4TQ9A

Crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Biochemical and Structural Analysis of Common Cancer-Associated KRAS Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tq9A00
4FMDB 4L5BA 2ZE7A 4H9GA 4UNQA 1XB2A 4A2QA 1I4DD 4IOJA 2BEJA 1BMFA 3NBZC 4YQFA 1U0LA 3TRFA 3RSOA 2BHRA 4HZUA 3EA5A 5AUQA 2IT1A 4BLPA 4BQSA 1G8PA 1HT2E 2QPOA 3PQCA 2VL7A 2PMKA 3RHFA 3RC8A 1W4BA 1TQ4A 3CW2A 1UFQA 5CM8B 3BK7A 3KKOA 3CRQA 5EXTA 1KZ7B 4NCJA 1KO1A 1AM4D 4DRZA 5CJ2A 2GBLC 1XU4A 2HEIA 1JR3A 4QRHA 2NG1A 4IOMA 3SS8A 4GZLA 2OXRA 1P73A 2O0JA 4B2LA 3VFDA 3B1ZA 5BYJA 3WMGA 4DT1B 4DUGA 1GTVA 2FNAA 3E70C 3NHBA 5D3MB 2GJKA 3IBGA 3QPVA 1FUKA 4EPTA 5CM9C 3SI7A 2F9LA 5CYOA 4MRNA 1QBKC 4KBFA 3TNFA 5L3VA 4IDOA 4JLOA 3SHFA 4UKDA 3TIFA 4JL5A 4Z8YA 3P4XA 1KDOA 3R7WA 1XPOA 4C0AC 2G1KA 4LV5B 2FEMA 2QT1A 1J90A 1TNDA 5DYIA 2NMVA 1Q21A 1GZSA 3HYTA 2A5JA 2WAYA 1KMHB 3PVSA 1ZUIA 4ZDJA 4LX0A 4F93B 2V54A 5HZKA 1J99A 4FMBB 4W7SA 4ARZB 4LJYA 1Q12A 3IPYA 4M21A 1NSFA 3FGNA 2CCGA 1P2UA 3PXGA 1XCMA 5H1YA 1TTTA 1T0HB 5FOTA 1Q3HA 3B1YA 3KJIA 2GEVA 2HLDA 5CYPA 1EFTA 1OYWA 3K8YA 2F9MA 1HE1C 2Q3FA 5FTJA 4QKQA 2R9VA 4XIGS 5H70A 1HEIA 4OHZA 1OKKA 5L8VA 2FN4A 4A0RA 4A2WA 1LS1A 1QDEA 2IYUA 2QAGB 4POAA 3K09A 1N6RA 4QGHA 3W90A 4IFEA 1DE0A 1J8MF 3OF5A 4UNPA 3THWA 5G3ZA 1HYQA 1YU9A 1E6CA 3D31A 2ZYVX 5JRZA 2FH5B 4A36A 3JZAA 3QG5A 3ECCA 4IVQA 1RKBA 3NEJA 4RKFA 5EP1A 4PQFA 4RZ2A 3MD0A 2CLSA 3SYKA 5JLJA 1IN5A 4Q4HB 3FDIA 1CF4A 3VAAA 3I8XA 1RZ3A 3CNLA 1JR6A 4I81A 4S2EA 1MO3A 1XXHA 5EE5B 2RKOA 4PO8A 2AKYA 4Z51A 3WNCA 3CRVA 3SR0A 2P5SA 4HAUA 4LHVA 4NYJQ 4LUCA 2HJVA 3ZZUA 3FMOB 2CVHA 2QMEA 1E79D 1E2FA 1SVLA 3EIEA 3EZ6A 3FE2A 3TUZC 2O8DB 4KAXA 4LOAA 5FPTA 2NZ8A 3KQLA 3VR3A 1CBUA 3QVUA 1R0YA 2FSGA 2BM1A 4YXWA 4M9XA 4DLSA 4IEIA 4PC6A 3T35A 1JB1A 3CR8A 2D4HA 4WVFA 3GJXC 1U8AA 3BH7A 4IDQA 3WYGA 2WMNB 2ZRDA 3QUSA 2B92A 5JZVA 4BLOA 1NMYA 3H0KA 1U8ZA 3BFXA 3FOZA 1HH4A 3HPRA 3K09C 2F43A 1Y3AA 4JT2A 4D4LA 1NVVQ 1GRRA 2DB3A 2CK3A 4X8LA 1DAMA 2W0MA 4MDEA 1JPNA 3B85A 4TT3A 1U0HC 5LPNA 2PL3A 2P6RA 1UDXA 3T1VA 3MUFA 4FWIB 2GESA 3T06B 2KBFA 4V02A 1M8PA 1LFDB 3LX5A 4B47A 4ABYA 4B2IA 1RC8A 1VCOA 3PUWA 2JATA 4HSEA 1UKZA 5A5GA 3I73A 2FFAA 2J0UA 2GDJA 3B5JA 4P4TA 5B2ZA 3EXAA 5KNBA 3U4QA 1F2TA 4TL8A 4LRWA 2VP6A 1KI2A 3LX8A 4F38A 3I1FA 3KTAA 3SFZA 2ZI7A 4M1KA 4GRAA 4NMMA 4DLUA 1FP7A 4TYPA 2JLSA 2ZEJA 1V5WA 5DI9A 2X77A 3Q5DA 1GP2A 4V0OA 5JJLA 3N5CA 4RCYA 2R44A 2WWYA 2XNDD 1ZNZA 1F2TB 5JEDA 3ZD7A 1RFLA 2WJGA 3FHCB 3BFVA 2VHUA 2BMDA 3N70A 3QEJA 3T15A 3IKJA 1BKDR 1Z5ZA 4TSFD 4Q21A 3B8HA 5EZ5A 3T1QA 1N2CE 5EXXA 3EIQA 4PSVA 3Q8XB 2YWHA 2ZXUA 1R0XA 2C9OA 2F1IA 1W49A 2NO9A 4V0NA 2BWJA 2WV9A 2GXSA 4GMXA 2ANCA 3ZQJA 1DAKA 1PLJA 3VR1A 4JLAA 4A0GA 3GLFB 2OAP1 1Z0DA 1K5DA 2C8VA 3QKTA 4TMZA 4QGAA 4LBVA 5AUPB 2RGAA 2Q3HA 4TQAA 1VPLA 1QRAA 4MDFA 1G5PA 2BBTA 3GLHA 4TMKA 5J4VA 5UKDA 5A4JA 2XTZA 1VYVA 4Q5IA 5H8WA 1FX0B 3IHLA 4CT5A 4ZV4A 3IHWA 3TW8B 4US0R 2FMXA 4QBFA 2AXNA 3NC0C 1GNQA 4DCVA 1F5NA 1XJCA 4LPKA 2W6ID 5CB6A 3LBHA 3E1SA 2QL6A 1FNMA 3QG1A 4XVQA 2WOOA 3T61A 2NO7A 3IDQA 4IDPA 4EFMA 1G8GA 821PA 1FMJA 3VHLB 5AUNB 1EFCA 2C78A 1RJ9A 3HWSA 4PZLA 2AD5A 2Y8EA 5FTKA 1U90A 3REGA 3ZS8A 4TWZA 1AQUA 1CRPA 2WSMA 2EYUA 2QSZA 2RCNA 3ETLA 2FG5A 1VKJA 3OFND 2N42A 4YDSA 5HKKD 5AWFC 5IHPA 2EU8A 3CH4B 2W00A 2ZJZA 2L0XA 4LYJA 1DAHA 3FWYA 3BFKA 3RS2A 2HLDD 5J5CA 4TT3D 3QBTA 2WWGA 2AN9A 2LCFA 3QENA 4OI2A 1E9FA 1Z28A 1GNRA 4OQFA 1IXRC 4ZI3A 4G5QA 1RRCA 5L3SA 3CX6A 1XEWX 4FN5A 3GLHB 4GFDA 4HI0E 5DHAA 1VCMA 3AV0B 2JLUA 4FD2A 5EXPA 2P6NA 2PT5A 5FL7A 1MRNA 4ZIRB 2ZI9A 4PHTA 1WMSA 4M4SA 2QBYA 1OFHA 1Z3IX 2CJWA 3FPAA 2Q0HA 2IF2A 3NH6A 4BFWA 1ZM4A 1NP6A 5FOSA 4CEJB 3D3QA 3UATA 1XFAA 3EPKA 4AURA 3K0SA 1DAGA 4FINA 2O8EB 3A8TA 1Q1EA 2ZR7A 1SVKA 2GCOA 1JALA 4RZ3A 3M0EA 5TV2A 5FTLA 3R8FA 3TUIC 4C0QC 2Z0MA 2C2HA 1G7CA 2EW1A 4CF7A 1OXSC 5EE0A 1JI0A 2YHSA 4C0KA 1N6OA 1RE0A 3KXLA 1SKQA 4DB4A 3SDZA 3DZ8A 2O0HA 4L16A 4TQUS 5FI1B 3EX7C 5SZKB 3X1YA 3GJ0A 5KDOA 1AA9A 1DAFA 3EPJA 2VA8A 4MH0R 3EZ2A 4EPVA 3SQWA 2IYQA 2ZRAA 2IC5A 3LA6A 3KQUA 3AGQA 1NKTA 3REFA 1WBBA 1R7RA 4E07A 1OXTA 2VBCA 4TLCA 1EESA 4A1FA 2ATXA 1VHTA 2D3WA 3T1OA 1IJFA 1F6BA 1DO0A 1ZNYA 3WHLA 2XXAB 1T3HA 1R2QA 4LI0A 1WF3A 1TL7C 3VKGA 2G6BA 1Q22A 2V7QA 1F2UA 2FPMA 2J0VA 5HCNA 3RANA 2YYZA 2RHMA 2YOGA 3E2IA 1VG0B 3BOSA 5CJPA 5KO2A 4DLZA 3VHXA 2JLXA 4DSUA 1GG2A 1NBMD 2ZTSA 1N0UA 1SHZA 3BB4A 1G17A 1MABA 1W0KD 2OLKA 5JEEA 3DOEA 4LCBA 1PLKA 1CR2A 1GOTA 2ZSEA 4Q9LA 4F4IA 2ZRBA 1UAAA 1G7SA 1QHHA 4JLBA 5FPYA 3A1WA 3IEVA 1XTRA 4A82A 3OESA 1US8B 3A4LA 4ZCLA 1AZSC 3AF1A 3AF0A 2HT6A 2H5EA 4ERNA 3THXB 4W9MC 3I5XA 4LV6A 4G0NA 1G8YA 1IM2A 1NVXQ 2JIZA 3O8BA 4NKRA 5JJKA 4DBLC 1KJZA 1J7KA 3B1WA 4XJXA 2A5YB 5JSZB 1MKYA 1SXJD 1ZBDA 4GNKA 3RLFA 5KSOA 1Y63A 4B73A 1OXVA 5AJZA 2AFHE 3A6PC 2QTVB 3U5ZB 4WZBE 2QA5A 1T3LA 1ZIOA 1IBRA 2KBEA 1Z6AA 4FI3C 1YZKA 3HPQA 3RDPA 4TLAA 4TZ0A 3AKEA 1X86B 1JR3D 3DHWC 2CL7X 3E5HA 4PHFA 1P6XA 4DWJA 1Z8FA 5B58C 4Q66C 1E2EA 4B35A 2R6GA 4LHZA 4ZKDA 3QPWA 