W9MC 3I5XA 5KO2A 2LKDA 1BX1A 3EZ9A 3VU9A 1ETUA 1H8HA 1U90A 1AK2A 4Y9RA 1N25A 2GBLA 1JQLB 4LJYA 3SU8A 3CNNA 1RRPA 2CLCX 3OJWA 2I1VB 3QENA 4DUGD 5A4JA 3IQWA 1JI0A 1KRHA 1KAOA 2PCJA 3RC3A 3SHFA 4IOKA 4WA7A 2A5GA 1P9NA 5AWFC 2IUTA 5AN9A 3QKRB 3EZFA 2PT5A 1OSNA 2O0KA 1CS4C 4K46A
chains in the Genus database with same CATH superfamily
4MUFA 3STHA 4PSCA 1E4VA 1WULS 3BKXA 3EE6A 4OA5A 1SXPA 1KR2A 2Z8ZA 5HGJA 2WNSA 4WACA 1SGWA 3C3XA 1P44A 5ADVA 4DOMA 1FTGA 1T4CB 4RFLA 4TSFA 2REBA 4CM9D 1MA0A 4BOYA 5HS4A 4L3WA 3WHIA 1XTIA 2WF9A 4P98A 4F60A 2MDTA 3EISA 5J23A 1HSOA 1EH5A 1P29A 2VR1A 2PLNA 3CNLA 4UM9D 5KYVA 4ZI5A 3QXHA 1MFZA 1A5AB 1CULC 2B20A 4G0MA 5L51A 5BYAA 3CF6R 1OXBB 1SB9A 2RGDA 1L8LA 3BCHA 2PL9A 4AKTA 1JA0A 1IRXA 3JYOA 3SHOA 1QR6A 3RJTA 1J8VA 2D1SA 4BO7A 2J4FA 5EC8A 1W47A 5JAHA 3ZDCA 4ZYTA 1P2UA 5JAPA 1U2RA 2CDAA 2DUNA 3V4SA 2EFHB 1RAIA 4BVGA 3H2HA 3WDMA 2YRXA 4YR7A 1JVSA 1LI4A 3H7IA 4BNTA 2XMRA 2DKOA 2AG8A 3G82C 1QORA 1FDUA 3FPJA 5CB8A 7REQA 1GNQA 2P9TA 3HR4A 1X3SA 2CBZA 4MGHA 5LUAA 4PHFA 1QSGA 2D4AA 2ZGVA 3HJUA 2R96A 1MB2A 5EE3A 2GCIA 2Q0QA 1OXTA 2O1EA 3ESQA 3HA2A 4DG5A 3E9YA 4TVSA 5AVRA 1H2YA 2E4XA 5HKKA 2SKCA 4XWAA 3CLTC 3J7AC 1QCZA 4G1CA 3SC4A 4KO8A 2H29A 2H2GA 4ZK2A 5JFOA 4B3RB 5BXQC 2X76A 2V6FA 4Q9NA 4I5DA 4PQEA 3SIXA 4ZEVA 4QOSA 1JNYA 1EFVA 1E9RA 1KDRA 1TL7C 3EUEA 4JH0A 4L8WB 4J0FA 4MI6A 1J5XA 2JI9A 5DMXA 1IK4A 5KNCD 3EDCA 2QBYB 4KAFA 3HKEB 2V9CA 1ECJA 3QF4A 1KERA 1NP3A 2V45A 1LX6A 3O4GA 1LWOA 2CE7A 4GOXA 4K9LA 1D9XA 4LJLA 4PRYA 2PR2A 5HE9A 4CHTA 2F3RA 4B3DA 4DXHA 3O74A 1CY4A 3E4DA 4IXWA 2G88A 5DU2A 4FJ0A 3HEBA 2G1AA 1USIA 3EDYA 3I0ZA 3MOGA 2PVSA 3NCTA 3OKPA 2DWPA 3QVSA 5KPDA 5HF8A 2XADA 2HMAA 3SM3A 1M75A 4LJ7A 4CODB 3R7WB 4PQGA 3T06B 2FA9A 2BFNA 1V8PA 3OLVA 2HQBA 2ZR7A 4JB2A 4RA9A 5TQ0A 5AW6A 5AW1A 1RYBA 4H7KA 4OI4A 1QF7A 1L5ZA 1VIAA 3R6DA 4JOQA 4Y1EA 1DMRA 1YUMA 3NWPA 4Q7EA 3OLXA 5KAMA 3ZI0A 2W2KB 4AJHA 1P2DA 2ZZKA 4M98A 3QU5A 5J2TA 1OFUX 4TLLB 3RV3A 4KMSA 4H17A 2Q4RA 3RF7A 5H80A 1ZK2A 4YYZA 4JNCA 2V7VA 2WR8A 1DV1A 2OG1A 1L4KA 3BZUA 