4TYQA

Crystal structure of an adenylate kinase mutant--akm2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEYVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structures of thermally stable adenylate kinase mutants designed by local structural entropy optimization and structure-guided mutagenesis
doi rcsb
source organism Bacillus subtilis 168
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tyqA00
1Q22A 1XZQA 1KKMA 4U7DA 2JDID 4N1AA 4EIWA 5FR1A 2OM2A 1KKLA 3NC0C 4M9ZA 1MH1A 2FPLA 2A5GA 2V3CC 2VSFA 1LFDB 1JR3E 2ZYWX 4TLBA 3PEYA 2XXAA 3ECCA 4BFXA 2OV2A 1NIJA 4EFNA 4XVRA 1JALA 4Z1MA 2HJVA 4O2RA 2VHQA 4HDCA 2ZSEA 1KAGA 4A82A 4EFLA 2BBWA 4G5OA 1U98A 1J90A 4JBWA 5FOXA 3P27A 5HTKA 3GJ4A 3AVQA 4GMXA 4EDHA 4EFMA 1VTKA 3S1AA 2YOGA 3QUSA 3ZD6A 1FUUA 3HPQA 2DBYA 1EFCA 1W5TA 3PJRA 1HY3A 3BB1A 1RE0A 2VQSA 1W36C 3OAAA 3W3ZB 1BYUA 3K70D 5CLQA 3N2IA 1AK2A 4ACBA 3THWB 5KTYA 3GPLA 4JMPA 4Y0AA 5A0FA 1YRAA 4MYCA 4LBWA 3GJ6A 1OH8A 4MGKR 1EFHA 4OK5A 2ZI6A 2VBCA 1EK0A 3CRMA 3QBTA 3AVYA 2O8BA 3W5JA 3AVPA 1EFRD 2Z83A 2J7PD 5B30A 1XPRA 4URWR 5BW8A 2AR7A 4TMXA 1T91A 1GZSA 1A82A 4UKDA 1X8KA 3SZRA 1CEEA 4AKIA 2J0UB 3I8SA 2VF8A 4HB4A 1XMVA 5EQTA 1G8YA 5A5GA 1NMZA 4JLVA 3TSWA 1ZM3A 5JJLA 2AKYA 1P5ZB 4L16A 2KSQA 4TMZA 4BRWA 4HLUA 2IYUA 4X8MA 4AURA 4Q5IA 3UWOA 4DLRA 3AGQA 2GZHA 4NYMQ 3CW2A 4DDTA 2PX0A 2Y8EA 1QHIA 2GHIA 3VX3A 3I5XA 1ZP6A 5B58C 3MWKA 4OI0A 2IEYA 1WMSA 1E32A 2XTNA 4HYYA 2ZROA 4BFTA 2IUSA 2JJ2D 3CNOA 2NOAA 4WW0A 3GEHA 4FW9A 3BFVA 3OAAD 2R6CA 1KI9A 5DHFA 5HE8A 4AD8A 3EXAA 4KV9A 2WWHA 4URYR 2WKRA 3T61A 1UBEA 4Q47A 1GOTA 1II9A 1ZNZA 3PENA 4Q4HA 4F7WA 4DKXA 2BKUA 1E2NA 1ZVQA 2CLSA 1S2MA 4XTCS 5EP2A 5E7MA 3QJYA 3C41J 2G1JA 3RSOA 2EW1A 3FB4A 3VR1A 1JBKA 1XMSA 1S4QA 1N5LA 2P6NA 4KYUA 1BIFA 4DLSA 3CRRA 4GMDA 3UKDA 3W8NA 2XEXA 3A1UA 4ARZB 5C46F 4BPBA 3R9XA 1SGWA 5CITA 2D74A 4ESHA 5KPDA 5GVRA 4JBXA 1X1SA 3KKMA 4HAWA 3THWA 4CIDA 4W5HA 2FZ4A 2J0QA 4OQMA 5FPYA 4CF7A 5JI2E 1OHHA 2FG5A 5JCZA 4N3NA 4JT4A 1R5NA 1U94A 3W6PA 3K8YA 2C95A 1OSNA 5FL3A 4R2IA 3SHFA 2ERXA 2BBTA 1OE0A 2CNWD 4BWYA 4MYHA 3C4JA 5EUMA 2J7KA 2FH5B 4RZUA 1Z63A 4ESVA 4L15A 2ZE8A 1KSGA 4WOPA 1HT1E 2JLUA 2WSMA 2J0UA 4AI6A 1ZNWA 2V8OA 3R7WA 2IT1A 4B34A 4CRWB 1D2MA 3PQCA 2C9CA 2VP0A 3VHLB 3VMFA 2WBLC 2O0KA 4A15A 1OLOA 2BJWA 2ODNA 2CXXA 1P2TA 3W9YA 4F92B 1D2EA 4UNQA 2XX3A 4M9QA 5FOSA 1ANKA 1Z6AA 4TYYA 2VIIA 2P67A 3GCGA 4KCGA 1XU4A 1RVDA 1CIPA 1ESMA 3ZZTA 3LA6A 3NBXX 5J4KA 3TVTA 4HZUA 2F1JA 4EKDA 1IXRC 1GAJA 4B71A 3QPWA 2O8EB 1G3UA 1KSHA 3AF3A 3U7FB 4JVSB 1YR8A 2GK6A 2B6HA 4XD7D 1TL7C 4GDFA 3MWLA 3CPHA 4KSBA 4WXRA 1Z0IA 2XOKD 1RZ3A 2DWQA 1UKVY 2VHJA 2PEYA 1FQJA 2QI9C 3I61A 3A6PC 2OFXA 2JJ1D 3MJHA 4DZZA 3SDZA 4HLCA 1KK2A 4NU0A 3AKDA 2YYZA 3AP2A 3QI2A 2DWPA 3B1WA 3T1TA 4GRAA 1II8A 2ZUDA 2QP9X 3VKGA 4M53A 2CK3A 1X8JA 4KU4A 4M9XA 1M6NA 1R2QA 1GL9B 2P3SA 1IQPA 4CDGA 5DNYB 4DSOA 1E2IA 3WHKA 3OEHD 4NMMA 4PR0A 3EW9A 1OXVA 3VR5A 1Y3AA 4B32A 4HUQB 2QE7A 3CRW1 4PPNA 3V00A 2O8CB 2R9VA 3EASA 3Q9LA 1JB1A 4B6FA 2QT1A 5D3QA 2XGJA 2ONKA 3MCAA 5EXPA 1W2HA 4A2PA 3TSOA 2E87A 2DPXA 5LPNA 2O0JA 3KXIA 3VTKA 2F55A 3NIBA 1TF5A 2CL0X 3JZMA 4PC3A 3MAAC 4UXHA 5CJ2A 4EQ6A 4NCIA 1Q1BA 4RZXA 4HAUA 2PBRA 1M8PA 2ZRHA 3FVQA 3R9IA 1N5KA 1EFUA 3PUYA 4QKQA 4US2R 3KDSE 2JLQA 3UK6A 2ZS8A 3CF2A 1G291 1F60A 4O2LA 1IY1A 4OYHA 1IN7A 1T6NA 