1FUUA 3IIMA 4YMUA 2HCBA 4YLGA 1IJEA 4HUQA 4E22A 2JJ1D 1XZPA 1GFIA 5KHOC 4O0MA 2VHTA 3CRRA 1DBSA 1MOZA 3I8SA 3K0AA 1OW3B 4Q47A 3QKSB 1FOEB 5JHHB 3TJZA 1NN0A 3ASYA 4CEJA 2ZANA 3L8ZA 1XCPA 2NPFA 3LNCA 1MV5A 1VIYA 5B30A 1SKYE 2CCJA 2CL6X 3IQWA 4ON9A 1GIAA 2F3TA 2FSFA 2HF8A 1OHHD 2EVWX 2CK3D 5FUXA 3ICQB 2ZRLA 3ADBA 2AK2A 2G3YA 2P2LA 5LBIA 4BZPA 4Q1AA 4KBGA 1X8KA 4AKHA 3EW9A 4WIAA 1W2HA 4NL4H 4Q9HA 4EPRA 4X8HA 4ARZA 3UANA 5JI2E 2C96A 4FWTA 1L8QA 2ONJA 2ZSFA 3PUXA 2AFIE 2DWPA 3Q9LA 1E4VA 3VR4A 4Q7LA 2Q21A 1OFUX 2A30A 3LW7A 3GFTA 4DEXA 3JZMA 1G3RA 1ZP6A 4MGZR 5CITA 5DI3A 1Q1ZA 2E87A 4KODA 1TU3A 4CYMA 3IGFA 3RRMA 3PR1A 3FFAA 4XWAA 2GZHA 4NCKA 2I1VB 1YQTA 1KI1A 2FV8A 2F3RA 3IIKA 1KO4A 5IDVA 1T91A 1Z08A 3AF4A 5H68A 3NBYC 5KUTA 2V6JA 3VMFA 3CF0A 3QXCA 4LC1A 4MKFA 1NN5A 1TQDA 5EE1A 4YC7A 4BWYA 4Q9IA 4CRWB 4D4MA 5BWMA 3TW4A 2ORIA 2ASEA 3F0TA 1X8LA 3K9NA 2ZSBA 1E2JA 3ZVMA 1ZAKA 2Q3MA 3TR0A 4DC9A 2ZRHA 3F8TA 3BB3A 4JLMA 2OLJA 2OFOA 4KITB 1CS4C 2QN6A 3DL0A 1JXOA 3KKMA 3WHKA 5IF9A 2XOKA 5DSZA 5JHGB 3LV8A 2EYQA 2ZI6A 4B6EA 1WBDA 3AM1A 1UBCA 3O8RA 3NIBA 3AH8A 1GNPA 4HZUB 1QG4A 1KDPA 3FMFA 4AKIA 2G0TA 3SBEA 5CIQA 1W5SA 3TSOA 5DHFA 1Z07A 3TSWA 1KK3A 1D8TA 3T5DA 4L9WA 4LJ4A 1DS6A 2H18A 2A5DA 1GKYA 4D4JA 1NL3A 3KB1A 5IK2A 1LY1A 1PUIA 2BEKA 2PBRA 3P27A 4JBXA 3SJCA 4AYXA 1EFRA 4BFYA 4LWZA 2H8KA 4A8JB 3CX7A 4G01B 3EPHA 3GEHA 3BH0A 1E9BA 2IXGA 2VHCA 1LF0A 2MMCA 4MYCA 2V3CC 1GRNA 1T8UA 1TF5A 1ZCBA 4A2PA 2DCUA 1G5TA 1FQKA 3B78A 1OJLA 4AKEA 5B64A 2N46A 1DAEA 2JLQA 3GEEA 1XTSA 2J7KA 3GLHE 2ZE5A 4L4UA 3LXXA 1H8HA 3OEEA 1OYYA 4Q1DA 1E0AA 2GK6A 3ZD6A 1YR6A 4ZO4A 3GPLA 1OF1A 4XSHA 3BERA 4B71A 4QHYA 2ODNA 1BH2A 1XEXA 3SEAA 1OH7A 2GRJA 5KDDA 1OB5A 4DDWA 1S3SA 5FOUA 1NVUQ 1QZXA 4LJ7A 2CXXA 1K6MA 4UNRA 2JASA 3L0PA 4JL8A 1XEFA 3HP1A 2IXEA 1OB2A 3G82C 2RAPA 1SQ5A 4TMWA 4UQOA 1NMXA 1W46A 2AK3A 4KI0A 4RD0A 1K5GA 5C2JB 1KO8A 2CHQA 5JCZA 4NYMQ 5C46F 1NBME 2V8OA 1YE8A 1W0JD 3SFVA 2J46A 4WXRA 4D26A 3FFBA 2NZJA 2GXAA 2KB0A 3H4MA 3VU9B 3KQHA 2GXQA 2R65A 3CUEF 1UM8A 4GDFA 3AUXA 1A5TA 3N2EA 1D9XA 3VKWA 3AF3A 2BBSA 4Q00A 2AR7A 3A1UA 4RZXA 4GOXA 1SKYB 3U7EB 2OBNA 221PA 1E2IA 4K8OA 1ZMXA 1E9SA 5FR1A 5TDHA 2EFEB 3AP2A 2BMFA 1E98A 1Z83A 4KFSA 2ZU6A 4Q9JA 1E79A 4JVNA 4JVLA 2OFWA 2PEZA 4LYHA 4HAVA 1NBMA 2J7PD 3SN6A 1KK2A 2O8FA 1Z0AA 3IBYA 2C98A 3MLEA 3RVBA 3GLGB 3P20A 1NG1A 4C30A 1E2LA 3UMRA 4LJAA 2E9SA 2WIBA 2WKPA 4LZZA 4LJ9A 3GLIE 4HAZA 2ZS9A 3B13B 3DMDA 2VHQA 4JS0A 5E4FA 3SZRA 1RW4A 1A1VA 4Z1MA 4R7ZA 3QI2A 1G21E 1G6OA 1VDZA 4WZAE 1NN1A 2HDNB 4MKHA 4P33A 1IOZA 1G9XA 1CEEA 4MQBA 1EG7A 1YHNA 4IVRA 3R9XA 1NY6A 5KSZA 1GL6A 1GRQA 3K53A 3PFIA 2REOA 1AS3A 3HJNA 4LHYA 3FKSA 4HLQB 2B8TA 3AVTA 4NCHA 2GWHA 2IYXA 4BLQA 4F7WA 4Q4JA 1UPTA 3U44B 1G18A 5BN3A 4EJSB 2KJQA 4YONB 3TVTA 2I1QA 1L4UA 4OQXA 3UIEA 3BE4A 3VQTA 1JJ7A 4E03A 1IN6A 2V55B 4Q7MB 1P9WA 1ZM3A 2JGNA 3CRMA 4CEIB 1G7TA 1SHKA 2IS4A 3HU1A 3QF4A 2J5XA 3GFOA 3MWKA 1BMFD 5FPHA 2FZ4A 3NKVA 1HY3A 3GJ7A 3NC1C 1KNQA 2QT0A 1W7AA 1W44A 4OK3A 3CPEA 1P3JA 2OE2A 2C04A 3BGWA 5LB4A 4AD8A 1SXJA 1AN0A 3RNLA 2IWHA 3CWZA 1DEKA 1IHUA 2VF8A 3AVXA 4NCNA 3TR5A 1RYFA 2QMOA 3B6EA 4AIIA 2BKEA 5JSZA 1CTQA 1XTIA 4PC3A 3RC3A 1XJ0A 1BIFA 3HDTA 2G9NA 4ACBA 4QBIA 1LW7A 2JJ1A 3PIRA 5DO9A 4Z8XA 3H2YA 3W3ZB 4MITA 3TVDA 4NZYA 4M9ZA 4L15A 1IY0A 4TL6A 2J0QA 1VECA 5L3QB 2ZAOA 4NH0A 5DGXA 4WW0A 4E5UA 3A36A 3LVRE 2EWWA 1S1MA 1XEWY 3PITA 2R6CA 5EE3A 2I3BA 3MFYA 2QPTA 4DLRA 4PC2A 4R9UC 2B21A 2YV5A 1GL9B 1T9HA 4FMCB 3PUZA 4QJ4A 2V7QD 2JJ8A 1XF9A 5M04A 3AKCA 2ZRJA 2VQSA 2YINC 3THXA 3I4LA 2OCBA 5FOXA 4Q4AA 2ZS8A 4RD2A 3RYTC 5A0FA 2A7QA 4QFMA 4KO8A 1W0KA 2ANBA 1CJKC 2O8CB 2JA1A 1ZD1A 1DARA 3K9HA 2IBMA 4TTRA 2WTUA 1KMHA 3NWJA 4AC9A 1U9IC 2HYDA 2YOFA 3C14C 2ZUDA 2TMKA 1Z0KA 4RFSA 4Q4HA 2DFKB 4V0LA 2HXYA 4KSCA 1L7VC 1R6BX 1WE2A 2ZR9A 4Q4JB 4DCNA 2HUPA 3ZVLA 4QM7A 2UZIR 3NH9A 4FXPA 1W4RA 1E4YA 1ZM2A 1P2VA 3A1TA 3M6AA 1A82A 3VR6A 1ZRHA 1P75A 2XZPA 5J4HA 5FBVB 5E7JA 2QGZA 2ZYUX 4DLWA 4B43A 3VKHA 1EK0A 2WBLC 3IILA 3EIHA 421PA 4TYWA 1ZJ6A 3A4NA 4CGZA 1UKVY 1N0VC 5TARA 4Q1FA 2VO1A 5GVSA 1DO2A 1I2DA 4G5SA 1PV4A 1ZINA 3Q7PA 3W8RA 3I62A 2JDID 2ZJAA 5B57C 4KXFB 1G20E 5FBWB 3MWYW 1XXHE 1XRJA 5IT5A 1R10A 5D3QA 2ORWA 3H84A 5FUYA 4OQNA 2OBMA 3DO6A 5FL7D 1GAJA 721PA 4ESVA 1D6JA 4XTRA 4IVPA 4JLPA 1ONBA 1IONA 1DELA 3P4YA 2A78A 5G3YA 1DG3A 5E7MA 3TAHA 3ZIAD 5C4MA 4DT1A 4XWKA 1QHYA 4PTLA 4ZIRA 4D25A 2GILA 3SQXA 3KXKA 3DOFA 3NVAA 1KDTA 4PAOA 1Q1QA 1ANKA 2OAQ1 1HQCA 2H17A 1MO5A 2QSYA 1QHNA 2D74A 2P6UA 1KKLA 3RRZA 2O8EA 2PJZA 2ZRPA 3U7GA 1XBTA 2JJ2A 4MGIR 3ZLJA 4EDHA 1VMAA 4P4SA 4LDJA 2ZJOA 5KSPA 3AVOA 4UXJA 1E0KA 1AGPA 4CIDA 1AZTA 2DWQA 3TAUA 4KJZA 2H1LA 1XZQA 3ZJYA 5HE8A 4B3DA 2IK8A 4JKYA 3SU8A 3IEUA 3MGCA 3K0CC 2YOHA 1S3GA 1ELOA 1QHSA 2VF7A 1SVMA 2PZGA 3V4FA 1COWD 2QENA 1FFHA 3THYB 4BEBA 4DSNA 1HA3A 3SHWA 5CIWA 3IIJA 2HCJB 5CK5A 1ZD8A 1B23P 2FEOA 2PZEA 1E0SA 2XXAA 2V1XA 4RD3A 1Q57A 2YWGA 3C4JA 3T34A 4US1R 1KI9A 1KDRA 1W36D 4LYFA 2OILA 4JJZA 4Q7KA 2ZS7A 3L82B 4URVR 