4DTIA 4EPYA 4CN9A 4RTOA 4LF9B 5AI5A 4E4TA 1I2MA 5K7SA 1GR1A 3IUYA 2XT0A 1DAGA 2YZKA 3E9CA 4L51A 2ZZMA 1JH8A 2QL9A 4OKIA 1RJGA 2GPYA 3RDPA 4F11A 2AJTA 5ALVA 2L42A 2DR2A 1IN7A 2H7XA 3O73A 4FN4A 2RMKA 3JQBC 5DGHA 4R9VA 2ONKA 2QA5A 3FZEA 9ATCA 3L6OO 3VJMA 5CEEA 3H6HA 4HTFA 3Q87B 1BFKA 3QWFA 1E5TA 3OC0A 1ZUNB 3A3PA 3RNLA 5K6RA 121PA 3UTCA 2APJA 3X2FA 2IITA 2XGJA 4URZR 3A6PC 4X62B 16PKA 1RVV1 5KI6A 4KRGA 2YASA 2BEWA 3VRHA 4Q7MB 1JLLA 2YL2A 3A6HA 5GM1A 4AN1A 2HIMA 5JRJA 4N48A 5EYPA 2FG7C 4BRZA 5E7QA 1Q0UA 3PFCA 2HSDA 2OFPA 1L3IA 4PNHA 3UV7A 1G291 2RI0A 5EZSA 3GFTA 3WSWA 2CUZA 1W1WA 4G1EB 4UU8A 4CKBB 3PUZA 1RQGA 5BV0A 1HOTA 3DEJA 1SQGA 5E8JA 5DK6A 4F85A 1FDIA 5HG0A 4AMVA 3MGBA 2PUHA 2BM8A 2ZYTX 4JLNA 3A2NA 1YZLA 2YW9A 4XM1A 2HIGA 3TFOA 4J1TC 4WXEA 2XA1A 1TF7A 4BUZA 1LQ2A 5EFOA 4I55B 3A31A 1EUYA 2IZ0A 4FM9A 1ZY2A 2YRWA 3LX5A 1HFWA 1NUSA 5LQAA 2GDZA 3QA9A 5DBOA 1P4JA 2ZJFA 1QRUA 3MTIA 2OK8A 2CBXA 1KEEB 1DRKA 4Y6GB 1E7QA 2XGMA 2EKDA 1SKQA 2Y27A 3B1YA 4I1IA 1T0HB 4JB8A 4K2HA 3O8OB 4NI5A 5AKGA 1WTHD 3PICA 4DWWA 5HQ3B 1O89A 4Q03A 1NW6A 1AK9A 2VBCA 2C2XA 2DGDA 5TPZA 1NT4A 4HDAA 4A2WA 3JQDA 3C3EA 4YRSA 2UZ3A 1YQ9A 2I2BA 1UC8A 3EN0A 4OL0A 4F71A 1X86B 4R9NA 2EQAA 4CQLB 4YCAA 1ORHA 2JFHA 4YRZA 4Z4VA 4RZXA 1DQNA 4WZLA 1U99A 4OSPA 5A2GA 1I4LD 2R66A 2ODNA 3G2OA 1Q19A 4A10A 3DKIA 4PYMA 5IU6A 1MIHA 2QRHA 4TT8A 1QIIA 4YCCA 3IOYA 2V7UA 3AK4A 3RHSA 2JIOA 1KARA 1ZAKA 5JOQA 4CF4A 3TOXA 2VDJA 4U6SA 3SFVA 2Z8YM 3ETJA 1GQFA 4MCHA 3GVLA 4PFKA 4RUKA 2PGIA 1NYRA 2HMVA 3I8XA 4EO9A 3SZRA 3EVBA 5E9AA 1E7SA 2VI5A 3KDAA 2ZYWX 3B6KA 4I7EA 4MV7A 4C7JA 2JBAB 3HU1A 4BAGA 1ZXBA 1GGHA 3CA8A 4QUIA 2YFYA 1MHTA 4ACBA 5EHGA 4L02A 1V71A 2O7NA 2PT6A 2QYHA 4JJ8A 3BKWA 2R6R1 3BGSA 2R4UA 2Y6UA 1IY1A 1PO7A 3DBRB 3F5FA 4HDNA 4ZHQF 1T3HA 4RVGA 1PFGA 4P5EA 1V11A 3KT8A 1E5QA 2AN4A 1JTVA 3EXG2 3EZ7A 4TYYA 4OJNA 2AN3A 4IDDA 2WUVA 5FPYA 4XOTA 1NBMD 5D86A 1E9SA 3OECA 4BBZA 1YL7A 2IY9A 2VXYA 1Q7YD 5JLJA 3E9RA 2R9VA 1OXMA 2AXNA 3D3KA 3PDIB 1SBNE 4XLFA 2EQ5A 3FSGD 5HP4A 5GOTA 1QF6A 3JASB 1RRKA 4CF3A 