4MITA 4B6EA 2YV5A 5F2EA 3U5ZB 2ZAMA 2J1LA 1Z5ZA 4N0DA 4M1KA 3DZDA 1E94E 3IO5A 1GITA 2C8VA 3GP8A 1YR7A 2H8KA 2QZ4A 3BE4A 3REFA 2H57A 1Z0FA 2OG2A 4PSAA 1XEWY 4HZUB 2O8DB 1U8ZA 2CL7X 5JS7A 5GJVC 1D8TA 1XXHB 4BFWA 2B21A 4EJSB 5FBVB 1FX0A 4AG5A 4KLNA 2GNOA 2ASEA 3CUEF 3RS4A 4DJTA 1AQUA 1IXZA 3GJ5A 2LKCA 3DDCA 2O8EA 2FF7A 2QP4A 5JJIA 1G64A 4JVNA 1NRJB 1RRFA 4PZYA 2A5YB 4URUR 1KSJA 4C0JA 3GQBA 5DHAA 5L3SB 3K0CA 3TAHA 5HE9A 3SN6A 5KOYA 2QTFA 4LYFA 1RPZA 1OB2A 2DB3A 1G6OA 1R6BX 1ZM7A 5H70A 1PV4A 2XSZA 2CLCX 2L0XA 3B60A 4D2IA 2R2AA 4BASA 2ZJZA 3CNLA 2HYIC 4DLYA 1S9DA 4B3CA 2PCLA 1NVXQ 1VIYA 1BMFD 2QPAA 2JEOA 3HR7A 1UM8A 1K8RA 3UATA 1KO5A 3EG5A 4C0QC 2VF7A 1N6LA 3C7KA 1IY0A 4B74A 1AM4D 2GA8A 2DWOA 1ZINA 2BBSA 1VG9B 2IWHA 2ZRNA 3WP0A 5BWMA 4IOMA 4QJ5A 2AWNA 3UXMA 3MD0A 1UJ2A 2GZAA 4BUJA 5FTJA 1P72A 1A1VA 5C4GB 4LV5B 2YOFA 1NSFA 2NIPA 1E3MA 2WKPA 4F4CA 2OZEA 2FWRA 4PHTA 2ZRJA 1AZTA 3AUXA 4NONA 1HURA 4IOKA 4D4MA 4DSNA 4JJZA 4M22A 3A58B 4I81A 5K8LA 4DLWA 4YXWA 3GFPA 1HE1C 1T0JB 2FSFA 2ZSAA 3L0SA 3LLMA 4MRVA 1QVRA 3ZVNA 3KJHA 3KJEA 1O3YA 2QRZA 4PAOA 4BFVA 4P3YA 1VDZA 1XZPA 1AGRA 3N2EA 3B2EA 2IYVA 4IVQA 1ZD1A 1M7HA 2IYYA 3AF2A 3NG1A 1UDXA 1CTQA 2P5TB 2ZYVX 2JA1A 3KQUA 2ANCA 2HXYA 3CPEA 1US8B 3T1VA 1G18A 4L9WA 1SHKA 1NKSA 1OB5A 4DCUA 4WA7A 5FUYA 5P21A 2V4ZA 3WHLA 5LD2C 1NVVR 4RJLA 2RGNA 2JAQA 2RHDA 1KO1A 4G5QA 1QHYA 4Q1BA 3CWZA 5KU1A 4JVLA 4OQFA 5AJYA 4PZLA 5JCPA 1WA5A 3MJRA 1RIFA 3FKQA 2JIZA 2QSZA 1HTWA 1O87A 1RKBA 3VR3A 3ZYCA 5JHGB 2XB2A 4XWKA 5JJKA 3CPJB 3IHLA 5SZKB 2HCBA 2C5LA 5KHOC 1Z06A 3B13B 5IF9A 1QBKC 4DUGA 3EC1A 3AVXA 1KMHA 2BEKA 2IF0A 2R62A 2Q3FA 1TX4B 2IXEA 1BKDR 2BC9A 1UPTA 1L7VC 2EWWA 2XZOA 2WOJA 4JSTA 5A4JA 2BM0A 2VTKA 1AJEA 2ZU0C 2BMJA 1W4RA 1AIPA 2UZIR 2NO7A 2Z43A 2G0NA 5DIFA 2QM8A 2ZM5A 2F9LA 3TUIC 4D4JA 1G20E 4LHWA 2R6DA 5D3MB 2FX3A 2BMDA 2SHKA 4A92A 2YZ2A 5AR1A 2A5FA 1E99A 3GLHB 5H1YA 5BN3A 1KO8A 2I3BA 5F3WB 3D3QA 3KTAB 1XD8A 2RGBA 4K81B 1X6VA 4DBLC 1MO5A 3IGFA 4P0TA 4QJ3A 5H8WA 3P20A 1N5JA 3D8BA 3H86A 3ZS9A 4JLDA 4ZDWA 621PA 1RJ9B 4L8GA 5EP4A 1ZC3A 4P33A 4MUBA 3EZ2A 1S1MA 2REBA 3EZ6A 4MKIA 2HXSA 2R8RA 1ZD9A 2G83A 1LB1B 4V0ME 3ETLA 1II8B 1LS1A 2ODEA 4PAQA 4Q7KA 4HB3A 1KJWA 3ND8A 4R98A 3U4QB 2WIAA 4ZCIA 1W36D 4XJXA 3CZQA 4CW7A 2BDTA 3AF0A 3EIHA 3B1VA 4QRHA 4HLQB 4OJKA 1R4AA 2JJ2A 2VRWA 4O25A 4TT3A 1W4BA 3RS2A 1CRQA 2ORWA 4H1VA 2VLIA 2X2FA 4P32A 4OK3A 4B48A 5FUWA 4I1OA 4Q21A 4U5XA 2QTHA 4I1VA 3RLFA 2F7SA 4RD4A 3K0FB 3FMPB 4LBYA 4EPRA 1XXHA 1J8YF 1P2SA 3PUZA 1OH6A 3QXHA 3AP3A 5KO2A 4LHVA 1JAIA 1ZCAA 2V9PA 4QGGA 4LJ7A 3ZVLA 3LRPA 5DH9A 4DB4A 3CM0A 1R0YA 3PUVA 2D2EA 1JR3D 1Z0KA 2CCKA 3F5FA 3W34A 2QQEA 3SFZA 4CYMA 4Q18A 4BZXA 1CR1A 2W6ID 3K0FA 4FN5A 2WWGA 4G5SA 3LNCA 5FR2A 2FGKA 1GUAA 3FWYA 3VR2A 4Q00A 3QEJA 3QOFA 2IX3A 2BM1A 1FUKA 5FTKA 1ZJ6A 1DO2A 2JDIA 5HCNA 4C30A 1OFIA 4NPHA 5G41A 2FGJA 3I1FA 4Z51A 2W2TA 3GJ3A 3PEUA 4LGMA 3M0EA 4TTPA 5JSZA 3OE7A 3QKSA 3TAUA 3O8CA 5E95A 4HDQB 4CEIB 4A8JB 2PT7A 4OJQA 1P73A 5DYIA 4LHZA 421PA 1H8ED 1AKYA 1CR2A 3C14C 1V5WA 5BQ5A 1ZAKA 1NLZA 1J99A 1HYQA 1U9IA 3L0IB 3P32A 3ZD7A 5KDDA 3H1TA 4KHZA 4EPVA 1MRSA 4D80A 5ANRB 1XPUA 2V6JA 2VL7A 5L3QA 4Q4LA 5EE3A 3Q3JB 1E9RA 1SKYE 3OEHA 1MV5A 3G0HA 2XJ9A 1SKYB 2A7QA 4HDOB 1W1WA 1UKZA 2OO7A 2RMKA 2ORVA 2WSSA 5EXTA 1Q1ZA 2W83A 4LYAA 1E9SA 4LC0A 1OIXA 3W6OA 1E96A 2ZI9A 