2NIPA 4ZDKA 4DEYA 1LS6A 2PX3A 2XNDA 2ZRNA 4G3XA 4N1AA 1UBGA 1ZUNB 2IYTA 1ZIPA 4C0BA 5C1BA 4ILEA 1OE0A 2OFXA 1UJ2A 4MYHA 4O25A 4GMDA 1CLUA 3CZQA 3KB2A 4P31A 5LD2B 2OCPA 1IN8A 4UXHA 2BJWA 5G40A 1CR1A 1P7CA 3B1XA 1AKEA 3LAWA 2ORVA 3T12A 2J9RA 3H1TA 2D06A 1KHTA 2FGKA 3PEUA 4HYYA 2ERXA 4GOKA 1V43A 3GJ3A 3ICEA 1SVSA 4WXPA 5GJWC 2YKGA 3DPUA 4PC7A 1Q3TA 4XVUA 5G41A 1QHGA 5HZHA 3TE6A 5EP4A 5HTKA 5HR5A 2QTHA 2GCPA 2MSDB 4P0TA 1YZNA 4AG5A 2P65A 4A8JA 2FX3A 2ZRFA 3RSLA 5EP2A 2Z4RA 2O8DA 2YNMA 4JVMA 2J7PA 4QNMA 1WP9A 4ZKEA 2FGJA 3PUYA 4C9BA 4Q19A 1Z63A 2J3EA 4OJKA 3OEHA 4URXR 1RPZA 2IYRA 4AI6A 4BFVA 1Z0IA 4M1OA 1G291 3VR2A 2SHKA 3OEHD 4IRUB 1N6PA 1QVAA 3QXHA 3DKVA 3SYNA 4BFSA 4PZZA 2PJRA 4QBGB 3SJZA 1E1RD 3U2QA 4CZ2A 2IUSA 1OV4A 2IHYA 1N6NA 3RRYA 4D6PA 5IK2D 1NVWQ 3W34A 3LQQA 1NJGA 3PG5A 3CLVA 4B3GA 4D80A 1U0JA 1SULA 3WP1B 1W36B 3R8CA 1IN7A 3P32A 3P1JA 2BCJQ 1NNEA 3THWB 2W6IA 4QOSA 1BOFA 4D82A 2ZETA 2QMHA 1ZUHA 2NTYC 3KX2A 2C95A 4QGGA 2QY9A 2GEDA 3QNUA 4HDOB 1UF9A 1XMSA 3W6PA 1JPJA 3CIOA 1E9DA 1XTJA 1XX6A 1IXZA 1TEVA 4Y0VA 3KKNA 4A4DA 2QMUA 1ETUA 2WOJA 3RS5A 1ZYUA 1IAQA 2WJIA 3FKQA 3GLGA 4D0GA 4RD6A 4EPWA 4KVAA 3J81k 5FH9A 3QXJA 1VTKA 1G4UR 2WHXA 3Q72A 4IOLA 4CEIA 2GZAA 1II9A 2AX4A 1M7BA 4NPHA 3QSYA 2GCOB 4OL0A 3B7GA 1E2QA 4LY6A 4BFXA 1E1QA 2QEQA 4US2R 1CRQA 2IWRA 4GI7A 2DR3A 4F4JA 3KFXA 4NCIA 1KOFA 4PR0A 4W5JA 3F3YA 3LH5A 1P9NA 2OESA 4QHTA 4TSFA 1JXMA 1KI6A 4OQMA 3SYLA 3VNUA 2O8BA 2V1UA 4DCSA 4JT4A 2BMJA 1Q20A 3AVYA 4CVNA 1M6NA 1U9IA 1Z6XA 4XD7A 1C9KA 4JJKA 1KK0A 3WP0A 4A15A 2R2AA 5FL3A 3GLIA 1CJMA 1JQJC 4X8MA 5DH9A 3QKRA 4DSTA 4N0EA 4TMXA 3FMIA 4NU0A 2R62A 2DBYA 2XAUA 3RRNA 3OIUA 2E1RA 2PCLA 4C7OA 3K0FA 4WA7A 3SJBA 3MJHA 2WSSA 2JLVA 2ZE8A 3QKUA 1G64A 3LFUA 3MMPA 3K0AB 1NLFA 4BFUA 2G1JA 1IN4A 4Q1BA 1VCNA 3A4MA 1CJVC 1E9AA 3ONWA 1KIMA 4UJ5A 1T6NA 2VP5A 3TKLA 4JLJA 4RD1A 2JAQA 3PV0A 1G3MA 2WJHA 5ELXA 4HB2A 4KFRA 3THOA 2GBLA 1KKMA 3CO5A 1P9RA 2XITA 1TQ2A 1OLOA 2JLWA 5EUQB 2C9YA 4P4SB 1E2MA 3EA0A 2AHOA 2BBOA 4PPFA 2DPXA 3CNNA 1G3QA 2F6RA 3FB4A 4J0QA 3UWOA 1KAOA 5DN6D 1W2GA 1XD9A 2QAGA 1MH1A 4FCVA 3KKPA 4TMTA 3K0EA 3K1JA 1S9HA 3P26A 4MYTA 3TH5A 5J40A 3KDSE 4D81A 2CLCX 3CX8A 5EUMA 4DDTA 4GBMA 3QPUA 3WNDA 3AKYA 4S35A 4PX9A 4B3XA 5L3RA 2UZ3A 4Q02A 4DLTA 2QAJA 2XZOA 2YZ2A 1FTSA 4PZYA 1H8HD 3OEED 1N5LA 2A3RA 1EWQA 4HAXA 1O87A 1W5TA 2XJ4A 3WMFA 3VR5A 2ONKA 3A37A 1NF3A 3CM0A 2QP3A 1XMIA 3QIAA 2GJSA 2JIZD 4YDHB 3GJ8A 4F92B 4A6XA 2CBZA 4KU4A 2X19A 4K81B 4X8OA 1XP8A 3LVQE 3EC1A 4IHQA 5L3QA 2BJVA 3M4YA 3FHOA 1UBEA 5FBQB 2EFCB 2ZREA 3O8DA 4QL3A 4DB2A 2OUKA 3B60A 5KTYA 3EPLA 4JIMA 5EZ6B 2OHFA 1B0UA 3AP1A 1N5KA 2OCYC 2XGJA 1NJFA 2BOVA 2AKAB 3LY5A 4HB0A 4WZ6A 2WVJA 3IQXA 1KSFX 5GADl 2ZSAA 5DE3A 2FJUA 4AWXA 2VTKA 3B9PA 5DI3B 5E95A 2DY1A 1FNNA 4TL9A 4MGKR 2V9PA 3CF6R 4BECA 1RJ9B 1BS1A 4CEHB 4Q48A 4BGDA 2BBWA 4I99A 1D9ZA 2IUUA 1RYHA 2QPAA 4HB3A 3TK1A 2ZRGA 3V00A 2Q9AA 3HYRA 1JAIA 2GHIA 2QROA 3BRWD 1P61B 1XNJA 3IO3A 3L2OB 4B74A 3ND9A 1NY5A 3ND8A 4LGMA 1U8YA 1Q44A 2IS1A 4GP6A 3HR8A 2VP4A 3A58B 4M0LA 3RS3A 2ZAMA 4RFSB 4ZPXA 5HPYB 3Q85A 2XZLA 3SC3A 4ZCIA 1NG9A 3AEZA 5J4LA 1ZC4A 1MABB 4PSKA 4ASUA 5C18A 2J87A 1ZC3A 3DVLA 3NHAA 3RWOA 5JBQA 1KI4A 4EAQA 4HAWA 1NIJA 3EASA 4LSGA 2FPLA 1S9DA 2RGNC 2X1VA 2HT1A 3AGPA 1KI8A 1LF5A 2NPIA 2ZPTX 3RABA 4HDQB 4M22A 4CDGA 1Z29A 3MWJA 3FYHA 3JVUA 2GCNA 1M34E 2GZDA 3U61B 2WIAA 2WICA 2ZROA 2ODBA 1R8QA 3EZFA 3CRW1 3R20A 1PJRA 5HKKA 4B76A 2HV8A 5FOWA 2EWVA 2QORA 3GQBA 5GVRA 3LLUA 1ZU4A 5DIFA 1GITA 1NMZA 3W8NA 3ZH9B 1SVIA 1Z2AA 2BC9A 1HURA 4Q18A 4UNNA 3SJAA 1JEDA 3CF2A 1Z6GA 1YZLA 1Z2CA 3WBJA 3DEFA 2FOLA 3ZZTA 1QG2A 4ZDWA 4B75A 1JEEA 4JBYA 2P5TB 4V0KA 1TEXA 3I3SR 1OKKD 4IW3B 2FPKA 4DCUA 3TGPA 3I72A 1YR8A 3TLXA 1E69A 2B6HA 3WBKA 3ADCA 5CDFA 2D2FA 1I2MA 3QKSA 1MT0A 3UPUA 1L2TA 4TTQA 1E9EA 4IJMA 4IOKA 2GETA 2GAOA 4GT1A 1R5NA 3DDCA 5FTMA 3CZPA 4B34A 4QGFA 4FCWA 1KSJA 4JZKA 2X2FA 4NE2A 1X1RA 1VG9B 3QF7A 2IW3A 4RKEA 4YMWA 3I92A 5F3WB 4RY2A 1AGRA 3KJHA 4Q4AB 1N25A 4HEJA 2F1JA 1ODFA 1UADA 1W36C 4HLUC 1U99A 2ZITA 3W6OA 1QHHB 1KMQA 2VLIA 5EJEA 3RWMB 2JLZA 1E9RA 3M1IA 1DG1G 2RH5A 2O0KA 2AWOA 2WWHA 1CJTC 1RVDA 3K9GA 3QY0A 4QHSA 5E3HA 1WRBA 4JYBA 3ZVNA 2B7BA 2CDNA 1U94A 2C03A 2DFLA 3B9QA 1W1WA 1XPRA 1CXZA 2ZVQX 1JBKA 2EFDB 4JL6A 3K70B 1ZVQA 1AS0A 5AUOB 4QC2A 4JLKA 3UWKA 2XSZD 1HUQA 1FW6A 1H8ED 4C2UA 4FMCF 2BMEA 3LXRA 5CDFE 1AKYA 2VP2A 1JQLB 2IX3A 3AUYA 2Z83A 1Z6YA 4HAYA 4DJTA 1P2TA 3ZS9A 1E99A 4JSYA 1P62B 4N3NA 3FKSD 4IDHA 3TSZA 1M2OB 3GJ6A 3OE7D 4B32A 4E09A 1CR4A 2Q9CA 2IUTA 3V9PA 1F48A 4BLSA 3ZZ0A 2WM9B 3MWLA 4TN1A 4OHYA 1BYIA 3CNOA 4V03A 4AYTA 1YR9A 3NTUA 1D5CA 4LHWA 2R6FA 4Q9KA 5P21A 4HUTA 2VSXA 1FL9A 3CWQA 4L8GA 4YMTA 2ATVA 2IHBA 3X2SA 1KI7A 3CKLA 3U44A 4RCZA 3S1AA 4RZUA 1IY2A 1R8SA 3AF2A 1HTWA 2WMOB 2WWXA 1LB1B 4LJ6A 1T8TA 2XTNA 2KWIA 1GWNA 4Q1CA 5JWHA 1HT1E 3U6KA 1AJEA 3MAAC 1G4AE 4LV8B 2OBLA 4AKGA 4D4KA 3TBKA 1W0JA 1KY3A 3C15C 4HUQB 4UJ3A 3EC2A 4LBZA 5AR1A 3ZYCA 3C5HA 2ZYWX 3OAAA 1KO7A 1OIWA 4L9SA 2F55A 