2J5RA 2PVCA 4MPPA 3N8IA 1NJ2A 1FNMA 2I34A 1ZISA 4XYMA 1STOA 2X41A 3PCTA 1X1QA 4KJXA 3UJ8A 4I1UA 4FGSA 1EB8A 2JD0A 3K05A 5TGZA 3ZWNA 4YLYA 5ICEA 1NM5A 3TZQA 3CZPA 5F1KA 5HVNA 2OZPA 1W88A 4OHWA 3R7AA 4C07A 2ZWMA 3LUFA 5F4ZA 5JO9A 3IP3A 3WLQA 1HDGO 1QLJA 2C7BA 3FTNA 4BB6A 3CGWA 1U65A 1Y80A 1FQKA 1N2SA 3PC4A 5ALRA 3RBAA 2XTNA 2W58A 1QYVA 3DB2A 1JIKA 4A5SA 5CIWA 4BP8A 4EHKA 5A7FA 4AB1A 1CR1A 2GARA 2ZM5A 5DGDA 5EESA 5A04A 4WZBE 2WA1A 1RXUA 2AK2A 2CK3A 3FI0A 4OXQA 3RTDA 2R00C 3EZGA 4PXSA 1H2FA 3OD1A 3TB6A 3COYA 1DDIA 3FSRA 5GZ6A 1XDGA 3EVFA 1NATA 5FF9A 2WFMA 3K1JA 3AF1A 1N8NA 1YB6A 2BCGY 3FJ1A 2E4WA 4QOFA 4KRYA 1H1LA 1P2VA 3B8HA 3M0EA 1JIXA 1B0UA 3FBTA 2Q3EA 3RIHA 5KKCA 4LYYA 2OFWA 4C7MA 5DTRA 3LP5A 3BIFA 2XW6A 3GUHA 3LX6A 1P5JA 1KK2A 1IE3A 3R6LA 3ASZA 4DQDA 3HADA 1JR3E 2NU9A 5M04A 3S8MA 3WMEA 1ORRA 1RXEA 5G41A 3TMKA 8ATCA 4EFKA 3CSSA 2IZOA 2P78A 5I7VA 4MR8B 3PEWA 2IQIA 1PJTA 2GN6A 4G67A 3H8WA 3U7QB 3T3DA 2WWGA 1YBHA 2PBZA 4KDEA 3UJ9A 5CB4A 4YMTA 1SUDA 1ND6A 1QH9A 5A7GA 1YJWB 3PDHA 5DCWA 3W78A 3O3NB 4XI9A 4LN1A 4QD3A 4H4DA 4LYEA 1SOAA 4G4IA 3KT6A 3OQNA 1OFTA 2Z6VA 1QHYA 1KGDA 2AOTA 3AP2A 4CGYA 4FNOA 2OESA 1YS1X 4G65A 2X2PA 3VU3A 2FVXA 5C1PA 2A0KA 2P3QA 2ZQ5A 5JH7A 5KNCH 1KO4A 3BGIA 3BORA 1H05A 5ICMA 2ZCUA 1TTTA 2O2YA 2WW8A 1XZLA 5M5BA 5BVGB 3VOTA 1YQXA 3UENA 5CFPA 2C5BA 4IOMA 3G2PA 2O14A 4E51A 4QUBA 5LQUA 1N5DA 1YI2B 1DXYA 1JFFA 4PVDA 4REMA 4CMEC 4AU1A 2G72A 3EXFB 1AQUA 1FDRA 2QTWB 4ZIRB 5A2QA 1K89A 1W6RA 1W9XA 1RWMA 4U8HA 1LNQA 4S0ZA 3Q7IA 5J4VA 1XKLA 3K96A 3A1SA 1EX7A 1NRWA 3LXMA 2IKSA 4QDJA 3ZQUA 5KNBH 4N5MA 3Q4GA 3C6YA 3AM4A 1YK0A 4IO1A 4BX0A 3MJFA 3FFWA 1LK5A 5P21A 1PN3A 2JCXA 2P5YA 4JY7A 3MBIA 1XEXA 3IVAA 4LZZA 4B76A 1DQPA 4DDTA 4MLDA 5FO0A 3VDNB 3HGQA 1M6HA 1HG1A 1Z0KA 3GFSA 4IX1A 3S81A 1XJCA 2XE7A 3C3PA 1VQ5B 5AI8A 1Z33A 1FLVA 1QQ7A 2WIKA 4U2EA 1KH2A 3EG9B 1G3MA 2QX9A 2H57A 3D8RA 5E7IA 1GG2A 4H1TA 3ZHOA 5CDSA 2FWRA 4IEEA 5SZKB 1RJ9B 4NCJA 2VF4X 3L0ZA 3AF5A 4B3HA 1ONOA 1A9YA 2R48A 3OLQA 1V3TA 2V7BA 4HYQA 4ZANA 4QU0A 3MB8A 3OCXA 1PE0A 