1SVKA 2D7DA 2ZQ5A 3LLUA 1M34E 2PH1A 3M6AA 4F4IA 1OXXK 3KQKA 4FWTA 4CGZA 1N25A 1QF9A 4Y0VA 2PT5A 4FMDB 4L4UA 2O0HA 4URVR 1QVAA 1AN0A 1J70A 1KAOA 2QA5A 3OIYA 1EX7A 1NNEA 3KFVA 2J46A 3LX5A 2ZAOA 4JL8A 2ZUBA 2GTPA 4YMTA 1DBSA 3E5HA 4GSYA 2GCNA 4OQXA 2BCJQ 1WE2A 2ZJOA 4Q4JA 1G5PA 3K0SA 1UBGA 1Z8FA 2GJSA 4M1YA 4RCYA 4A6XA 3TJZA 2AD1A 1R10A 1T4GA 4NYIQ 1P9WA 1RW4A 3GJ0A 4ZKDA 1XEFA 3VU9A 4B3FX 1QZXA 2JLVA 4US1R 3BBPA 5JWRA 2C04A 4YDSA 1QHXA 2IWRA 3HP1A 1N3BA 3PR1A 3K0AA 5KSYA 5L8VA 1D5CA 1QRAA 2GVDC 4C2TA 4PSKA 1G7SA 1TUEA 2WWFA 3AKEA 2QNRA 3U6BA 1W4CA 4A36A 4F93B 1KSFX 2NO9A 2DHRA 1T8TA 2HYDA 3A1VA 4BGDA 1E2DA 4KITB 1US8A 2IXGA 1OFHA 1XCPA 1XEWX 4S35A 4ZDIA 3FMIA 1W7AA 1ZM9A 1E9AA 2R65A 2D7CA 3TE6A 1LNZA 1IAQA 4B3GA 1SXJC 4B47A 4EUNA 1ZBDA 2O8BB 4BE7B 3ICEA 4UJ5A 3RANA 3IO3A 3EARA 3B1ZA 5LB4A 4NH0A 3SHWA 1XCMA 3FGNA 3KB1A 4C0AC 1X1RA 4IOLA 2PX3A 5E7IA 1KI7A 2W0SA 3Q5DA 1AGPA 5K8UA 3V9PA 3U7GA 3THYB 1GL6A 1XXHE 3SYNA 3F3YA 2FFQA 3EA0A 1XMJA 1KO4A 1OT3A 2ZRKA 4KFSA 2C9OA 2P6RA 2JLYA 5AJZA 1CF4A 2XZPA 1VPLA 3BRWD 2Q9BA 3K09C 1OV4A 1FMLA 2Z5FA 4OHVA 3SS8A 4HLUC 2JLZA 1U0JA 4X8OA 3WMEA 5B2ZA 2NPFA 2GJ9A 5FOTA 3SR0A 1JR6A 1DAIA 3FOZA 2CL6X 4QGAA 3A4LA 1KIMA 1G3IA 1SXJA 1RRCA 4V0MA 1GRQA 1ZU4A 1Z47A 4Q4AB 5JS8A 1ZRHA 4J0QA 2IHBA 4DUGD 1W0JA 4G0NA 4C4PA 4BFZA 2C78A 3KZ1E 3PEVA 5CLLA 3AV0B 1JXOA 2ZANA 4HLDA 1U9IC 4ZDKA 1QHNA 4HAZA 2JLSA 2FSHA 2ZVPX 4HUQA 3G82C 1A4RA 3OIWA 4OI1A 1SULA 4IOJA 5AUOB 4D0GA 4MRSA 3EPHA 2C03A 5K8TA 3BC1A 4A9AA 4TL7A 4QGHA 3L8YA 1AS0A 3LD9A 3T5GA 1UKEA 4XOIA 1N6RA 4Q48A 1WRBA 4IXMA 1PZNA 4XVUA 4CVNA 1G3RA 1MR3F 4TT3D 4BLPA 1M7GA 2VHTA 5FFMA 1Q3TA 2NO0A 1YE8A 4Z8YA 1VKJA 1OFTA 2QMOA 1EX6A 3AQ4A 4TLAA 2QROA 4AC9A 3AH8A 2MSEB 2B8TA 4AY2A 4PQYA 3IDQA 4PZZA 4FMCB 3KTAA 3SI7A 1IJEA 4OK6A 5C2JB 3CF6R 4LJ6A 1YKSA 1WBBA 1CJUC 4P4SA 2GZDA 3QKRA 3GMTA 5HR5A 2QTVB 3WP1B 2OHFA 3NH6A 3HWSA 1K6MA 4OQNA 1YR9A 2GF0A 4PHFA 4TTQA 3W3AA 3VR4A 4JZKA 1NN1A 3UPUA 2V7QD 1CJVC 1YVDA 2G77B 4DLVA 3CKLA 1FNNA 4WZBE 4URZR 2RGGA 3BXZA 4Q9IA 5DLQC 1W46A 1T3SA 4LJAA 1T5IA 3NHAA 1FMJA 1Z0DA 3LBIA 5EXXA 3WY9A 1C1YA 2IHYA 1G41A 1KO7A 1TU3A 2VP9A 3TK1A 2CCJA 2IXFA 4Q01A 4NCNA 5CIWA 2QAGB 1IONA 1XF9A 3MRSA 1ZIOA 2JLRA 3T12A 3TW8B 4YC7A 4PO9A 1XNJA 2QENA 1E4YA 1TTTA 1PUIA 2A3RA 1MRNA 4C0SA 3O8DA 5AWFC 1KI6B 1SXJB 3OFND 2JATA 3ZVRA 2G3YA 4L9SA 1FP6A 2G9NA 4YMVA 1LVGA 5KUTA 3LQRA 2O8DA 1VIAA 1ETUA 2DY1A 2EWVA 1Q1EA 1GSIA 2C9YA 2WAYA 2AHOA 3QIAA 1QG2A 3DVLA 5BN4A 2ZXUA 4V03A 4YMWA 2WJGA 5TB5A 2V7QA 2GEDA 3REGA 1CP2A 1OXSC 2QT0A 1G19A 2WSSD 3ASZA 3B5JA 5JSZB 4JJKA 2WZQA 3SNHA 1OW3B 1VHLA 1HE8B 5AJXA 1G4UR 3QXCA 2JGNA 1G21E 3LXRA 4BZPA 2XTZA 3RSLA 3RWMB 1G8HA 1NF3A 4G3XA 5EZ5A 2NZ8A 4Q02A 3IBGA 1Y63A 2QP3A 2YJTD 1EESA 1SVLA 1GTVA 3NKVA 1WF3A 4A1FA 1ZUHA 2GDJA 4P4TA 1RFLA 5IK2D 4EPXA 2CMKA 3GFTA 1EGAA 5JMTA 3NEYA 3QF4B 4C0BA 2BCGY 2CBZA 4HAXA 1U81A 2QEQA 1XEXA 2OSBA 1TQ4A 2PZGA 4B73A 1DADA 2CHGA 2Q6TA 3MLEA 5DISB 3C8UA 5K8IA 3K70C 1JXMA 1WB9A 1OIWA 2IBMA 5F98A 2GEUA 4OBEA 3M4YA 2J45A 5LB2A 2F43B 2FEOA 2JJ1A 3SQWA 2WMNB 3CH4B 1M7BA 4MRNA 3H2YA 3A4NA 4Q9HA 4PFSA 3RS7A 3WRXC 1HH4A 1W0KD 2ZPTX 1N6KA 4JLOA 1C4OA 2QMHA 1JPNA 1SVIA 3K0CC 2QMUA 3IEUA 5HZHA 1NVWQ 1CULC 3I73A 2HV8A 1G3QA 3BH6A 1U90A 1YZTA 4E07A 2X1VA 4DWJA 5CYPA 5AJWA 1N2CE 4A0FA 1U8AA 3SYKA 4QM6A 3VNUA 1TF2A 5J47A 