2DFNA 1SVOA 1G3IA 1TX4B 3CBQA 3L0OA 2OXCA 3DMNA 1N6KA 1PVOA 3GD7A 1EFHA 4A8JC 4OQLA 3QXSA 4RJLA 1EX6A 2QE7D 1VG8A 2W58A 2O8FB 4HATA 5HCIA 1TU4A 2QRNA 4ACAA 3DM5A 3GJ4A 2QE7A 1OIVA 5FTNA 3DM9B 3ZGXA 1DPFA 2WKQA 1FZQA 1XTQA 1G6HA 1DTSA 2XSZA 2FZLA 2VEDA 3AKDA 4FMDF 4N0DA 4OI0A 1OSNA 3AVUA 1OXUA 3SBDA 1XDBA 1ZM9A 3CPJB 1UKYA 1KSHA 4IXNA 2FE4A 3OAAD 1E9CA 1T5LA 2ZRKA 4LPSA 2WJJA 3S1AB 2VPPA 1UDWA 1P60A 3EZ9A 2RGXA 2RGGA 4B2PA 1AS2A 1EFUA 1KNXA 3C41J 4RD4A 4AYWA 3U3KA 3X1ZA 3B2EA 3NG1A 5KNCA 2WZQA 2ZJ2A 4U7DA 1FX0A 4PXAA 5LDDC 2RGEA 5F9HA 2MSCB 3QOFA 2NO0A 2ODWA 3GCGA 1KTVA 2G83A 4BASA 4K46A 5L3SB 1GILA 4I1OA 2AL7A 2F7SA 3I61A 1II8B 1I4TD 4YMSA 2KE5A 3QEOA 4QM6A 2BKUA 1DADA 2QAGC 2ZJBA 4JLDA 3WNBA 1JR3E 1X8JA 4TLBA 4OKSA 4R2IA 2OG2A 1US8A 4EIWA 4M2LA 3GJ5A 4C3ZA 4RFVA 2EQBA 1KJWA 4PO1A 2IS6A 4PPQA 1CU1A 1P4SA 1WCV1 2PMDA 3IO5A 4DIEA 2XOKD 5CLQA 2CCKA 2I4IA 1OPXA 2MSEB 1MO6A 2PT7A 4CT4B 1S4QA 521PA 3PEYA 2JJ2D 1SZPA 1SVWA 1CIPA 2MMGA 4JMPA 4LBWA 4QNRA 4RVCA 4TLDA 1SXJB 5EP3A 1T4GA 1W4CA 1G8FA 1KYIA 1P5ZB 3QJYA 3CONA 4BLTA 4DUGD 3I5YA 4OBEA 4C7OB 1Z0FA 1N3BA 1X3SA 2LKDA 2IL1A 2DHRA 3N2IA 4MKGA 5DISB 3VX3A 1M7HA 2ZJYA 2GNOA 2QGNA 4NTZA 2WJYA 1G16A 5GJVC 3VU9A 4KSBA 3UK6A 4DCTA 2PLFA 1VHLA 2KI5A 4I1VA 5FUWA 2QUZA 2P0EA 1G19A 4M1SA 2J45A 3R7WB 4OHXA 2AXPA 3EAQA 3EWAA 3NXSA 1NLZA 4W5WA 2BM0A 2GVZC 3UXMA 4XVRA 5BN5A 1H8EA 4IEEA 4EQ6B 1NVVR 3L43A 1KZGB 1N5JA 3OZXA 2ZJ8A 3JVVA 2ZUCA 4XH9B 2WWIA 4U02A 1F3OA 4LJ5A 4TMVA 1UEJA 4V0MA 4OHWA 1A2BA 1X6VA 2REBA 3OIYA 2IYSA 1D2MA 4TLEA 4F4CA 1ZD9A 2VH5R 2HJGA 2CL0X 4PQRA 2BV3A 4DLXA 3IPXA 2IXFA 2VP9A 2GXUA 2CJWB 5FR2A 3R9WA 2QQEA 4DLYA 5DNYB 4D0NA 4LC0A 4DLVA 1OHHA 5JMTA 1Z0JA 2P3SA 2D7DA 4CEHA 3HR7A 1LNZA 1M7GA 1YJ5A 3A1SA 1II8A 4DSOA 2IEYA 2ZSDA 2ZQ5A 1XWIA 4DIDA 3W5IA 3WYFA 2G77B 4A9AA 1R5BA 2GVDC 1E96A 3KJEA 2J59A 5BXQC 2YVUA 2XB4A 1WQ1R 3BH6A 3ADDA 1CP2A 4A0HA 2JDIA 3K0FB 2R6DA 1YZGA 2YWFA 1G1MA 3QE0A 1W48A 2D7CA 4TZ6A 2PEYA 4PANA 4MRRA 1HV8A 1OH6A 1VIAA 4R2HA 2OZEA 2R6AA 4KCGA 1E2NA 1KI3A 1W4AA 4WOPA 4NP6A 4JLNA 1R0WA 5JWRA 2JLRA 4AG6A 3GLGE 5G53C 3CR7A 3L8YA 3U7HB 5JJIA 1EWRA 1KI6B 1QF9A 4YXWD 4DDVA 5J4KA 4G5OA 4IXMA 4BRWA 1S8FA 1KSGA 1E0JA 2YWEA 2X2EA 4LBYA 2J0SA 5JS7A 2CNWD 1W47A 2O52A 1N6IA 2A2ZA 1XD8A 2W6JD 4M9SA 5CB8A 3ZIAA 1GKUB 4PPNA 1FTNA 1EGAA 1QHIA 2A5GA 3LDAA 4PO9A 1CKEA 1M1YE 2EFHB 4FW9A 2ERYA 3C16C 5K8IA 1XD2A 1XMJA 2RHDA 2B7CA 4PQYA 4ESHA 1JAHA 3UMFA 2Q6TA 5F9FA 3GFPA 5J47A 1OXXK 1OFIA 1WDTA 1E94E 4QXAA 2RB4A 1UEIA 1TQ6A 2ZVPX 3QXXA 2ZE6A 3CPHA 2WWWA 2QRZA 3H86A 2OCAA 4TTPA 2C77A 3BWDD 4Z1MD 2DWOA 2XJ9A 3GLIB 4EPXA 2WJVA 2W83A 1WA5A 1Z47A 3D8BA 4XSGA 4LHXA 2CEAA 4HLUA 3TUJC 2FA9A 1VYUA 1X1SA 4OK6A 2ZI5A 2XEXA 1D2EA 3W6NA 3BBPA 1II0A 4KYUA 2GAAA 2YJTD 4F91B 3PJRA 2Z4SA 4AK9A 2D62A 3PEVA 4TL7A 4H1VA 3X1DA 3LD9A 3VTKA 5BN4A 2HYIC 8OHMA 2BCGY 1GSIA 2OM2A 5KSYA 1KAGA 2XB2A 3ZVRA 5JECA 1YZQA 2QP4A 3RAPR 1RIFA 5F2EA 2GKSA 3R9IA 3K0CA 1M74A 4MGYR 3Q7QA 2ECKA 3O47A 1E2DA 1CR0A 4PFSA 1DVRA 1LV7A 1XJQA 2H92A 5BQ5A 1FP6A 5JFGA 3EWSA 4QJ3A 2FDCA 4HLDA 1TAGA 1HE8B 1N5IA 1OH8A 2ZUBA 6Q21A 3BS4A 3F5FA 4NBSA 4A92A 4OI1A 2V6IA 1A4RA 2A5FA 5IRCD 5BYKA 1DAIA 1YVDA 1E2HA 3WMEA 1E32A 1NLYA 2WAXA 4C2TA 2W2XA 4XTCS 3GP8A 4PC1A 2LKCA 2ZYTX 1F60A 2IF0A 1ZW6A 1CULC 2ZRMA 4P4UA 1NSTA 3LW8A 2GA8A 5LD2C 2W0SA 1G41A 4HLCA 3FVQA 1K8RA 2PCJA 3AQ4A 4RSGA 2RGDA 4UXIA 4WBSA 1SXJE 1JECA 4IDNA 4IKEA 4KYIB 2C9CA 3W9YA 1A2KC 3GMTA 4NYIQ 4NYJR 1TMKA 1Q0UA 4GL2A 2C99A 3PUVA 4ZI2A 4BPBA 3KTAB 4TQ9A 3LO5A 621PA 3BD9A 4B3CA 4PPGA 1P72A 4BLRA 2W6JA 3ADKA 3OFNA 1VYTA 3MRSA 4B44A 4DVGA 3BIFA 3NBXX 1ESMA 2ZIAA 2FFBA 1XXHB 4EFNA 4DXAA 1XPUA 1D2NA 3KXIA 1NRJB 2DFTA 2PZFA 2QTFA 1GVNB 2WPDA 3GLFE 1WB9A 2ZRCA 5JCPA 1R4AA 1XD2B 2G0NA 2IEZA 2BVNA 2RGNA 3RS4A 3RS0A 4Z54A 4G5RA 2CVFA 4BFZA 2RGBA 2FSIA 2JEOA 3Q5EA 5SZHB 3U3RA 5KNDA 3U3MA 3Q3JB 3FTQA 1MR3F 1E1QD 1N6LA 1YRBA 3WXMA 3EARA 1OFTA 4MRPA 2NO1A 4MYUA 3X1XA 1J70A 4GSYA 4Q1EA 3WRYC 2ZRIA 2QQ0A 3QQ5A 4KFTA 3U3OA 3K70D 4TYNA 4OYHA 4DKXA 2H57A 1WXQA 2K5UA 4EKDA 3NDPA 3U3JA 3ASZA 3KL4A 2J1LA 2BDTA 3BORA 1VG1A 2IA5A 4MRSA 4JKIA 4R71A 4URZR 1Z22A 5EXSA 4KVGA 4HB4A 5BW8A 1Z06A 4WAUA 2BIFA 1L4YA 3ZQ6A 1SXJC 1O3YA 1ZNWA 4I4LA 4U5XA 121PA 4CW7A 4AY2A 3GEIA 2OEPA 3QKRB 1FQJA 3VX4A 2IYYA 3KUDA 2WSSD 4M8NE 5TB5A 1G7RA 5EQTA 2GTPA 4QJ5A 1T5IA 3RS7A 3T1TA 2CE2X 2P67A 2PLRA 1C4OA 2H16A 4R98A 4D0LB 1H65A 3LBNA 4Q01A 2ODEA 4P3YA 3KUCA 3W5JA 4O2RA 2W2VA 5DN6A 2UVQA 4Q03A 4O3MA 3KZ1E 2OT3B 2QM7A 5D3MA 4BUJA 4BFTA 3K70C 2CHGA 3HU3A 2FF7A 5C4GB 3OIVA 2FSHA 5EE9A 4M9QA 1ZU5A 2N1BA 3DKPA 1S96A 3FMPB 3U6BA 4FIDA 2GEUA 5KU1A 1GUAA 2EFGA 2ZI3A 4OJQA 1QVRA 4M1TA 4Q4LA 1DOAA 4HZIA 1EFRD 1MRSA 2D2EA 1EXMA 2Z5FA 4PAMA 4PHGA 3LLMA 5KPJA 5KPDA 2OO7A 3AP3A 3K9LA 2QNRA 1TUEA 5FPKA 3WYAA 3I32A 1CJUC 1GL7A 5FI0B 1TPZA 1NI3A 4V0ME 1BYUA 4B3FX 2OV2A 4JLVA 4GPTA 5FPSA 3QVVA 4TYYA 2Z43A 3CH5A 4URUR 3BJIC 3C8UA 5J4YA 1XEXB 3HU2A 1T3SA 2CE7A 3PCRB 5JRJA 2VP0A 2R8RA 4XD7D 4U00A 