2A9KA 2FR1A 1X1DA 4X6YA 4BDSA 2WNIA 3QY0A 3URKA 2PQ6A 2P1RA 3A3BA 3REFA 2VUIB 3DZHA 3UFXB 4D79A 1H4SA 3T5GA 4M0FA 1DNPA 2GEBA 4DVJA 5IVKA 1OI7A 2GWHA 4A2QA 2RGNC 3AR5A 2QXTA 2IDJA 1DHTA 2YBDA 5C4GB 2FWMX 4L72A 1WPQA 1EESA 2I7CA 3FMFA 3M5WA 4ISCA 3R40A 1Z18A 4W7SA 4R2LA 3EJ6A 1RLMA 4NMLA 1XCBA 1SRQA 2JDIA 2DBZA 3GDFA 5HFAA 3TL6A 4TTSA 4WX2B 4RHUA 2IU0A 1EXVA 5BN1A 4BRUA 4P2NA 1X1BA 2W0SA 4F84A 1KYYA 3MD9A 4GXRA 1SBCA 5DASA 1OB2A 2PH1A 3MSXA 1HE8B 1HDEA 4ZMBA 3VR6H 6LDHA 1DG3A 2O2EA 4K5QA 4P7BA 1SHKA 1BTOA 2NUTB 3CV3A 3O47A 4B8YA 3CZQA 1DKLA 3SYLA 4AJPA 3BS4A 3N8NA 3U4AA 4G63A 2DU8A 2YJZA 2W2LA 3A1NA 1JN0A 2CT8A 4YAGA 5CDFE 2YV4A 3EFBA 1Z88A 1ZX1A 2NZYA 3LAWA 3PYMA 1RLOA 1U0JA 3GN2A 4HQNA 5BW6B 4YAUA 4WN9B 4XUDA 1SH7A 2ZUVA 3RR2A 3G02A 3CNHA 2FEPA 1J70A 3A2MA 1T4CA 4H1WA 2QT9A 2B4KA 5FWXB 4DV3B 3VX3A 1IOLA 2P2ZA 2ZIGA 3QNUA 1O0SA 3ETHA 2HDHA 2F1OA 3WR5A 3R74A 4BQSA 4IDQA 5IXSA 1PT9A 1BROA 3IE2A 3UAZA 4BMYA 1GSHA 1GWNA 1V16B 3BDAA 2IHZA 5IARA 1GEGA 5ENZA 3ZD7A 1IQRA 1YIDA 4FKZA 4BNXA 4X0CA 3ML1A 4J1NA 1ESZA 3CURA 3OQOA 2JLBA 3DGFC 4M0DA 2R5NA 3ZDFA 5INTA 2ISQA 1YR7A 5JXGA 3D7NA 2I54A 4CTKA 1BN7A 1FLDA 4U00A 3W6PA 1GUBA 1DAEA 1GKLA 3SBDA 1CDEA 5DIFA 2H92A 3UGJA 1HYBA 3MUFA 3HVJA 1L1FA 3ASQA 1YK1A 3HXPA 2C58A 3O83A 4FP9A 1A8SA 4NU0A 4H6PA 4DEYA 1X7GA 1AO3A 2IXBA 1CT9A 3PNLA 4UBNA 3R76A 1SA0A 2Q8PA 2P4EA 1TO2E 4IIJF 4ECEA 4WVFA 1YONA 4BZXA 4EGCB 3SKYA 3SMVA 4INOA 3M4JA 4LXQA 3NDBB 1I8TA 9LDTA 4E08A 4P7FA 4P58A 3EIFA 2CVFA 4D9MA 4HSGA 2XB6A 3IQHX 1FSPA 3A9WA 4YFYA 1OX5A 2DIEA 5ENDA 3QBVA 1H22A 1DUSA 4FC6A 1QLHA 4DCTA 3N28A 2JFXA 2N1BA 4FD2A 2IEIA 4ZOQI 5HHTA 2W6NA 1OTHA 1UEIA 2A1IA 2GSWA 2HLDA 2WWHA 2VQFB 3A1PA 2RGRA 2DMRA 1LY1A 5EHZA 5DYIA 2OV2A 1CNEA 5FWYA 1WCWA 2BE7A 4MUBA 4TQAA 2PK3A 3IAXA 4CLOB 4URVR 2QZJA 3A37A 2QGGA 3HSKA 1DLJA 1C7ZA 2ZYDA 1Q1BA 4RJJA 3VPSA 4I6EA 4U63A 3VYSB 2BIFA 1UIMA 4LHXA 3V1NA 3TPCA 2WDPA 5T57A 4ZO6A 9ABPA 4ENRA 5KNDD 4K05A 3H9QA 1ECLA 2UKDA 2OBFA 4NE2A 1MAAA 4ZVOA 5TVGA 1WVIA 3P9YA 4LISA 5CFRA 4G0WA 1H0RA 4QM6A 