4PC1A 1P2UA 1GKIA 1H8EA 2QE7D 1D6JA 1N6OA 2QG6A 2YINC 2OESA 2YWHA 3C5CA 2GK7A 5HZKA 2D62A 1NIPA 3VQTA 2AXNA 1IN8A 4FCVA 1BYIA 1WDTA 2DYKA 2FSIA 2QN6A 2ZJBA 2ZRMA 3AB3A 1A7JA 2QRNA 3BD9A 3H0KA 1UADA 2ZR7A 5EE9A 1N0VC 3GJ7A 2FN4A 1FOEB 3H84A 2OILA 3W6NA 2F9MA 4GNKA 5C4MA 5BN5A 4QHYA 1JJVA 1YZQA 1NP6A 4KO8A 4IKEA 1FTNA 4PC6A 2GAAA 5FTNA 1G8PA 2W6JD 4FD2A 2NPIA 3OHMA 3KQHA 5GJWC 5CIQA 1ESNA 3U61B 1IHUA 2ZTSA 1X8LA 1FX0B 1NMYA 1KY3A 4D81A 1T8UA 2WPDA 1VYVA 4PC2A 5EJEA 1TNDA 3QEOA 5GVSA 3T1QA 3Q8XB 4TSFA 1ZNXA 1UBFA 2UVQA 5CDFE 4OL0A 4AK9A 3C15C 4IEIA 3TIFA 2GBLC 2VHCA 1SVOA 3OFNA 1BOFA 4G5GA 1W44A 4V0OA 3SYLA 1XTIA 1G3MA 1CS4C 1PLKA 1S8FA 3RRZA 3T06B 1LW7A 1FP7A 1KI4A 3A8TA 1NBMD 2ERYA 2KJQA 3SBDA 8OHMA 5J4HA 1Q20A 2HT1A 1OFUX 3LBHA 4B43A 1S9HA 5L3RA 3PITA 2ZRPA 4W5JA 1MO4A 2AK3A 1W4AA 3BH7A 4OI2A 4RCZA 3T35A 2JIZD 3A36A 4V0KA 4EQ6B 2CEAA 3DEFA 4HAVA 2MMGA 3OIVA 4RKFA 4YQFA 1FNMA 1ONBA 3U7HB 3MSXA 3O47A 2BV3A 4IHQA 5CM9C 1E2EA 2IC5A 5J4VA 3GLGE 2OAQ1 2GWHA 4YXWD 1MOZA 3AVUA 4MGIR 5FOVA 4L5BA 4CEIA 3TQCA 4U00A 1ZU5A 4FIDA 4ASUD 3LX8A 1DARA 3K53A 1YU9A 5JHHB 1GDDA 1E2KA 4QC2A 4UJ3A 4TZ6A 2XITA 3A1WA 4NP6A 4UXIA 5DN6A 1LTQA 6Q21A 2GEVA 1R5BA 5TDHA 2V54A 1MKYA 3FTQA 4RD3A 2GCOA 1KI2A 3WYGA 4DHEA 4QBFA 3NBZC 3UWKA 1E0JA 4NCJA 3ZJYA 4US0R 1Q57A 4GOJA 3SQXA 1DAMA 4Q66C 3U3JA 3WNDA 4BEJA 4LSGA 1TUIA 3CB4A 5ELXA 3PCRB 4HB2A 4JLPA 4AYXA 5JBQA 3I5YA 1XTQA 3KKQA 1ZM2A 3BFKA 4ABYA 3U44A 3L0PA 3I8XA 1E2PA 3I92A 2KWIA 3BH0A 4QG7A 1Z28A 1CRPA 1E79D 4CT4B 4HB0A 2OLJA 3U3MA 1GILA 4PXAA 1TQDA 2K5UA 5FUXA 5JECA 2O8FB 4PPFA 1VCNA 4PQFA 3LW7A 2B7BA 4M4SA 3ASYA 3TVDA 3LAWA 2ZE7A 3DKVA 4DDUA 4OKSA 4MRPA 3AGPA 3GJ8A 4QHTA 1P2VA 3GFOA 4GPTA 4JBYA 1UEJA 3A4MA 1MABA 1XFAA 3NEJA 4JLBA 1I2MA 4B3DA 4GFDA 4DLXA 1W36B 1T9HA 3BORA 3CLVA 4GP7A 1G8FA 2ZIAA 1YZUA 3ND9A 4Q1FA 1ZCBA 5FH9A 3NDBB 1G8GA 4B35A 3CX7A 5KSPA 3FHTA 2JLWA 4BFSA 3AVOA 5TMPA 1EFTA 3SEAA 2OCYC 1ZUNB 1G7CA 2ZRLA 4PX9A 2WJHA 1NN5A 2OLKA 4U02A 5FI0B 2WOOA 2KBEA 3L82B 3IQWA 1L4YA 2CVHA 1T0HB 2WPDD 4NYMR 4M1SA 4UQOA 2ZVQX 1E2MA 2ORIA 3I62A 3UIEA 5EP1A 2N42A 2IS2A 5FBWB 1CU1A 2FOLA 4D0LB 3EZ9A 3F8TA 5FL7D 2DCUA 5GADl 1JAHA 1XTJA 4IDNA 2UZ3A 2BWJA 4B2IA 3BGWA 2WWWA 1PUJA 1ZIPA 3M1IA 4Q1CA 4BRUA 1XJ0A 4M9SA 1OKKD 2ZRCA 3B1XA 3NDPA 5CK5A 2AFHE 1F6BA 2G0TA 3THOA 2MSDB 4DDVA 2IA5A 3FKSD 5FPHA 2GESA 4R9UC 1N6IA 4F38A 1U2RA 5J4YA 1SZPA 1FL9A 4KLZA 4QBHA 2A78A 2A5DA 4OHWA 4HATA 4GL2A 1HA3A 1QG4A 2J5XA 1MT0A 3GLIA 1W49A 1F3OA 3DOFA 2DFLA 2WM9B 3FFBA 4I99A 4AKEA 3KKNA 4QNMA 2XNSA 2W58A 2CCGA 3WMGA 2GF9A 2QGNA 2OE2A 2O5VA 1I2DA 4B2LA 3X1ZA 3WYFA 2G88A 3HPRA 4XVQA 4A4DA 3KXLA 2FA9A 4KBGA 1MABB 3ZZUA 2RGCA 4TMKA 4QOSA 5JEEA 5FUVA 1KJYA 4ZPXA 5FPTA 5EUQB 2AKAB 4W9MC 2ZRGA 2AWOA 2X2EA 3Q7QA 1IXSB 3KKOA 3AM1A 1CJKC 2RB4A 3HU1A 3TW4A 5D3MA 1E98A 3GLFA 4EPTA 1H8HD 2XNDA 1VHTA 1R0XA 5J4LA 1KOFA 3K09A 3SJZA 5HPYB 4KVGA 4ZCLA 2P2LA 3NBYC 2C99A 4IDQA 4KFRA 4MRRA 1IBRA 1Z6GA 3NHBA 1TADA 1B0UA 4Q4HB 2BBOA 4LJ8A 1KNQA 2VP5A 3BS4A 4C3ZA 221PA 2H5EA 1NVUQ 1CJTC 2GJ8A 4DDWA 1UF9A 4LDJA 4ON9A 4KJZA 5AK0A 5IRCD 2NQ2C 3ZVMA 2ZREA 4ZO4A 2J9RA 2FPKA 2VHUA 2VA8A 2VPPA 2ZRAA 4TQUS 4P4UA 4WZAE 3QG1A 1Z6XA 4IVPA 1XTKA 1BH2A 5HKKD 3R7WB 4AYWA 3CWQA 2HLDD 4B44A 2QBYA 2H1LA 2CJWA 3RRMA 1F2TB 2ZJYA 2KBFA 4JLKA 1XPOA 2CE2X 3CZPA 1X86B 4DEXA 5KSZA 3DL0A 