2IYZA 4B6FA 3IUYA 4YMVA 1SGWA 4EFLA 3EZ7A 2QZ4A 1ESNA 5SZJA 1F2UB 1VCIA 2V4ZA 3MCAA 1UKEA 4C0JA 3SE0A 4GP7A 3FHTA 1MO4A 4B48A 4MA4A 4OK5A 5HE9A 1I4LD 3C5CA 4BEJA 2XNSA 2WKRA 4EJSC 4A6PA 4II7A 3ZDQA 4EPYA 4M1YA 5K8LA 5TY0A 3MG9A 3CB4A 5LB2A 2H7VA 1S1CA 4URYR 2Q9BA 2WWFA 1KGDA 2O5VA 3UMSA 2QG6A 5JS8A 3BC1A 2RGCA 1T0JB 2VSOA 4EJSA 1E1RA 3B1VA 4EQ6A 4BZXA 4LYAA 2F43B 2GJ9A 5FOVA 3UG7A 3D7MA 4C0HA 1AK2A 4I1UA 5ANRB 4TYQA 2VYFA 4Y0AA 1R0ZA 2CLDX 4PAQA 2IS2A 5AJYA 1Q1BA 4Q7JB 1U98A 1RRGA 1YR7A 4NYMR 5AJXA 3W3AA 2QI9C 2A9KA 2G88A 2LWIA 4H1UA 3U60B 4DHEA 1HQYE 1IY1A 3AVPA 3WY9A 4C4PA 1TADA 2QU8A 1BO6A 5SZIA 2CNWA 1G8HA 3V4RA 3NBFA 4KLNA 1TF2A 2ZI4A 1OT3A 2DYKA 3EG5A 1S0UA 3UKDA 1A7JA 1R5OA 4JSTA 3U7FB 3DZDA 2AWNA 2NO6A 2GF9A 4MUBA 4QG7A 3KFVA 5GJCA 4A0FA 4OI4A 1ZM7A 1LTQA 1J2JA 4URWR 2FFQA 4M1WA 2CMKA 4B33A 3AVVA 4OHVA 2O8BB 2REXB 2ZU0C 2NOAA 2HXSA 5FBLB 1KJYA 4LJ8A 5F98A 1KO5A 1NN3A 4NHOA 2J0UB 4XWOA 4BZQA 3U4QB 1JJVA 2C5LA 3OIWA 4ZDIA 1YZUA 1TUIA 5FUVA 3THYA 1NIPA 3AVQA 2PX0A 1IXSB 3D6TB 3SNHA 3PEWA 1QHXA 2QP9X 2VIIA 1RRFA 1LVGA 1EX7A 4KHZA 5AK0A 1E3MA 3BXZA 5CK4A 5FFMA 1YZTA 4C0SA 2IYVA 5DLQC 3O8CA 2IYLD 2UKDA 1J8YF 2VRWA 2PH1A 4JVSB 3OE7A 1FPMA 5E7IA 3L0IB 4D2IA 3TQCA 2O8CA 4C0LA 1XCGB 3AVWA 2VHJA 1FMLA 1Z6TA 5GJBA 1G5RA 3KQNA 3AB3A 2GF0A 4G1UC 1NKSA 1PUJA 3G0HA 5JWOA 3VNVA 1IQPA 3BB1A 1E2GA 5TVKA 1OH5A 3MSXA 5KYKA 3NDBB 2GK7A 4ITRC 5FBRB 2NGRA 2AD1A 4P32A 5K8UA 1PLLA 2Z6VA 1E2PA 3LRPA 4KV9A 4FCTA 4GOJA 3OHMA 5DYGA 4M53A 1XTKA 3C7KA 4XOIA 2FWRA 1N0WA 4IFBA 2B8WA 3TQFA 3GLFA 1E2KA 3WRXC 2JCSA 2QBYB 5K8TA 1GM5A 4HDCA 5AJVB 5CLLA 2GJ8A 4NDZA 4DDUA 4MUAA 1P2SA 4BRUA 5TMPA 2ZM5A 2YC2C 4GZMA 4JBWA 2F1RA 2XTMA 2ZR0A 1G3UA 3G5UA 4UNSA 1COWA 2YC4C 4G5GA 4ASUD 1UBFA 1KK1A 2FU5C 1RRPA 3KKQA 2HF9A 1YKSA 2KSQA 4BE7B 4W5HA 5JI3E 2QM8A 1ZCAA 2ZJ5A 3NEYA 4NYIR 3A1VA 3MJRA 4KFUA 1C1YA 2VSFA 3KJGA 1U2RA 2RMKA 4KLZA 3TMKA 3T5GA 1PZNA 2IYWA 2XX3A 3UG6A 1XMVA 2JLYA 4PSAA 1YRAA 1AQYA 4LK2A 3X1WA 2GJAA 2J41A 3LWNA 4EUNA 3KQKA 2NQ2C 1GDDA 4I1SA 3LQRA 4MKIA 1OIXA 4B3BA 4DZZA 1TF7A 2W2TA 2F1HA 2X8AA 4PHHA 1AIPA 4MRVA 3B82A 3BAFA 2WPDD 1ZNXA 4O2LA 4QBHA 5TXGA 3L0SA 3LBIA 5KOYA 5AJWA 4ZCMA 3QF4B 1GKIA 1KY2A 2CHVA 3PENA 3QBVA 4NONA 2FFHA 1U81A 1JNYA 4JYCA 4M1MA 1N6HA 3SOPA 1S2MA 5KDLA 2OSBA
chains in the Genus database with same CATH superfamily
3LBFA 4NATA 2JHPA 2ZE7A 1MIOA 4N7JA 4UNQA 1I4DD 4YV1A 3HZHA 1LVUA 3DCYA 5ARDA 2EBHX 2HD4A 1GVHA 1ZH6A 3O4FA 3TRFA 3Q9SA 3MHPA 4ZPJA 4CKWB 4GR4A 1VJGA 3IUMA 3UJPA 1HT2E 1XDUA 3PQCA 1EUCA 3KEQA 1DQZA 1RYYA 2WB4A 5G1PA 3RHFA 2G08A 1DBVO 3HDYA 3VJLA 1W4BA 1TQ4A 4K6KA 3SAJA 3BK7A 2QMQA 3CRQA 5EXTA 2BPOA 3G0DA 1FK8A 1AU9A 5L6LB 4I3GA 2VDKB 3UQZA 4XWYA 3NBMA 2GBLC 3O73A 5DRTA 1VM6A 5TGTA 4QRHA 1K88A 4B3MB 4E08A 3MJEA 4YP9A 3L4SO 3ZU3A 3VZQA 4A03A 2Q50A 3CN7A 4GZLA 2OXRA 3D4IA 1NVAA 2CFIA 2HFJA 3AMVA 4UMDA 3UUGA 3VFDA 4IIUA 4EQZA 4YT2A 4YBRA 4DUGA 4JJGA 4ZHQA 2FNAA 3E70C 2BUCA 2DY0A 5D3MB 3QPVA 5IJZA 1FUKA 3TM4A 1DWOA 4PYOA 4CDMA 3KEGA 3KZVA 1ECCA 1RAIA 1C14A 2F9LA 3IHKA 4WNCA 3F4KA 1TFUA 1QBKC 4M0MA 4B0OA 1UH5A 1DWQA 2W2LD 3A6GA 4L78A 3K3PA 3SHFA 5EXDA 3RGWS 3TIFA 3ULKA 1G2PA 5HRCA 2YXPX 3R7WA 3C85A 1JHQA 2G1KA 1AA6A 3M2TA 4F11A 2XW6A 1HM5A 4I55F 4LOIA 4JEMA 4GO1A 1DMSA 1N0HA 3PKZA 5FB3A 5I4IA 2A5JA 2YL2A 3M34A 2WAYA 4KWIA 3OT5A 5ITZA 2JIQA 3SZGA 1KMHB 2CXTA 1CNEA 1NM5A 4IRMA 4JBNA 2XCRB 2ZJ4A 2JLCA 4G8BA 4JR1A 4NENA 2B9VA 3HJTA 4ARZB 2DHDA 1OC4A 4CLXA 4L4YA 2DSTA 4JLWA 1SMKA 2H1IA 3PXGA 4D3FA 3K30A 4MVJP 2VRBA 4E13A 5FOTA 2O2SA 3KJIA 2V98A 2GEVA 3BDVA 3DLTA 2H5IA 4RQBA 3LSTA 3OH8A 4M89A 1HE1C 2Q3FA 4BBZA 4PLYA 4XIGS 4OHZA 3QVXA 2CD9A 3H75A 2FN4A 5L8VA 4BVFA 4A2WA 2CC2A 5E6RB 1N6RA 1MEOA 3FYCA 1JDSA 4OBWA 5AM2A 1FJGB 4X84A 2Y4OA 4CCYB 3M83A 2LW7A 4IFEA 2IV3A 2QLTA 2IH2A 4UNPA 2PUAA 1YU9A 3HVIA 1ISIA 1DCMA 1CNMA 1WABA 3GRRA 4BMXA 4OHBA 4BVEA 2B35A 4A36A 3I83A 1IIRA 1SUWA 2PT9A 2ZJ7A 3BBLA 4UTXA 4IVQA 3HM9A 3NEJA 1IDOA 4PQFA 1QC5A 1V95A 3U4GA 4C07A 3MD0A 1JEAA 3EF0A 1A2OA 1IN5A 3KKLA 3HCWA 3PX3A 4Y30A 3I4FA 3SYKA 2HMWA 4F3CA 1FYVA 1E6LA 1G8AA 3TSCA 3NX4A 1XCOA 4LDRA 1WKCA 3CNLA 2COEA 4IMIB 1T5DX 1OBFO 1NUUA 4S2EA 4Z7NB 4Z51A 4JQYA 4PRYA 3CRVA 4EGFA 5CFZA 4QRIA 2IOYA 4ZO6A 1V1JA 2GAIA 3R1IA 1R00A 3D4NA 4HXYA 4PYMA 3ZZUA 4PYRA 4MWGA 3KS9A 5JCXA 3WKAA 4I0WB 3TUZC 1XNQB 4E15A 3FTDA 2A9QA 2O4UX 2XD4A 4WEQA 1HYEA 3BEDA 4JIGA 1JAYA 1R0YA 1YAHA 3C87A 1ADGA 2BM1A 4M9XA 2CNOA 3RVMA 3T35A 3V7FA 1GPBA 2JGDA 2EIXA 2J32A 4EO4A 4WVFA 1TOAA 1G66A 4FHFA 2YXNA 2ZRDA 1YB5A 1GARA 1YRQA 5IS2A 1ONSA 4NOKA 1HX7A 3QU7A 3TQSA 5IVDA 2H2GA 3W2IA 3FDJA 4FB4A 3HPRA 5CX4A 3A10A 4NSNA 5HEKA 2QRPA 1GPAA 4HX2A 4AUMA 3JTMA 1FJ2A 2R3SA 4FEYA 5C32A 1NVVQ 2CK3A 4X8LA 3ZNNA 5DGCA 2VNHA 3E6AA 3IBFA 5ITZB 2P6RA 2NVUA 4DSAA 2PGAA 4FWIB 3T06B 1Z5WA 3ZDBA 4LJRA 3SDBA 3FBTA 1Q0PA 1EZZA 4TOIA 4OQDA 3WL6A 4OYRA 1VCOA 3N53A 1NQAO 4ZXFA 3EXHB 4HXGA 4BZZA 4P4TA 4QPDA 2R84A 3U4QA 2YWRA 1WHSB 1LU9A 1P8JA 1KOJA 3EXAA 1EXVA 3QE9Y 4ZC1A 3AM5A 