4HADA 3RSHA 2DHCA 2VRWA 2Q6LA 2CL0X 2J3DA 1RYNA 4RDLA 2M6RA 3SIWA 4MK4A 5AFSA 5F1YA 2CFTA 1YHNA 4GR9A 1U6KA 4BS9A 5BSHA 3BOSA 2HM7A 4NJEA 2XUKA 3HB7A 3AVYA 4D45A 2QVCA 3IDQA 2XTAA 3S5UA 1D5WA 1E6WA 3ZE7A 1PFQA 2IHYA 5FOTA 3VR4D 3F49S 3MWFA 4RSRA 5CDHA 5LU9A 5AM4A 1FL9A 5CH3A 4JFRA 1QZ3A 4M9RA 3LY7A 4IV5A 1E92A 3HVUA 1U3VA 3AQ4A 3D1VA 3U0VA 3ZZMA 4JBXA 3GVCA 1QQAA 3CC2B 4J2HA 4CLOA 3ZBUA 2PZLA 1G3QA 4FD3A 1BHQ1 1SG6A 1ZCJA 2H1FA 2PKYX 4QTUB 2OBYA 4M87A 4Q5IA 1FBNA 2QTFA 5JCJD 1ISRA 1K2WA 3RVSA 3PVDA 1Y3BE 4OM7A 2X8BA 3U3DA 3QTLA 3CPHA 4K86A 1JAIA 5D6OA 2QZ4A 3C1OA 1RP1A 2C8JA 4G6ZA 3OMWA 1ID8A 3NIBA 3TUIC 4FZ3A 4IMJB 4J0JA 1EJBA 2HWUA 2IYFA 3HEMA 2HCFA 4HQRA 4RL6A 1XL0A 1HURA 2GZAA 4DLXA 1FSGA 2ZXIA 1SC3A 2IYRA 2WJIA 3B60A 1HDCA 2NTYC 1Z83A 1JU9A 2OORA 4KTVE 4UEJA 4XGRA 1E2HA 2ZBUA 1U7XA 3N2KB 3TDMA 2ZYRA 4ZVRA 4LG1A 4ZCQA 3ES9A 4BNWA 1UOQA 4DHEA 1W5FA 1X9IA 3DHWC 3KVNA 5BWOA 1X87A 2VBTA 5KWIA 1Y1RA 2CC2A 1JQEA 3FUXA 2ZTNA 3G49A 2VPQA 2JN9A 3B1KA 4AMBA 1ORDA 4YQYA 5HM8A 1F2TB 1GADO 2JIZD 3TK1A 5CA1F 2NT3A 3QLUA 1GDDA 5JJIA 5DWQA 2P2YA 2VT7A 1JLRA 5KSYA 1YJ8A 2G82A 3IV9A 4RKYA 4RY0A 1W36C 1ES9A 2OLEA 2ADMA 4FWBA 4YMVA 1YZGA 4AKSA 3NC0C 1I4EB 4G1BA 3AXTA 4BZQA 3O82A 1JXOA 4D97A 3E48A 1RJEA 2PFGA 1U2ZA 3FAKA 3K4PA 3PR3A 5I7UA 2A30A 4MJ3A 4EHIA 3HXOA 4IX9A 2AOXA 1XXLA 3G5TA 3S4YA 2Q8NA 4N82A 5DXJA 5I7FA 9GPBA 4KXNA 4M60A 2YWCA 2ZYGA 4KBYA 4WESA 4R40A 4RPHA 3ZQ4A 4UCQA 2F2TA 3MYRA 5AMXA 2Y68A 5ESWA 2QRNA 2ZKIA 2EL9A 5CHYA 2W6ID 3A36A 1R0WA 4FGUA 2GN4A 4IMRA 2CXQA 5HMMA 1YS7A 4K9MA 1XTKA 4RIEA 3KKOA 3V7UA 1I2ZA 5BORA 4AG3A 3G71B 4L8VA 5CLJA 1THTA 5M2QA 4LDPA 3B3JA 3A3GA 4XLZA 1DDGA 3BA6A 1V9SA 2QGNA 3JPWA 1PSDA 3VO9A 1ZUNA 4NEGA 3CG0A 4G7WA 1GUZA 3K9BA 3OX1A 4S05A 2I6QA 4OFBA 2XWSA 3AJ8A 1JDNA 3F7MA 5TS2A 3AERA 4NOKA 2DPYA 3DF7A 3PPIA 2IW3A 5JQWA 2BEJA 4MVJE 3QE9Y 1HPLA 2NYVA 4P22A 3CUEF 2PZGA 2I7DA 4PGOA 1ZM2A 5HW0A 4X65B 3TGLA 1QCDA 1NP7A 3LH5A 2FKAA 3AFIA 4FQ8A 4Y2HA 5I7AA 3R7SA 2C4VA 4GPBA 2P90A 4Q82A 5ULLA 4QBTA 2OCKA 2VHXA 1N7JA 2I4OA 