4A6PA 3EPKA 5B57C 3THXA 4TLEA 1OYYA 3IIKA 3K0AB 1SHZA 2VP2A 5BYJA 1G17A 3KL4A 3OESA 4KXFB 2B7CA 4CEJB 4D0NA 2RGNC 1PLLA 3SE0A 2I1QA 4Q1EA 1D9XA 3EA5A 2FDCA 4FMBB 3VFDA 3QE0A 1VG1A 2PLRA 2Q9AA 4D82A 2WJYA 2F43A 4ARZA 2GKSA 2PMKA 4IW3B 1N0WA 2FZLA 3EC2A 1VMAA 4EJSA 3DKPA 4YDHB 3QVUA 4V0NA 1PJRA 2C77A 4QJ4A 2DFNA 4DLTA 3UG6A 2OXRA 3VHXA 1XD2A 3TR0A 2X8AA 3ZGXA 1II0A 5DN6D 5EXSA 4I1UA 1D2NA 4DXAA 1R0WA 2PZEA 1E9BA 1NMXA 1ELOA 1Z2AA 3IIMA 5E3HA 3GLFB 1A2KC 3B9PA 3GLFE 3W8RA 5L3SA 2F3TA 5JWHA 3KB2A 1RYHA 4DSTA 2QAGA 1OKKA 2EFGA 4C7OA 2MSCB 1R8QA 2AFIE 3LV8A 2ZETA 2HT6A 2ZSBA 4EPYA 4R71A 3CX6A 1HV8A 3TSZA 3PIRA 5EZ6B 1UAAA 4LPSA 4S2EA 3SU8A 2XXAB 2Q3HA 4DSUA 3PFIA 4AIIA 1OF1A 2V1UA 1T3HA 2OBLA 1YJ5A 2B8WA 2PZFA 5FBRB 2ZRIA 4ILEA 5FOWA 4BLRA 2LKDA 3Q5EA 1HQCA 1W2GA 4WIAA 1J7KA 3NBFA 4PPGA 2C98A 3WBJA 4UNPA 1RYFA 4Q7LA 4XWAA 3HYTA 4E22A 1XB2A 2REXB 4YONB 1CR4A 2XZLA 3T5DA 1HT2E 2VO1A 4GBMA 1NI3A 3B78A 5KDLA 2ZSFA 5J40A 3QBVA 2OUKA 1TU4A 1KDRA 1LF5A 4LCBA 4PHGA 5C1BA 1KGDA 4Z54A 4H1UA 1GKYA 4BEBA 2Q21A 2CHQA 3JVUA 4MYTA 2CHVA 2W0MA 4FWIB 2FV8A 1OXTA 4JKYA 2J0VA 1DAKA 2GCPA 1Z6YA 3QF7A 4RD1A 1LS6A 1VYTA 1RRPA 2FU5C 4LHYA 1W0JD 121PA 1ZUIA 4GOXA 4LY6A 3RS5A 1KMHB 3OEEA 5BXQC 2J87A 3FMOB 4AWXA 1K5DA 4EPWA 1KZGB 2FE4A 2WVJA 3RNLA 4XSGA 2WWYA 3PXGA 4BZQA 3EZFA 2F1HA 5JRZA 1G7TA 3Q7PA 3LQQA 2OCAA 2NZJA 3RRYA 4M1MA 3VX4A 1GKUB 1LY1A 2EVWX 4D4KA 1TEVA 1XDBA 4G1UC 2WWXA 2YC4C 1DEKA 4LUCA 3CIOA 5DI3B 2P0EA 2YVUA 2PLFA 3ICQB 5CDFA 3FPAA 1TAGA 3ZIAD 3BFXA 1P9NA 2ZITA 3GLHE 4P4SB 5FI1B 2HLDA 3IPXA 4C0KA 4ZV4A 4TL6A 4FXPA 3CH5A 3MG9A 5CYOA 2D2FA 1S96A 2GJKA 1Z6TA 4LV8B 3BJIC 4YMSA 4M2LA 2YHSA 2FFBA 2I4IA 1KMQA 5H68A 1GNQA 1ZD8A 2R44A 5EP3A 3UG7A 5KYKA 2O8CA 2O52A 1E1RA 1JECA 2EYUA 4FMCF 3MWJA 2DFTA 4JYBA 4TQ9A 2BMFA 4D25A 2REOA 3QPVA 3I32A 1RC8A 4R2HA 2F3RA 3VAAA 1GVNB 4MYUA 2F1IA 3K9HA 2DR3A 3KUCA 3G5UA 3LDAA 3DMNA 4B75A 5AUPB 1SKQA 2EYQA 3IEVA 2PCJA 1NKTA 2P65A 5G3ZA 5F9HA 2AN9A 5EE1A 3HDTA 4ACAA 3W90A 1KI8A 3ZQJA 3QVVA 3PEWA 4QNRA 3EPLA 1Q1QA 3EAQA 2ONJA 2IYZA 1GNRA 3HU3A 3B82A 4JS0A 4PO1A 3V4RA 1CKEA 3D7MA 4M8NE 4LJ4A 3N5CA 4LWZA 4A8JC 4NCHA 1ZMXA 4MH0R 4Q9KA 1FZQA 3A1SA 4GOKA 4D26A 2NO1A 3OZXA 4FCWA 3MUFA 4DVGA 2GETA 2GXSA 3SJAA 2ZSDA 3J81k 5TVKA 2Q9CA 2ZJAA 3FMFA 4DIDA 3RC8A 3HJNA 3ADKA 2ANBA 4URXR 1I4LD 1AS3A 4NBSA 4M1TA 3L8ZA 2FSGA 4Q1AA 4EAQA 1P4SA 2QY9A 5JRJA 4Q4AA 2P5SA 1NSTA 2ZS9A 3GLHA 2NG1A 3DZ8A 2IS6A 4MKGA 4BFYA 2QORA 4JLNA 4ASUA 5KSOA 3BIFA 3QXSA 4TYQA 4ZDJA 3QQ5A 3QSYA 4DCSA 1NN0A 2W2VA 4RFVA 3RC3A 4MKFA 4JSYA 1KZ7B 1V43A 4XSHA 4C9BA 4KVAA 4LK2A 4WBSA 3FYHA 4QXAA 4M1OA 3KJGA 3MGCA 4NKRA 1R0ZA 2ZU6A 4JIMA 5HKKA 5KNBA 1NY6A 4TYWA 4A8JA 1EFRA 1J8MF 1NLYA 3BB3A 2ZI5A 4XD7A 2W6JA 2NTYC 1XCGB 3KXKA 5DI3A 5FBLB 3SJBA 1ZYUA 1KDPA 3QKSB 1DO0A 1E1QA 2QM7A 1LV7A 3CRQA 3LO5A 4LPKA 5JZVA 3TUZC 2GVZC 3C16C 4IFEA 4CEHB 2NMVA 2BIFA 3GLIB 4B2PA 2EU8A 3P1JA 5GJBA 1W5SA 2QPOA 5FPSA 2H7VA 3FHCB 2IYTA 3BOSA 1DS6A 1FPMA 5IK2A 4DEYA 2ZR0A 1KTVA 2JJ8A 2ZRDA 4A2WA 3CR8A 3ADCA 1Q0UA 1WP9A 2FFAA 2YWEA 3K1JA 3VKHA 1CR0A 4AYTA 4AKHA 1DG1G 4DC9A 1NL3A 4X8LA 4A0RA 1QDEA 4WZ6A 2IF2A 4IRUB 4CZ2A 1XMIA 1F5NA 3AVVA 4W7SA 2JASA 2AD5A 3VU9B 4V0LA 2GJAA 3LBNA 4E09A 4MDEA 4OHZA 1DE0A 1E0SA 2EQBA 1E2LA 2WJVA 1E69A 2WV9A 3WNCA 1U99A 3KX2A 1KI1A 4ZCMA 2QPTA 2Z6VA 2W2XA 5SZIA 4O3MA 