4TL8A 4LRWA 3IV7A 4QX6A 4XCVA 3WJ7A 2WIGA 3C6BA 4GRAA 3B3JA 1ZFNA 4QDTA 1ZGAA 2NZXA 4TYPA 2XB9A 4AT1A 2ZEJA 5DI9A 2X77A 5K0GA 1PWHA 3VR4D 1N9KA 1T36B 2W2KB 1GP2A 3DKKA 4G63A 3MUOA 1CQIB 3RU9A 4BB5A 5JJLA 1IWPB 1N5OX 3N5CA 4X3PA 2OGTA 4K9LA 2WWYA 1L7AA 3FGZA 4HQOA 4AJLA 3VOTA 5LQAA 3T3NA 3INGA 3ZD7A 3L8MA 1JW9B 5H4HA 1EVJA 1RFLA 2WJGA 2XUDA 3AY6A 1C7JA 1C0LA 3FHCB 2YZMA 3BFVA 2VHUA 1DRJA 4XGQA 3TYXA 1Z4IA 3VR2D 3GLQA 3QEJA 3V8MA 5A3VA 5C35A 2D5CA 1BKDR 1QVZA 1QOPB 3E03A 4Q21A 1N2CE 5FA8A 3OG9A 2C92A 3Q8XB 5TQJA 1KC3A 2IZOA 2VJCA 3ROMA 3B36A 4IBOA 1ZCJA 4D74A 2ZXUA 1WB4A 5DTIA 5H3HA 3OCJA 2NO9A 2VYCA 3UOAB 1CUBA 4P5DA 3BYZA 4CKEA 2GXSA 3LO8A 2UZ4A 3B3AA 1EMDA 4FGKA 4GC5A 2XVZA 2BH2A 2G9QA 2Y92A 1NQTA 3USCS 5EHZA 4JLAA 4AS1A 1VFPA 2YXEA 4FC7A 1Z88A 3RYHA 4NWIA 4ZTBA 3T7KA 3T5CA 2AE1A 2XECA 1WSWA 2NYVA 4JI1B 3IE1A 1Z0DA 4AROA 2C8VA 3HV0A 3OJ0A 4JI0B 4QGAA 3VSDA 4E51A 1HZZA 4TQAA 4A15A 1PR9A 5K3CA 1GL3A 3GLHA 1EM6A 3JRWA 3RF6A 4IIDA 3SICE 2FN7A 2GLUA 2GOYA 4Q5IA 1FX0B 4CT5A 3ELYA 2O2IA 2BHLA 4P0PB 4NBKA 3I09A 4V2UA 3SFTA 1TRHA 4R16A 1LWNA 2AT1A 1PEAA 1RJDA 2DPMA 1CWUA 3NC0C 4QBFA 4QGSA 1ZR4A 4ZICA 6REQA 5IWAB 2ZAGA 2W6ID 5EJ9A 3CEMA 1NUPA 3I2HA 3HCBA 3JZFA 2Z6QA 2R4TA 1KYQA 3JCZA 3T61A 2NO7A 4EFMA 5BN3A 5HM6A 5AUNB 5I3ZA 2R6ZA 1W75A 4NEHB 3EY9A 4TX1A 3CVOA 2C78A 2AD5A 1XZCA 3CH6A 1U90A 2C59A 1RAGA 2CLIB 2QRQA 4HO1X 4N8DA 5CG2A 3L7OA 4JBLA 5CDSA 2W98A 3KR1A 3T3OA 2WSMA 2EYUA 5K6RA 1NFQA 1ODIA 1JHXA 3HUDA 1LZLA 1X70A 2A1UB 2RCNA 1ODKA 3OD1A 2FG5A 3OFND 4YDSA 1GNLA 4DN6A 2C9ZA 4JB8A 1RPAA 3LT2A 3ZLVA 1U3WA 2W00A 1R4MA 4XQ0A 1K9VF 4YRPA 1NW5A 2HHHB 2O6HA 3RS2A 3NKFA 1A4IA 1MAVA 4NECA 1B6TA 3QBTA 3GJQA 4TT3D 3TDMA 2AN9A 5C51B 3CNEA 4UUQA 1I4EB 3CVXA 5CH8A 4F4FA 1B00A 4AF7A 4FGSA 5PNTA 4EFKA 1C4KA 2FJPA 1IXRC 1L7RA 1JYSA 1RRCA 3F6SA 2Y93A 3IOMA 1WB5A 5AW1A 4EUEA 1YCFA 4F0JA 4W7IA 4HI0E 1ZCFA 2CYBA 3DSRA 1YMVA 1XLUA 2YYAA 2NO4A 2X22A 3G79A 4X64B 2PT5A 1W5BA 1X2BA 1WMSA 3JPWA 3K72B 1WW8A 2QD2A 4KIFA 1OFHA 2XUGA 1ZIXA 2A0KA 2E1PA 2IF2A 1SC9A 2XUAA 4G0PA 5LQMA 3HCPA 5FOSA 4LF6B 3O3CA 1XFAA 3DMPA 1CFZA 4AURA 1F8GA 3K0SA 1DAGA 1JJBA 4FINA 1BH6A 3TFQA 2O8EB 3GLSA 3A8TA 1Q1EA 2VJAA 1I36A 1A96A 2PN1A 4K2AA 5HXAA 1N2IA 3LLSA 4HNRA 4OF4A 2IP2A 1U0BB 3M0EA 1GTJ1 1SCAA 3AR3A 3TUIC 3R8FA 2C2HA 3CWCA 3IODA 2WZCA 2EFJA 3TVYA 3DCIA 2LD4A 1JI0A 5DPMA 2COKA 3DFKA 4AZTA 4YCMA 1N6OA 2DVMA 2CMHA 3KXLA 1SKQA 4DB4A 3ORSA 2PY6A 1FNCA 1IHOA 1JLLA 2AJCA 4L16A 1YC2A 2MTBA 4PNZA 4EGSA 1KTIA 3GJ0A 3WHPA 1R50A 3R6GA 5KDOA 3ZI0A 3MB8A 4HFJA 1DAFA 3I01M 3EPJA 4NPCA 5LQRA 4WXHA 2NXJA 2O5RA 3PHHA 3EOAI 3KHSA 3TD2A 2NP7A 5JQGA 2HGZA 2VVTA 1PZGA 2IC5A 1QGED 2EC5A 2XE8A 3IALA 4E07A 3WFIA 3AEKB 5G1NA 1OXTA 1OZHA 2D2IA 4W5QA 4AMBA 1PFWA 1CJSA 3KVNA 3EULA 5B4UA 5CM2Z 2ATXA 2D3WA 3COSA 3RFUA 1RMTA 1IJFA 1F6BA 3UK2A 4N49A 2NTNA 1T3HA 4ZAZA 3CS3A 3L6RA 5IJ9B 5B1IA 4EG7A 2KLHA 4EG8A 2OKCA 4CE6A 1IFXA 3C8MA 4B3TB 2LUOA 1NNSA 1I1QB 2I9PA 4NJOA 2RG7A 3HE3A 3STWA 5JCJA 2H0AA 4OA8A 4AWAA 2DR0A 1NOJA 4W4TA 1GG2A 1NBMD 2TMYA 3QELA 4MWOA 3UTDA 4RVUA 4ZP1A 1G17A 4D9JA 2OLKA 3V2GA 4ETIA 3PC2A 3C24A 4B3JA 3H3JA 2NVUB 2CMDA 2D3TA 3FWHA 3JV7A 4QYXA 3M5CA 1B8UA 1QH1B 4JR0A 1JQDA 4F4IA 3GO4A 1UAAA 1FU7A 4JLBA 2DH6A 1T8WA 4DKJA 4ZU1X 3A1WA 1A9SA 4A82A 4FFMA 3MWDA 3VDXA 3A4LA 3W6ZA 1WF6A 4I4CA 1D5WA 4H59A 3TRHA 3B89A 3WB0A 4DC0A 2P9TA 1E1YA 3IERA 4LWOA 3CLKA 4MV6A 5A9RA 1M10A 3OLYA 4Z9XA 3VR5D 4W9MC 1YS1X 2Z09A 3O8BA 2D13A 4BO2A 5IDYA 4RULA 1ID8A 2RBGA 2G9UA 3B1WA 3L8GA 3CLUD 3ZE0B 5JSZB 1SXJD 3DNFA 1P18A 2Q6VA 4DRXA 3G17A 3FWZA 4MUKA 2BFDA 1Y63A 4JELA 1OXVA 4CM9A 1APBA 1P1IA 4XUGB 4DA9A 3U5ZB 5E1OA 4WZBE 2PE5A 1T3LA 1JIJA 2JB9A 2ZBGA 4FI3C 4O0LA 4TLAA 4JXZA 1E3EA 4GXNA 3IL2A 3LK7A 2HQ1A 3AKEA 1NYQA 3OZAA 4U2KA 1JR3D 2B7LA 4GYWA 5BORA 2W71A 3DULA 3HXKA 3JWEA 1J1UA 4INJA 1G38A 1Z8FA 3KSMA 1E2EA 2M1XA 3IRVA 4Q66C 2C7GA 4GR5A 4RLHA 2R6GA 3W5HA 4ZJPA 2J9FB 1GA1A 4PICA 3N5KA 1H2FA 1OX5A 3EH2A 3QMVA 1FUUA 5LMCA 4PO3X 2HCBA 4R5HA 4YLGA 1IJEA 3T7AA 3VSBA 5EZYF 3BJZA 3UJDA 4BMNA 4O0MA 3HYNA 1DBSA 3K0AA 1ESEA 5DK6A 2J3HA 3QKSB 2GKOA 3VV2A 3L77A 3BX1A 5JHHB 1NN0A 2YWBA 2ZULA 3E9CA 3PFBA 4MQ6A 2HKIA 3ZXUB 2NPFA 2OV8A 4L50A 3P96A 2ADOA 4YS6A 1UFKA 4KK3A 3ITEA 4ADSG 4UHJA 2Z6AA 1IVNA 3D54D 2O23A 2ZT5A 3AFOA 1GIAA 4IV8A 5E1BA 4K9OA 2IPOA 1QZUA 1ZGZA 2Q3EA 3M4NA 4P82A 1Y9DA 1VPVA 2ZRLA 2AK2A 2P2LA 1T5TA 3OU6A 4C05A 4FYJA 1W1UA 1X8KA 4KBGA 3JQGB 5IVHA 1QKIA 4MWSA 3ZE7A 3ZHRA 4YNBA 3TTVA 1UT8A 3M89A 1WUTA 2AHRA 1O6CA 2X9LA 1ZH2A 4NL4H 5ALTA 4EGQA 1XVIA 3FSGD 2C96A 2CVOA 4OJTA 3UANA 4J4BA 5IFKA 1C50A 2BGKA 4RF2A 3WLLA 3FY4A 3PUXA 3Q9LA 3VR4A 4UOEA 3Q8KA 3PFHA 4GPAA 4MEBA 4GKAA 1Q7TA 1RWQA 2P9GA 2H1CA 3LW7A 3GFTA 5DW3A 3W05A 4DEXA 3PQ6A 3JZMA 1ZP6A 3A25A 4KBYA 3RHSA 1U3VA 2XYRA 4KODA 4WK2B 4JDUA 4CYMA 2ATEA 1VPWA 4BNZA 3H6KA 3LC2O 1CZUA 2UVDA 4PRZA 3FFAA 2X4LA 1PL7A 3PEEA 3MT0A 4H7KA 3LDUA 1PR4A 1PZMA 2I1VB 4P35A 1KVTA 1VHQA 1QTNA 5ALQA 3EZXA 2EKBA 2OFPA 3A9CA 3H99A 3IIKA 