4GPZA 2M32A 4ND6A 4Z9FA 5HKBA 4HDSA 3DZCA 1HYQA 4RTLA 2JFUA 4BWVA 3OZFA 1M2HA 2ZBFA 4EY5A 4R69A 4DW8A 2OG2A 4GZMA 4JLDA 3UEOA 1A1VA 3PQ7A 2QLLA 4P83A 2B36A 4B45A 2GAJA 3II6X 3IEXA 2CNDA 3NO4A 1HY3A 1E6MA 3KLBA 3PUWA 4L7QA 1ABBA 4R6WA 3WKCA 4K9KA 3OCYA 2Z08A 1KTIA 4HE5A 1SQFA 1P45A 3DHVA 4G5QA 3EGWA 3O8RA 2GCPA 3KSDO 4ODIA 4D3DA 2G6BA 4Q4JA 1CR4A 3OQJA 5EMNA 1E6EA 2F3QA 3H05A 4H3VA 3VYVA 5LMUB 5AW9A 1BEUB 1E79D 1XKTA 2D3TA 4NLLA 1TM1E 2ETXA 4IHKA 4JL6A 2NT4A 3PXUA 3THYA 3GLFE 3VO1A 1A7UA 1ZITA 3V7FA 1LSOA 4X3CA 4QPCA 3K8ZA 3DL2A 1VHJA 4BVLA 3ND7A 4EOGA 1RBQA 4LX8A 1Q6YA 5FDFA 5F4BA 1R00A 1V8OA 5CYFA 2D2XA 1NA5A 2VPPA 1IFXA 1I0ZA 3O8OA 2FXVA 3G5AA 3OIFA 3ORRA 1JBKA 3QEMB 1GPJA 1QHEA 4UDOA 2TS1A 2EP5A 4O1HA 1ZZGA 1RAHA 1U7PA 1XALA 3QJ5A 4KUHA 4CE6A 5EZ5A 3OZUA 2P6PA 3FB1A 4B7AA 4L0MA 4CMKA 3ZWQA 2RBGA 5GM2A 4G37A 5CMLA 1HXHA 4B5LA 5L40A 3J81k 3BD6A 4IGFA 4AX4A 4JHXA 2HRCA 4NULA 1JV2B 4EB6B 2C3YA 4GXQA 2RBEA 1E2FA 4R7GA 2AK3A 2WB2A 1UBHS 3HY4A 3PVZA 4YXWA 2CUNA 4WGFA 1O58A 3PC8A 3DLHA 4L8JA 1M2OA 4YRQA 2NVUB 2FLKA 4BQRA 4D4JA 1LCIA 1RC1A 4UXHA 3W0LB 2PMCA 3KEQA 2VHZA 1EPUA 2OENG 4WNIA 1VIYA 5KSOA 2OBTA 2NV0A 2OGUA 2RGYA 4IDCA 4TXNA 2W70A 1J23A 1I94B 4UULA 3T94A 1E99A 2CXXA 4KXQA 1WZ2A 1AKNA 1ZGBA 1GUAA 2WFZA 4TOIA 1Q86D 3RY8A 1J2YA 1MO5A 2DR0A 3FWYA 2ZZNA 4NV1A 2HRZA 2ZRMA 1W5TA 3QNMA 2V3WA 2M1XA 1ZM9A 1FUIA 4ZOLA 1JEAA 1JXQA 2BFOA 1S02A 3L01A 1HE2A 2RGNA 2GN0A 3GDHA 4EYOA 2FR8C 4L9AA 4UCWA 3LDGA 3P27A 1BDMA 2IXDA 4HL6A 4RQBA 2J41A 5EP4A 5K6TA 3IX7A 5DWDA 4XGKA 3MTEA 1DAFA 2PRYA 2FOLA 1O7JA 1W88B 5JMTA 5ARCA 4PO9A 1WVGA 5CYPA 2E48A 4JX8A 4BFVA 3LPDA 4L07A 1SCQA 1FP4A 3ZBTA 3HJTA 1KDYA 1IN1A 1L4GA 2X58A 3VZSA 3G05A 3THXA 3C3KA 2R6AA 3DE5X 4BLSA 4N41A 3KXKA 4CDMA 2VBSA 3J7TA 1EBFA 4BVEA 4BLOA 4XONA 3I2HA 2QJTA 4OQYA 3JASA 4BVKA 4X6XA 5K45A 1XNRB 3OLCX 2XD9A 5FOVA 1PF7E 5DI9A 4P34A 3DO5A 3CR7A 5AVUA 1NQ5A 4B4KA 2GJPA 1KJ9A 2HO5A 3LUHA 4ZA2A 4UVEA 4DQ0A 5DNYB 1T36A 3QKIA 3RARA 5IUJC 5IZ4A 4P3PA 3SLRA 4AJ1A 3UT0A 4KVAA 2I33A 2TMGA 5CPBA 4JUDX 