4TL8A 4LX0A 4GZLA 4Z1MD 1XP8A 4PQRA 1IN6A 5B64A 1FQKA 1H8HA 1YRBA 2XNDD 4P31A 2ZI4A 3AEZA 2KE5A 2X77A 4Q9LA 3OF5A 2QAJA 1Z07A 4KYIB 3RAPR 2GILA 3VKWA 2YOHA 2IL1A 4TSFD 4BLTA 4NYJR 5BYKA 4WVFA 2QGZA 1TEXA 2I1VB 5CB8A 1QHHA 3K9NA 4TLDA 2EFHB 1KDTA 1JJ7A 2OBMA 1VG8A 4PO8A 4BLQA 1DELA 4QFMA 4JYCA 3X1XA 1P7CA 2XB4A 2C96A 2FPMA 3QPUA 4FMDF 2ZJ2A 3EIQA 4PAMA 4KFTA 1NBMA 2ZS7A 5SZHB 3PUXA 3LW8A 4PANA 4ERNA 1COWA 1OIVA 3QG5A 4YMUA 3FFAA 1NBME 2AK2A 2PEZA 4JT2A 1ZM4A 4I1SA 3O8RA 2CLDX 1YZNA 3CRVA 4RZ2A 1VG0B 2P6UA 2H18A 2ZYTX 3U44B 1DG3A 2LCFA 1OH7A 1P6XA 4Q7JB 2JLXA 4FCTA 4GI7A 3PUWA 4QBIA 1KI3A 1AQYA 5CJPA 1VECA 2OFWA 5FTLA 4UNSA 4LRWA 3BAFA 3QENA 3U6KA 1L2TA 4NYJQ 4DT1A 4ZIRB 4CEHA 2ZRFA 3ZQ6A 3EX7C 1WQ1R 2ECKA 3IQXA 2QU8A 4K46A 1ZNYA 1E6CA 4IDOA 3AKYA 3DM5A 4QL3A 2D4HA 3P26A 3RVBA 1SVSA 3X1DA 1SXJE 5DGXA 4M0LA 4BECA 1AS2A 2FNAA 5TARA 1XBTA 4QBGB 3SBEA 3KQLA 4JLJA 1GRRA 1QHGA 2FMXA 5HCIA 3P4YA 4HSEA 3W5IA 4ZI3A 1YHNA 1QHSA 4AKGA 3E70C 3IILA 5GJCA 5KNCA 2N46A 1KNXA 3QXXA 4II7A 1NG1A 1XJCA 2Q3MA 1COWD 1JNYA 1CLUA 2CNWA 2J41A 4UXJA 3ZIAA 3TLXA 4JL6A 3LVQE 1K5GA 1E79A 4HZIA 1VCMA 5IDVA 3CR7A 1NY5A 1UDWA 3MWYW 1KDOA 1NLFA 2A9KA 1UBCA 3CF0A 1ZC4A 3IUYA 5E4FA 3TBKA 2ODBA 4NCKA 3RDPA 1JI0A 1JEEA 3QKUA 4AG6A 2PMDA 3U60B 1GRNA 3GLGA 2GXUA 4RFSB 521PA 1IN5A 3GJXC 1Q44A 3THYA 3HU2A 4LC1A 4Q1DA 3LFUA 2BVNA 4TMWA 3WRYC 1NJGA 4KODA 4X8HA 1E1RD 1NJFA 4RY2A 3AVWA 3AUYA 3I72A 2HUPA 1E9DA 2WKQA 2GBLA 2V6IA 4NHOA 2RHMA 5AUNB 2CVFA 1WBDA 3RHFA 4LJ5A 2HF9A 4LJYA 5AJVB 1GP2A 3T34A 1E0KA 1D9ZA 4D6PA 1E0AA 3LXXA 3ONWA 3KUDA 4DCNA 2ZJ8A 5DE3A 4RD0A 2ZUCA 4TTRA 3JZAA 5UKDA 1FW6A 2R6AA 2RH5A 2CE7A 3QF4A 2PL3A 1M74A 2KB0A 2UKDA 2GCOB 3HR8A 1E9CA 2IYSA 3E2IA 4QM7A 2J3EA 3ZS8A 4OQLA 1Q21A 4LYHA 4LV6A 3RRNA 4MQBA 3CNNA 2YKGA 2WAXA 2YC2C 5JLJA 4NZYA 4ITRC 4TMVA 1J2JA 1P60A 1Z83A 4PTLA 5KPJA 2GRJA 1XJQA 5M04A 1JPJA 3DPUA 1W48A 3NC1C 2FJUA 1G7RA 1U0LA 1PVOA 2OCPA 1AKEA 4LOAA 2TMKA 1U0HC 2ZEJA 2CDNA 3EIEA 2HEIA 4IDPA 3TNFA 4CT5A 3V4FA 1XTSA 1VCIA 2R6FA 2X19A 2BJVA 5FOUA 4HAYA 3QNUA 3I3SR 1G6HA 2LWIA 3CBQA 2E1RA 2XTMA 3TR5A 1YQTA 2OEPA 4B76A 4G5RA 1SVMA 1I4TD 4IDHA 1P3JA 2IK8A 4E5UA 4YLGA 5C18A 2IYQA 1P62B 4O0MA 4PHHA 3PV0A 1DAEA 1S3GA 5TXGA 3IIJA 3T15A 4HUTA 3P4XA 3TKLA 1Z29A 5CM8B 1EXMA 5J5CA 3R8FA 3QY0A 1GNPA 1M1YE 3WNBA 1R5OA 1T3LA 3WYAA 3ZH9B 4MKHA 1ODFA 4NL4H 4MGYR 4OHYA 1S3SA 3TQFA 1JQJC 2A2ZA 3Q85A 1YR6A 1FFHA 1IJFA 4K8OA 3KFXA 3UMRA 4E03A 1KJZA 3AVTA 2VSXA 1WXQA 3NWJA 1SVWA 1DVRA 1AA9A 3K0EA 1E2QA 2BMEA 4Q4JB 1IOZA 4XTRA 3VR6A 4RFSA 4DCTA 1LF0A 1OHHD 4B3BA 1G16A 1DAHA 1E2GA 2F6RA 3TH5A 4TYPA 2WICA 2ZE6A 1E9EA 3DOEA 3RWOA 1HQYE 1W0KA 1XD9A 5E7JA 2GAOA 2OCBA 1VCOA 4POAA 5JI3E 1H65A 1M2OB 1Z2CA 4A0GA 2BHRA 5G53C 2OT3B 4KBFA 1E2HA 1VYUA 1S0UA 3R8CA 4F4JA 2JCSA 3E1SA 4C2UA 1E2JA 3F0TA 1N6PA 4IVRA 5G3YA 5IT5A 1U8YA 4NE2A 4Q7MB 3RYTC 3B8HA 1OYWA 4JLAA 1KY2A 3B7GA 2N1BA 3WMFA 2VP6A 3LWNA 4KI0A 4LZZA 3TGPA 4TQAA 4RVCA 3B1YA 3N70A 2CK3D 4XH9B 3I4LA 3PVSA 3CX8A 4A0HA 2O8FA 5DO9A 5LBIA 5EE0A 5FL7A 4M1WA 3B9QA 1BO6A 2F1RA 2WJJA 1F2TA 3DMDA 4IFBA 5FBQB 4EJSC 1C9KA 4LJ9A 3K70B 2J0SA 3NTUA 3IHWA 3U4QA 1N0UA 2RCNA 2XOKA 2D3WA 1XWIA 5LD2B 3ZDQA 3C5HA 3ADBA 4QHSA 2BKEA 4LYJA 1MO3A 1IY2A 3VNVA 4MA4A 2GXAA 1TF7A 1WCV1 2QQ0A 4G01B 2RGAA 1IM2A 1F48A 1KYIA 3UANA 4NYIR 4RKEA 2HCJB 1GM5A 3T1OA 1Z3IX 