4V24A 4BVJA 1OGYA 1O95D 1GPDG 2II6A 5EOVA 3AF4A 1TCBA 3MTIA 4X7BA 5ALYA 3SMVA 2O0LA 4LEIA 3A6LA 3GC6A 1X8XA 3CF0A 4BNVA 1DBPA 4MRMA 1TQDA 4YJ2A 4H0CA 3ZU5A 4E1VA 1V2HE 2ISCA 4RC9A 1OZAA 3PXCX 2WHYA 4D80A 1JSZA 1Q50A 4Q9IA 4FWBA 4PYNA 4WQMA 1MU0A 2BZGA 2ASEA 5LBUA 5C5DA 3GCZA 1REQA 4KQFA 4X6LA 5AHXA 2GM3A 3T0IA 1L7PA 4D43A 1ZAKA 3VVLA 1XF1A 1M6EX 1YOVA 2AFHA 3ROXA 5LP6F 4JLMA 4PEVA 2OLJA 4KITB 1CS4C 2YFQA 5G4LA 3WHKA 1MAHA 3U13A 5DHRA 3AF6A 3ROPA 2EYQA 4XD2A 5MGBA 1PFUA 3T95A 3NIBA 2GJ4A 5E0OA 1QPGA 4HZUB 4CR8A 5C1PA 2BFMA 2G0TA 2NUPB 2OHHA 3ZEAA 3D4OA 3CEAA 1BEEA 3D4PA 1G9TA 1RRVA 2Z1DA 1YZYA 1EE9A 1YB2A 4IV5A 1AOXA 4GQAA 1Y1RA 1BU5A 2H18A 1CUFA 2A5DA 2NXNA 2PR7A 3DE7X 3D1LA 3ETJA 3GEGA 4NK4A 5IK2A 4UC0A 4EP1A 3NNNA 4YJ3B 3SVTA 1F2DA 4RTJA 1C1DB 3PUJA 1WXEA 4AYXA 2L18A 1EFRA 3PJFA 4O08A 3EGXB 2XQFA 3ZWVA 1HDOA 4DDKA 2HQBA 5AVZA 1YT5A 2H8KA 4FFBA 3C4VA 4PLFA 4MS4A 1NHGA 1LLQA 3EPHA 4XDHA 4ZVQA 1CQIA 2WTEA 1YUNA 3JD0A 1XPJA 4YAEA 4FEGA 3UOWA 3RYCA 1K6XA 1JIVA 3JALA 3RBXA 1ADCA 5JZMA 3TZHA 3KXPA 3FJYA 3ABIA 1F4VA 1GRNA 2QUJA 1T8UA 1TF5A 2DP4E 4FYIA 4NQRA 4AY4A 4A2PA 4FFWA 1RBYA 4GKKB 4AKEA 3NTOA 1OJLA 5B64A 4JCOA 1IPHA 3QLUC 3QM1A 4A8TA 4EATA 1RIIA 5EZYB 3VHQA 3UN1A 1FRFS 4W9NC 3A3PA 3DOIA 1TRKA 4AQ7A 1SBTA 2I33A 4Q1DA 4K87A 1R9JA 2CLEB 4PR3A 3VGPA 1YR6A 1T1JA 4V39A 2OXTA 3QUCA 5E9JA 5AESA 1A3CA 2JFBA 3BERA 4B71A 4QHYA 2ODNA 3O90A 1J09A 1XZEA 2VJKA 2H65A 3BGSA 3V46A 2WJ6A 1Z37A 2NTEA 1UXJA 2G4CA 4EA7A 2UYCA 1JKJB 1S3SA 2FPXA 3MT7A 5EKTA 3CE6A 2I62A 2HJ9A 4DQLA 3JYLA 1NQ5A 2G63A 1IBLB 3H9EO 3L0PA 1OB2A 1QTIA 3G0GA 3G82C 1SQ5A 2CXRA 4UQOA 4Y7CA 1NMXA 4BTVA 1W46A 3SOZA 3TECE 3HN2A 1A76A 1ORVA 3BHJA 2X9NA 3GRUA 4D45A 2V8OA 1W0JD 5IH7A 2QTLA 4OOEA 3SFVA 4D9IA 4WXRA 1X7GA 3MRTA 3DQZA 4HDSB 2R4QA 3TRJA 2CSUA 3OTOB 2NZJA 3ENVA 2GXAA 4UUNA 5A5VA 3IB6A 1SXIA 2X9QA 5T64A 4MZXA 3F1LA 5AW2A 1JL3A 1FIUA 1F1BA 4Y2QA 5C8YB 1KMIY 1EDBA 221PA 2YRWA 1E2IA 1L7EA 2R1VB 3N28A 5FR1A 2EFEB 2XOEA 2B30A 1B16A 1BGWA 1I6LA 2X76A 3GCDA 1Z83A 4Z86A 5ES4B 2ZU6A 3I9NA 3DW1X 2HLNA 4P22A 7ADHA 4PPNA 2I6UA 5FOQA 1HDEA 4I8IA 1NDHA 1NBMA 4E5YA 4U4AA 6CHYA 1YE5A 4BKUA 3MCVA 1PJLA 1PEDA 3E22A 3RK1A 3G8YA 5FP0A 3B1JA 2HRCA 3MLEA 4I3HA 4DDHA 3GLGB 4GX5A 4UTRA 1NG1A 1YBVA 1BMDA 1RAEA 1EKXA 4N0PA 3PRYA 4JS0A 3ZU2A 1MJ5A 4Q12A 1QQAA 2WZBA 4R7ZA 4XLZA 4CM1A 5K4HA 2YZ7A 2WG0A 1G21E 2AN5A 5C0OE 4Q0MA 5A6SB 4CJXA 1C8KA 1RAAA 2HDNB 1MHPA 3NHJA 3HKCA 4R2XA 1CEEA 3B38A 4RIHA 3TG2A 4L07A 4FC6A 2F8TA 3R9XA 4IVRA 1B4DA 1QWOA 2QL5A 3GNTA 1VZ3A 4WOJA 4F2GA 2REOA 4L85A 1AS3A 5JO9A 4BAUA 4D3SA 3S6JA 1SQ0A 1D4FA 2C2MA 3JD1A 3K1AA 4HLQB 3V8VA 3AVTA 4RK5A 1L7BA 5HK8A 4F7WA 3WWEA 3INYA 1EWKA 5JNVA 5B1YA 4YJDA 1C7RA 3DW3X 3GMDA 1WTCA 2HIHA 2I1QA 2ZYHA 3IUQA 3GR6A 4OQXA 5DSTA 1PS9A 4MLDA 1IN6A 1GUDA 1RWOA 3AZQA 3ZWOA 4QXOA 1NMQA 4KMSA 3TNLA 1JQBA 2KQUA 2C2XA 1QDUA 3E1GA 3H4IA 1A4UA 1GTZA 2I3AA 3HU1A 2J5XA 1S8OA 5FPHA 1A9YA 2YJ4A 3FOFC 1ZO8A 4H7IA 1GPH1 1KNQA 2QT0A 3WLAA 3LJKA 2ZTUA 5IASA 1W44A 1WBJB 1PNRA 1PK9A 3H0EA 1ZITA 3BGWA 4GR9A 4AD8A 5LDHA 1AN0A 4M55A 5FCDA 1CUSA 2J4DA 3JQAD 1J22A 2IH4A 2C9MA 2PGNA 3K96A 1JPVA 3NJ4A 4F5YA 3QFCA 1Z16A 3DZIA 1DEKA 4K0KB 3G0OA 2C5HA 2KS6A 4NCNA 1RYFA 1R5JA 5CFQA 2Z1NA 2QMOA 3ZI4A 4ZZ1A 2BKEA 4LI3X 3ZBPA 1Z0ZA 1P5FA 2AI1A 1JFFB 3PKIA 4DV1B 4CDRA 4WJZA 5CA0B 4OMUA 4QDJA 2E0IA 1KMCA 5ILOA 1RXWA 2O2ZA 4M9ZA 3HB7A 2YDXA 3G2JA 3W2TA 4F5ZA 5KYNA 1HBJA 2M2IA 4NH0A 1K4YA 1U2TA 3WTCA 3FIJA 3H6HA 1FU4A 1XYVA 3E9MA 2EWWA 3AHHA 4PYIA 5JNTA 4AMUA 3EMVA 2I3BA 3MFYA 4GMKA 5BR4A 5C8VA 2B1QA 5ICSA 1EFAA 3VPFA 1FLDA 2B21A 2I76A 2W6MA 3DV0A 3TW0A 1GUBA 3Q3VA 1SUDA 4BCCA 1PYDA 1POXA 4ETMA 1V3UA 2C8JA 4BNXA 2NTJA 4EY5A 4ENWA 1FA9A 4EG6A 2ZRJA 1RM0A 3GDGA 4Y7DA 4Z0HO 2VQSA 5ESRA 7GPBA 3THXA 4F04A 5DWVA 3NIWA 4I8XA 3RYTC 4OLAA 2A7QA 2C5GA 3OWHA 2IEAA 1K92A 1ZHOA 2F3SA 3NS7A 5REQB 5B7PA 4FJ2A 4P3KA 1DARA 1YD7A 2IOFA 2IBMA 2O50A 2QVCA 3KG2A 4HWTA 1KMHA 1RP1A 4PZEA 3U9TA 3OOJA 3CEJA 1UOPA 4E6EA 1UPFA 4B4WA 3QFRA 3IUEA 2ESRA 1WZUA 1FDOA 3PQFA 4I2NA 2Z2IA 5F1KA 4JXJA 1H2RS 2FJ0A 1C3XA 4WNYA 4DCNA 4P2GA 1PJAA 3T1NA 4IMRA 4RS3A 2UZIR 2CBGA 2NU7A 4DR4B 3A1TA 1E4YA 1YO6A 2PS9A 4RA6B 5FEMA 1DCTA 3KJXA 4WHMA 1P75A 4K05A 4U8HA 2V6FA 5E7JA 2UYQA 2ENUA 4S0XA 4B43A 4ZV9A 5HQJA 4DLWA 3KSZO 1A1SA 3EIHA 4ZCPA 1ZI9A 4A7PA 4JWTA 5AXDA 5EJ5A 3LWZA 3PGVA 1HZZC 1L7DA 1IRXA 5GVSA 4G5SA 2G8LA 2D1QA 3O1JC 2I2WA 4QOHA 3OZVA 4M98A 5FBWB 1ENYA 3VPBA 1QP4A 5AW0A 1PGQA 2ORWA 3LUBA 3PQ4A 3DDUA 4Y2TA 4MQ4A 2ZPUA 2OBMA 1IQ0A 1NXWA 1GAJA 2A67A 1MA0A 2PT6A 1D6JA 5FL7D 4UCXA 721PA 4C6HA 1NI4A 2RGRA 1ZNQO 3P4YA 4NNJA 1KRXA 3UJ6A 1B42A 4OLBA 1WKBA 5I7SA 3LC7O 3W2FA 1BSVA 3SX4A 4B0PA 3SQXA 1KERA 3NUQA 5K45A 2OXEA 1DDIA 2VDVE 1LDMA 4NOMA 4G97A 1D04A 1HQCA 3WS7A 1C29B 3FAZA 2FXIA 1E4EA 1MO5A 1WOMA 1XHLA 2D74A 4UUOA 1KKLA 3CCBA 2HCFA 3U7GA 3ZY5A 3SXUB 3HBLA 1XBTA 4Z0PA 4MGIR 1JIUA 4P7GA 4M7RA 2YHAA 3MWEA 5T3UA 3TJMA 1E0KA 3KQMA 5EESA 2GN8A 2VJOA 3UB2A 4CIDA 4EG3A 4WPGA 4F5EA 1U7TA 