7GPBA 2KE5A 1NUPA 3V8NA 4RA6A 4RD2A 5CXUA 3FMVA 5DW3A 3ZEAA 3VKHA 4QXOA 5E3HA 4PLVA 4JXKA 2QTLA 1M2JA 4I19A 5FV4A 1EIWA 1FYDA 1XZEA 2DFDA 1TD1A 3CINA 1UK6A 4L8YA 1WMBA 4TL6A 4UOEA 2IX3A 4MUAA 3B7PA 4M7RA 3TW8B 3N8KA 3OZGA 1VOTA 3AINA 3F4BA 2H9IA 4KPEC 5DPMA 2FWBA 4B6FA 1W36B 4CG2A 1DC6A 2G9NA 4BNYA 2ZT6A 4WZAB 3CW8X 4WZBB 4RHFA 4O2AF 3SXUA 5CX1B 3Q9LA 2ASVA 1H9BA 1OAOC 3U09A 1I7DA 3AI2A 3I6BA 5K8UA 4LI3X 3LECA 4E4YA 2NSHA 4US2R 1RHJA 1TM5E 2QVLA 1XCMA 1H1LB 1X2EA 3BMOA 1E62A 2IA5A 3HB9A 4ARBA 2GA9A 1W87A 4WDQA 5IT9A 5EFZA 2I2AA 3ITNA 3ZGZA 2D5CA 3KO8A 1QJ4A 5IT5A 2PRSA 5A7HA 2QMQA 4X64B 4RIIA 2PXCA 2GBIA 1VECA 2NXEA 2BGMA 1IHYA 1CY0A 5ELLA 1T24A 1C80A 4GMDA 2X9QA 5LN1A 2R6DA 1RC0A 1ZH8A 2E6UX 3GRYA 4JDPA 3JQQA 4LNAA 1EDOA 4PO8A 1JKIA 4PPGA 1L8XA 1ULUA 2ODBA 1U0LA 4EDHA 3WGMA 4KWCA 5KJFA 4RY9A 2WUDA 3FF4A 5B1YA 5DX1A 2FV8A 1C7JA 3HYCA 1V7CA 2W8BB 3JYQA 1UC9A 4C30A 2VZ9A 1IU9A 1C1YA 3NB0A 4GR4A 3GVPA 4FJ1A 3W06A 1CB7A 3U3MA 2YJ4A 5AW8A 5HQ3A 3CX3A 4RHXA 1I3CA 3K8YA 4J94A 1LQUA 4V1CI 1PYOA 3B3AA 3AJDA 5H3HA 2R0QC 4HBGA 3PC6A 3FFBA 4DR6B 4CF7A 1H8EA 1C8LA 1Z07A 2AE2A 2NUPB 3AY7A 3OSZA 1N2CA 3BY2A 4BMCA 2BH2A 1OH6A 2FEWB 5K0NA 2I1WA 2XEXA 1NJ1A 3FTEA 5EJGA 1NXOA 4RV5A 4JXXA 3V3TA 2BD0A 1LW7A 3ETCA 3SOPA 4NCBA 4FOSA 4C5BA 3OQIA 3SG0A 1VHOA 5F52A 2ZFUA 1JQJC 2GUWA 2CB0A 5A1TA 1NRIA 2VCYA 4HMOA 3LUKA 2VFAA 4FNAA 4JJ6A 1CP2A 4UVIA 4YRDA 4DCCA 2XRZA 2VYFA 1XYGA 1A69A 1FTWA 4HH0A 4XD7D 4YRCA 5ERXA 2GBCA 4WTOA 3GZJA 1TA9A 3EXEA 3L05A 1JFVA 1OF1A 3C1TA 4G1FA 1EVJA 3WZ2A 3NIFB 2CNLA 1VM6A 2P4UA 3R4CA 3DLIA 2ZJ8A 1NVGA 3OF3A 1QHHA 3IB3A 1RXVA 3RYTC 3VI4B 4EUSA 1VKNA 3AVQA 5LDDC 3KU4A 5EE9A 2XZOA 4LE2A 1Z45A 3GF4A 3LC0A 3UWDA 5TIIA 2WWVD 2QT1A 3UK1A 1KVTA 3HYLA 3TIGA 1BSVA 3SEJA 2XYVA 4XUCA 1FRNA 2WTNA 4X41A 1JFRA 1OCEA 1OZ0A 1GGEA 3DBOB 1OZAA 3X1ZA 4YS6A 3R0XA 2BE9A 1IQPA 5FJIA 1ULZA 2DCUA 1BYIA 4KEAA 1YFJA 4BO3A 3QV2A 3P5BA 2JBHA 1B8NA 1ZGAA 4V2UA 2CVHA 3L0SA 1LA2A 3I64A 4MGYR 5GP1A 3SXUB 3WKBA 1AQIA 2QLFA 3KOZA 4TPKA 2QW1A 3FOEC 3VKGA 1G21A 4WXHA 