2ZRBA 3RABA 4BLOA 4BFUA 5DYGA 4IJMA 4JKIA 4LBVA 1T5LA 1UFQA 4RZ3A 3X1WA 2HDNB 4TYNA 4NTZA 5DSZA 2EFDB 3L0OA 1JR3A 4A2QA 3JVVA 5EE5B 4CEJA 1FTSA 1JEDA 3H4MA 3OIUA 3AF4A 1E9FA 2OXCA 2GXQA 3THXB 1E2FA 1EG7A 2IUUA 3BWDD 3IPYA 2MMCA 2ZYUX 3A1TA 3K9LA 5SZJA 4I4LA 4IEEA 1Q3HA 3DM9B 4MGZR 2J7PA 2Z4RA 4NDZA 4HEJA 1GG2A 2ODWA 3DHWC 1NN3A 3KQNA 4ZI2A 2VSOA 4WAUA 1XD2B 3S1AB 3GEIA 4RD2A 3AF1A 1G4AE 3FKSA 4B33A 1L8QA 2A30A 4LBZA 4GP6A 3LY5A 1JQLB 2XAUA 3MFYA 4C0HA 4XWOA 2XJ4A 2WHXA 4RSGA 2IUTA 4JLMA 2PJRA 3A37A 5L3VA 3FHOA 3EWSA 3R20A 4KSCA 1NG9A 2E9SA 4TL9A 4BLSA 3X1YA 2RKOA 2H17A 1NVVQ 3L43A 4JVMA 4M21A 2ATVA 1SXJD 2QUZA 1G5TA 1QHHB 3B85A 1G9XA 3WBKA 1KHTA 1E4VA 2Q0HA 4R7ZA 5G40A 3OEED 2PJZA 1CXZA 4MUAA 4TMTA 1KK1A 1BMFA 2RGDA 1BS1A 3PG5A 1F2UA 3U3KA 3NH9A 1GL7A 2YNMA 3KJIA 3SJCA 4Z8XA 1PLJA 3AP1A 4C0LA 2QMEA 1DOAA 3WXMA 4TZ0A 1DAFA 2V55B 1P9RA 2YWGA 1KK0A 3IBYA 4RD6A 2CJWB 2QSYA 2ZI7A 3D31A 1A2BA 3FE2A 2WIBA 1Q12A 1ZW6A 5LDDC 4WXPA 1TMKA 1L4UA 1P61B 4UNNA 1IN4A 2W00A 1B23P 4N0EA 3U3OA 1AZSC 4W5WA 5FTMA 3OE7D 1F2UB 3SFVA 1XX6A 5IHPA 3SC3A 3TMKA 1EWQA 3IKJA 2BEJA 3GLGB 1Z22A 2IYWA 2KI5A 2G6BA 3LVRE 4FI3C 3TRFA 2VP4A 2QL6A 1KI6A 2J59A 1YZGA 2IW3A 2AXPA 4JL5A 1R7RA 2EFCB 1A5TA 1DAGA 1XRJA 5CK4A 5TV2A 2H92A 5TY0A 3SOPA 4C7OB 4PPQA 2NGRA 2W6IA 1UKYA 3BK7A 1W47A 3MMPA 3B6EA 1TPZA 4H9GA 4MDFA 4DCVA 1TQ2A 3EZ7A 5CB6A 1YZKA 3NVAA 1G1MA 2RAPA 4TWZA 2BOVA 4UNRA 5FPKA 4DB2A 1OJLA 2A5JA 3GLIE 3U3RA 2IS4A 2ZI3A 2YWFA 2OAP1 3GD7A 4TLCA 2VEDA 2QBYB 2ZJ5A 3R9WA 1Z0JA 5KNDA 4PSVA 2NO6A 2AL7A 5AUQA 1Z0AA 2ZE5A 4QGFA 2HJGA 4KAXA 2EFEB 4OHXA 1GWNA 4DLZA 5JEDA 5L3QB 4OI4A 2IEZA 3QKTA 2R6GA 3ZLJA 2WJIA 2QAGC 2WMOB 4DLUA 2IYXA 2FFHA 1S1CA 1Z08A 3L2OB 3AKCA 2IS1A 1OXUA 2XSZD 5F9FA 4ZKEA 1I4DD 2FEMA 1XTRA 2ATXA 4PC7A 1P75A 2VYFA 1CBUA 4D4LA 2VH5R 3CONA 3NXSA 2HF8A 1N6NA 2D06A 3U2QA 3BB4A 4BQSA 2ZR9A 1N6HA 2V1XA 3D6TB 2H16A 3ZZ0A 2DFKB 721PA 3DO6A 1XEXB 1HUQA 3X2SA 2IYRA 3QKRB 4DRZA 3RS0A 3EPJA 3QXJA 1YZLA 3KKPA 1G5RA 4LHXA 4GZMA 3BERA 2AX4A 4FINA 5JWOA 1EWRA 1GFIA 1R8SA 2IYLD 1DTSA 2WTUA 1OPXA 4V02A 4DT1B 5KDOA 2Z4SA 3CO5A 2G1KA 1RRGA 1E1QD 2WWIA 1SQ5A 1OH5A 1HEIA 1RJ9A 3UMSA 3FDIA 3RS3A 4KFUA 4Q9JA 1GIAA 1MO6A 2B92A 3ADDA 4HI0E 3GEEA 4TN1A 3HYRA 3EWAA 4XIGS 3U7EB 1CJMA 2OFOA 2OBNA 3LH5A 3Q72A 3O8BA 4LI0A 2C2HA 4Q03A 4B3XA 2Z0MA 1X3SA 2RGEA 2RGXA 3K9GA 1KK3A 821PA 3UMFA 1TQ6A 3TUJC 1UEIA 4GT1A 4Q19A 4DIEA 1DPFA 5JFGA 1N5IA 4F91B 4IXNA 5DI9A 4ZIRA
chains in the Genus database with same CATH superfamily
1Q22A 1T6YA 1XZQA 2PVCA 3RVNA 3T1NA 3D4LA 2I66A 2FI1A 3IR5A 4YJ2B 4KUEA 3ZK9A 5AVQA 4LX8A 2FPLA 4ESEA 2VSFA 3ZGVA 4G2NA 3OMWA 1XQVA 3CJQA 2CXSA 2FZWA 4PCAA 3ZWNA 3LLCA 4DADA 1AMUA 3PEYA 1AKUA 3NM4A 1XVVA 3JQGA 4QWWA 1X7DA 4HGOA 1VQ1A 1NIJA 1YKFA 1QB7A 3A2LA 4D5GA 4TS3A 1GAWA 3JD1A 4XVRA 1V9CA 4DMHA 5EVJA 2VHQA 3N7UA 2XUZA 1BWQA 4GYYA 4YWJA 2VXYA 4FJ2A 3H6KA 5ESDA 2E5LB 3WJAA 1B14A 2BBWA 4F8YA 3HO6A 4G65A 2PUBA 1ODTC 1WVIA 1X39A 2G25A 5GPBA 3AFNA 3D4PA 1L4FA 4RQBA 5K20A 5JYBA 4ES6A 2GSDA 5CLHA 2W2PA 5ALVA 4IZIA 2GPYA 3AVQA 1DKPA 4YAWA 3ZHTA 3TL2A 3MB8A 4KQMA 3VC1A 2HHJA 2J9FB 3RG2A 4B3JA 3ZD6A 1FUUA 2BGJA 1UBKS 2DBYA 4OBBA 1EFCA 1CLEA 3EIXA 4UTOA 2VQSA 2V7EA 4N8DA 1BYUA 3H5NA 3PK0A 1PZGA 5SYNA 2I76A 3THWB 1PW5A 5C8DA 5F3RA 4CHTA 4YAUA 2LRHA 1YRAA 4MYCA 4LBWA 5A04A 2RBKA 1EFHA 