5JJ5A 1IN1A 2DWQA 2O9JA 3WKBA 4G1BA 2DTXA 2H1LA 2R7NA 4KJZA 1LX7A 2PRZA 1DKRA 2XCOA 3AY7A 3K1YA 4OYLA 3V33A 1AHIA 2JAUA 3GWGA 2Y1DA 3NHKA 4K2HA 5DWDA 3DDHA 2ZOSA 1ADFA 3VH1A 2HDHA 3CVYA 2DT5A 2IIQA 4N3GA 3QHAA 5JYEA 2H3EA 2LBPA 1KE1A 2NYAA 2YOHA 1S6YA 4X92A 2VF7A 1SVMA 1JZTA 1QG6A 2NPOA 2QENA 1FFHA 4X5OA 3F6EX 4Y9DA 3QFSA 3L7YA 2OL4A 4LDZA 5AM1A 4BEBA 2C4WA 3FCAA 4JC8A 4J29A 5A9TA 3SHWA 1DQRA 5DN9A 4AG3A 2BRUC 5D86A 4IO0A 1YS2X 1PG5A 2DQSA 4MDYA 4MUGA 4WNAB 2P2NA 1UKAA 1L4NA 3TQHA 2XXAA 2XV1A 1AGNA 4RD3A 1YR2A 1WQ4A 3AX6A 3TF5A 1Q57A 4MRAA 2E2WA 1TZ2A 1MGOA 4M54A 5ERXA 1KI9A 3H5VA 3TTTA 2JJYA 4LYFA 3OZTA 1MNQA 4RW0A 4BX3A 1WPGA 1V0JA 4DRXB 3WKCA 4BO0A 1ZISA 2FLWA 2CVQA 4DEYA 5ICMA 1FRNA 1UBGA 2VF4X 3QE2A 1W1IA 1E1CB 4DMGA 1MC4A 3EFEA 4WDRA 5E7QA 2WWVD 1WQ3A 2HSWA 1IE3A 3CZQA 1OWLA 4I2VA 1EA7A 1H4TA 3EIWA 3F6RA 4HDAA 4IDGA 4IIJF 4OQYA 1IN8A 4UXHA 4X9XA 3M82A 5CTAA 4DR6B 3FDZB 2IOHA 2O3RA 1CR1A 2OD2A 5HHTA 2ZDQA 1NZDA 4HEQA 2A94A 3LAWA 1L4KA 4AVYA 1SHLA 1DIHA 2DLNA 1PS8A 2D06A 2Q27A 3JATA 4GOKA 1T13A 5CT9A 2PZJA 2C9BA 2BGIA 3ICEA 1Z6QA 4JXXA 3B5EA 4L27A 1ADBA 4II3A 3TE6A 3R7LA 2QOEA 3BHIA 2QTHA 2AEEA 2GCPA 4P0TA 2FETA 1I6KA 2FX3A 1OI4A 4YRNA 3NB0A 1EVZA 4FBLA 2VXOA 1JIQA 2J7PA 4S12A 1WP9A 2FGJA 2JFPA 4MX8A 4ETWA 2A0FA 5K01A 4Q19A 1BD3A 1QV7A 3DF7A 5LJLA 1VKHA 2PUWA 5BWOA 4M1EA 1PSDA 3NBQA 2WK1A 3KJQA 4I3FA 4P38A 3T1HB 2P2DA 4RHXA 4CKEB 4AI6A 4Z7JA 2WQZA 4M1OA 1DBRA 4UEOA 3OEHD 1I3CA 1JWBB 3DOHA 3G5AA 3DS8A 4PZZA 1K8QA 5I9MA 5L4NA 4CZ2A 3SJZA 1DGQA 4MYDA 4B8YA 1HEUA 5LYJF 1OWMA 1N6NA 3KKEA 1NP7A 1TFRA 1NVWQ 4KQKA 3KAKA 3AUUA 5ULLA 1V96A 4HDMA 1TEZA 3CLVA 4RCVA 5AOAA 1AKNA 1ZRSA 3TRKA 1TLFA 3WP1B 2QQGA 1H2HA 1WUHS 3ENNA 3F5MA 4QVGA 3R8CA 3P32A 3P1JA 1F8YA 2ILTA 2P79A 1R4MB 1V8DA 2WJPA 1NNEA 3EUAA 4IMJB 3THWB 1DUVG 4QOSA 3NHUA 3VZCA 5KCZA 2ZVJA 3PQDA 1Z4KA 2ZETA 4DUPA 3DTNA 2D2VA 3PK0A 2C94A 1EWTA 3GUZA 1MX9A 1T15A 1TVEA 4RF5A 4UDYX 1BW9A 4X60A 3P9PA 3RRXA 4B6OA 2QY9A 4L75A 1C4WA 1XG5A 1G5IA 4YPFA 1XMSA 1ZD4A 1JPJA 4ZI7B 1E9DA 1NC1A 1IXZA 1ULAA 3DDOA 1RZRD 3PE3A 5FA5A 2QMUA 1XFDA 1ETHA 4JITA 5B2EA 3LCMA 1M1UA 3U4HA 2P7HA 2WJIA 3AL0C 1NVMB 5CNMA 3WWZA 4D0GA 1OU0A 4TV9B 5AI8A 4EARA 3QK7A 3VO9A 1T36A 2G4LA 2RK3A 5FH9A 4CEIA 4IOLA 4RK4A 4F3NA 2G09A 1II9A 1M7BA 3OCVA 3DMTC 4IJ5A 4JA2A 4KXQA 4KOEC 4EFDA 4BTLA 3LT5A 4MB6A 2XOXA 5JR3A 4L6IA 1XJ5A 2C8LA 4Y2UA 1YDHA 4US2R 1GU1A 1CRQA 4MW5A 5HIIA 4F4JA 4MS4B 1J4AA 3KFXA 2QZJA 5KJEA 5D87A 1FFXB 1RJEA 3LH5A 2OESA 3G7NA 1GFWA 3N7TA 4HGPA 1UM9A 1GXSA 4B7UA 4RGBA 1UXKA 3PCTA 3SYLA 2JZCA 1UWVA 2YS6A 3B3QA 3EIOA 3H8SA 3IQDB 2BMJA 1Q20A 4JT4A 4WKGA 1AY0A 1MRZA 4YBZA 5HS6A 4CVNA 3AVYA 5D1NA 4XD7A 4JJKA 3MIZA 5FL3A 1MHTA 3PQ2A 4OXKA 1V3VA 1M6YA 5DH9A 4DSTA 3IPRA 3FMIA 4NU0A 2R62A 3JSAA 3CG4A 1RCTE 1X7ZA 2ZIFA 4BXOA 5A3QA 3N1UA 2PCLA 1U3UA 4C7OA 3O82A 4WA7A 5KTOA 1ITZA 3OZFA 1AKMA 1QK5A 1RCFA 2DJIA 4KMOA 2W8ZA 3FCXA 3HO6A 2WU0A 1EDOA 2GEBA 1W29A 1WDKA 3AC0A 2YIJA 2HBYA 3MGAA 1VCNA 3QX8A 1MMFB 2PX5A 3I04A 5DXFA 1E9AA 3ONWA 4UEJA 3Q3HA 5ALIA 4WDQA 1SRRA 5ICFA 3TKLA 4RD1A 2JFYA 2RB5A 3IUBA 3H65A 1WXXA 1IPFA 4FJ0A 3N8HA 3THOA 2H4XA 1G42A 3UHOA 3RS9A 1P9RA 4JHXA 1OROA 5EUQB 1W76A 5I45A 4RAOA 2BBOA 4ZN6A 3UWOA 2F6RA 2Q2QA 3JQBC 3T0GA 3DCNA 4JI3B 1ZA2A 2H63A 2VK8A 2VJNA 2GT1A 3PPIA 1KFKB 1S9HA 4MQMA 1UP6A 1JKJA 4MYTA 3TH5A 1YOBA 2Y68A 5J40A 1LPAB 1MJFA 1YCHA 1T9CA 4D81A 3E9QA 2XNCA 4GLOA 3R7FA 3VSCA 5EUMA 3ZD8A 1WZ2A 2JHGA 5CDTA 2VRNA 3BCRA 3E3MA 3QLUA 1RPJA 1JEYA 3DZFA 2YZ2A 1FTSA 3E4DA 1TJ3A 4C5BA 4MP3A 3R3JA 1H8HD 1FDSA 2A3RA 4PZYA 3V4PB 5EJAA 5THXA 3ZE8A 5KTRA 4ZHQB 3FUTA 2IFTA 2ZIWB 3AETB 3CM0A 2QP3A 1XMIA 2GJSA 1H2BA 4MLCA 4F92B 4HY3A 1BW9B 4B9EA 4M0EA 1YQEA 1H93A 4H31A 4L22A 2WNSA 4F45A 4RY0A 1XRMA 3IAAA 4JJ6A 1UC4B 1VGRA 3NBKA 4KQCA 1DCFA 3GGDA 4P8RA 4HL6A 4MS1B 4C22A 1U2QA 4QLAA 5HQ3B 3HI6A 2ZREA 2GRAA 2PAFA 3G02A 4DB2A 3ZV3A 2J08A 3B20A 4FGUA 1U2DC 3QU5A 4MUIA 5EJIA 1YMQA 4NCXA 3H5IA 1TDJA 1NJFA 3CUKA 2AKAB 4L2IA 4XGKA 3TLAA 4RGVA 1ILEA 1VA5A 5DE3A 2BGLA 2R00C 4LF8B 3TQRA 3KJNA 3B9PA 2FY8A 2DY1A 3KALA 5ALLA 3MLBA 3DEAA 3LCVB 3UJAA 1PYGA 5AVVA 5EUBA 5EEHA 4NNOA 2JEYA 3IPLA 1VI5A 3SC2B 5LQUA 2P9HA 3AY3A 2PPLA 2CF5A 2XIJA 3IO3A 3L2OB 5KCMA 2GHIA 4WCDA 4F12A 3I34X 3NANA 4U7DA 1DSSG 1C3OA 2NU9B 1U8YA 2HO5A 2O3SA 5DBIA 4D57A 2IS1A 1XA0A 2P40A 5I7FA 3D43A 4DG8A 2PH5A 4R2WA 1KU0A 1Z5OA 4RV9A 1GCIA 3HWX1 3V97A 3N8IA 4ZPXA 2W70A 4OQPA 2QM0A 4DA4A 3VVBA 1ZC4A 3TD9A 3UICA 1ZK1A 5BSKA 3QELB 1VLVA 2JH3A 5C18A 1ZC3A 3PLNA 5DHSA 3GX1A 1KI4A 1QQBA 4TKUB 1F0PA 2B2XA 3LKDA 3TOXA 3EASA 5G2OA 3H9GA 3BFPA 4NJEB 4P80A 3QVOA 1OI3A 1AMOA 1YE3A 1I4WA 4CM8A 2OLEA 4LQ4A 2HT1A 1HTBA 1KI8A 2NSDA 4L4ZA 1OLSA 1VDMA 4HDQB 4M22A 3VPDA 3N2LA 2BELA 1Q83A 3FYHA 3ETGA 3JVUA 4RQUA 3BXFA 2WVAA 2ZROA 2QRGA 1E1LA 4MAFA 5FNVA 3N0RA 1I5EA 3KJZA 3KQOA 4X71A 5EQFA 1NLMA 1MX1A 3ZLUA 4C89A 1AZWA 2AIRA 2JFZA 2IGTA 1ZU4A 3VAZA 1I3OA 1NMZA 1XTZA 2W93A 1QGZA 1Z2AA 2BC9A 2HPHA 2XDAA 3QHQA 4IWNA 3CF2A 4UNNA 1K6JA