4CNBA 1Z82A 2Y1FA 3PUKA 4TXHA 2BBWA 1L5HB 1N6NA 2Z3ZA 5CAEB 1U3FA 4MX8A 2J46A 1EM6A 4W5HA 3LS2A 4XD7A 1YCGA 1NI4A 3PD7A 3PPVA 3L06A 3D6FA 3IPLA 4R3UC 5T41A 1YUBA 4AXXA 2AEJA 3HV0A 1W6UA 2GZDA 3N53A 4F1JA 3I34X 4ZZ1A 2N47A 4X20B 3ASUA 3IVGA 4WNAA 4CLHA 2IH4A 2D74A 2X6XA 1U0EA 3PFIA 5ALDA 3FDZA 3NBQA 1N5JA 3AWIA 1EEXB 4M9CA 3LVFO 3M4ZA 1EMDA 4FBGA 4HKTA 4MWTA 5D51S 3F5SA 3RLFA 1Z5OA 3UC5A 3Q1LA 1ODKA 1Z2PX 1NSFA 1EWVA 2H7VA 2H9YA 2VAXA 2VCEA 2VTEA 2RJ3A 3E4CA 4HAIA 2VPXA 4YYEA 2JIPA 4YDSA 1X19A 1RMYA 2BUCA 1KMNA 1P4AA 2E37A 3QELB 5HCIA 1R74A 2WIAA 3CX7A 3K0CA 1X15A 3DV2A 3PBKA 4LVCA 4G0ZA 2XT9A 4AS3A 1XZDA 4E21A 3OIYA 2O8BA 4AZ3A 4B6SA 1MD9A 3W3ZB 1H3FA 2G83A 1Y5RA 1YNSA 3LDUA 3VZBA 3QI2A 3ZNPA 4DR1B 3U39A 1ZEJA 2RAUA 3GGSA 4X07A 3KEWA 2E55A 4D5EA 4YV2A 3PDUA 1HK7A 2Z98A 5FYDA 3NMUF 4M0UA 3QIVA 3L93A 3N39C 5AO9A 3O92A 4XM2A 1GFWA 4QQKA 4I3HA 3W9UA 3BCFA 1UJBA 3C7KA 3GH3A 3OD5A 2F3UA 2AVDA 3LXUX 5FAXA 2C9DA 2AQIA 1SKUA 1WQ1R 3NRBA 1SBZA 5A06A 5KOJA 4JI4B 1PWHA 3EUWA 2R8PA 4FOOA 4CLDA 1I30A 3GC6A 1Y6RA 3GPLA 1N6OA 4URFA 5JDCA 2J6BA 5KINB 1PR3A 3PUJA 3IUQA 3A06A 1L4UA 1Q12A 4BKQA 2O1WA 4KIJA 3VHLB 3VR1A 1QM5A 2D3WA 4BLUA 2ZT5A 1Y7LA 2OQ2A 4Z49A 5CFQA 1I2BA 1EU1A 2YY6A 4GU5A 1BC5A 2X5XA 3IAHA 3KQPA 4G3XA 4XASA 1RQNA 1M76A 1WPCA 2EF1A 2WEKA 3PZRA 4FPXA 1E1CA 3PQ5A 4FZ5A 2PWYA 4ZALA 4N0DA 4YAWA 5FOUA 2NZWA 1VSQA 3L8MA 5LA6B 5LP6C 3VVCA 3CLSC 3GBPA 4UU1A 3H13A 1JVBA 2E1PA 2HF9A 4PC6A 4X9XA 3K7EA 1EFUA 1F2VA 1TE2A 4GWLA 2JVIA 2NPIA 3AVTA 2W2VA 4H7FA 3VH2A 4AZWA 4WOKA 3W34A 3UPUA 4HOYA 4CZ2A 2PX6A 3PR1A 2YZGA 2PRJA 2AG0A 4QYTA 1KZ7B 4OYHA 1YI1A 5IABA 4EQ6A 4P0PB 2X0EA 1V8FA 1XTVA 2QMEA 2AI2A 5C3UA 2BSQA 3AUSA 8ABPA 1M2WA 2XCOA 4C6TA 2IYOA 2RAVA 1YFZA 5JS6A 1WLYA 4H6VA 5KVCA 2RE8A 4IHJF 2P7HA 2P5SA 1MEJA 3BJMA 4YMIA 1CQZA 2HA5A 4GUAA 4IIGA 2Q1SA 2RK6A 2D2VA 4GFDA 4E7OA 3DO8A 5L3ZA 1QYWA 3IQIX 3OA0A 4U7DA 4DDVA 3OMXA 4J16C 4HJXA 3QVOA 1OLSA 4DIOA 2GWRA 4Z5XA 2GXSA 4DMRA 5LDGA 5AI6A 3WAJA 4X7DA 1AGPA 3W1VA 1X74A 3W7VA 4NE9A 2GD2A 5A71A 3ROZA 1DRVA