1P1FA 1LGYA 2ZI6A 2HA2A 2OOSA 4Q37A 5HX7A 1EK0A 5E9AA 5DBEX 3AVPA 3W5JA 2VDWA 3C3YA 4J16A 5D6OA 1V5GA 5BW8A 4TMXA 5BUZA 3DR3A 4MQLA 1D09A 1GZSA 1P1IA 5CW2A 3R5KA 3RYFB 4ENQA 1QWOA 1Y7HA 4GAEA 1QAMA 3AEUB 1J1IA 1HC7A 3E7XA 4HTFB 1HTBA 3CLSC 4FE3A 3OO1A 5A0TA 3KFLA 3ZZ1A 2VF8A 1WZ2A 4HB4A 1XMVA 1YU6A 3UMYA 3PNLA 4YBZA 5IP5A 1U0OC 4J6FA 4KWIA 2Q0QA 2TRSB 1NMZA 3BTVA 4FFSA 3UF0A 3N3AC 3VZCA 1V5FA 4C87A 4MV6A 3RVMA 1NMQA 1PR5A 1RQ7A 2KSQA 4L16A 5DSTA 4HLUA 3SJUA 4BAGA 4BRWA 1MG5A 2PE5A 4DLRA 4KR6A 4B09A 4X45A 4U8GA 3FVRA 1DOZA 4L8YA 1B8VA 3P2EA 3HWWA 4NFSA 3FUTA 3V33A 4WRRA 2AS0A 2JH3A 4MQUA 4QT4A 2Y8EA 2FPWA 3H16A 3UB3A 1QHIA 4CFYA 4L3OA 3SQMA 3KSRA 3M83A 3BMNA 3MWDB 4E5MA 4F46A 5HK9A 1AGNA 1RYZA 2XMPA 1VXOA 3CNOA 2JJ2D 2QVLA 1K92A 4X7PA 3JQ9A 4CHGA 4LEIA 5KREA 1U7WA 1U2TA 2R6CA 1L7NA 2B20A 1XLTC 1YL6A 4L8VA 4C4OA 3V8RA 4KV9A 1F9EA 1TAHA 2WKRA 3H5OA 1C7RA 4Q47A 3WRVA 1II9A 1P9LA 4FYPA 1N8TA 1ZI9A 4Q4HA 4YQEA 9ATCA 2MWMA 1RRMA 3QMPA 5HF8A 1E2NA 1ZVQA 1MA0A 3TM4A 1A72A 2UZ0A 4BMOB 1O5TA 3ZDAA 1L7DA 3FPKA 4WNYA 5E7MA 2G1JA 3NONA 3FF1A 4XGKA 3RSCA 3FB4A 2HI0A 3PNQA 5DZSA 3VR1A 4AJEA 3TECE 1H22A 2ZIXB 3I28A 1S4QA 1N5LA 1TYBE 3WDKA 3H2SA 4DLSA 1U1DA 1IMJA 3L06A 2Y71A 2CKMA 3FZNA 2D74A 1B8OA 4O4LF 3R7NA 2IXAA 4YMHA 3KKMA 1XZGA 4W5HA 2J0QA 1FFXB 4Q7QA 3GCDA 4OQMA 3E2PA 4C6TA 5JI2E 4ETMA 3QKIA 2Y6UA 2FG5A 4JT4A 4J6EA 3W6PA 3ICVA 5C5IA 5C5CA 1OSNA 4JIGA 2WNHA 5FL3A 3UJ8A 3A6EA 2XMDA 4GLLA 2NUTB 3VPAA 4BN5A 4H7PA 5HQ3B 1I7QB 1T0UA 1ZMBA 2BBTA 1NUQA 3N8GA 5TMBA 4BWYA 2VUTA 1AQ6A 2PRZA 4F06A 1QVVA 5EUMA 4EG1A 1Z63A 1K6JA 1MX3A 5CPBA 1YDMA 2PD3A 1N34B 1X7YB 2XR1A 4WOPA 1KSGA 2D59A 1E4OA 1TK9A 2J0UA 4NJMB 4AI6A 3JZDA 5DM70 2IT1A 1Z74A 2JIQA 4XB6B 4YWHA 1B6RA 4BX3A 1CS0A 2ID9A 4D4IA 3OZFA 2B2NA 3JWHA 4IJUA 5EIBD 4IDDA 3N28A 2CXXA 2HBQA 2JVIA 4F92B 3R4CA 4FTWA 1D2EA 1MC8A 3K2BA 2R60A 1HT3A 1R0RE 3RG8A 4ND8B 1Q0TA 1GZ4A 3LT1A 4YP6A 2CVZA 3HUTA 2P67A 2QLMA 1RVDA 4YUZA 1YTLA 3I42A 1RZUA 4LZPA 4CIAA 3ZZTA 4ADSG 1WSAA 2ODPA 3CUSA 5GOTA 4HZUA 5AKHA 5EJ7A 5J4KA 4MJLA 3AHFA 2O8EB 3VSEA 1URPA 4KXWA 1G3UA 3AF3A 1OLXB 3AR8A 1GXSA 1QH1B 1KDYA 5M34A 1YR8A 1DIRA 2B0JA 4XD7D 3TMAA 2ZDHA 4GDFA 1RYDA 1SJ9A 1RZ3A 2DWCA 4OO3A 1P0FA 3DF9A 2VHJA 2QRPA 4UFOA 4D02A 5E2IA 1XDSA 1LW6E 4JOSA 2OFXA 1WTCA 3MJHA 3SDZA 3B1FA 4HLCA 2WTNA 1RAEA 5BR4A 1E2BA 2A35A 1AQLA 3HUFA 4FBMA 1IAVA 3DZCA 4G8JA 5LLSA 4BEWA 3B1WA 4OUDA 4YGYA 3U4MA 3M33A 4Y9TA 1MAUA 5LMNB 2I8LA 2QP9X 4HX5A 5ER6A 4PX2A 2MJLA 1OR8A 1OA0A 3O26A 3UHFA 2CK3A 1A5ZA 1QYWA 3VZRA 1BE6A 1QGDA 5BR7A 4OHPA 4DMLA 4M9XA 3N8IA 2CLHB 3O91A 1GL9B 2GD2A 3I04A 3KQYA 4RABA 5ADWA 5AW0A 2YVQA 4N03A 3OEWA 4PLTA 4DBLE 1H9CA 2EAUA 3EW9A 3O1JC 2FWJA 2CDCA 1FP1D 4KVFA 2EDAA 4P82A 3FSJX 3IKVA 5IEBA 1TJYA 1U0GA 3OLVA 2JFBA 4TSRA 5E6SA 1DZIA 1C2YA 2AB0A 1HQKA 4GRDA 4H3VA 3DTVB 1L1FA 3VSAA 1YVRA 2CJYA 4A2PA 5AM5A 4LF6B 5KOHA 4RTOA 4EBBA 1P9OA 2QLTA 3B3FA 4QNNA 3TSOA 2C31A 3LT4A 1CUIA 3GGSA 5CJ2A 2CL0X 3JZMA 4D6XA 3I37X 4UXHA 2D5BA 2M6SA 3X0DA 4NCIA 5EJ6A 4O2BA 1X3LA 3FVQA 3UJ9A 4OQYA 2QUHA 4QEKA 5I5EA 1N5KA 1EFUA 2BGRA 4TX1A 4O4LA 4WCVA 1OWPA 1SBZA 2JLQA 3UK6A 1G291 3CLKA 16PKA 1CHNA 2NV2B 4R84A 4UVGA 2YV5A 4AP5A 1QC5A 1SEPA 3K5HA 5DU2A 2A1UA 4QYXA 1A8PA 1L5WA 4RMNA 5I9IA 1WABA 3B36A 2F8SA 3M5WA 1QO0A 5L40A 4JX9A 4J1TC 1M2GA 2PUDA 3HVRA 2QZ4A 3BD7A 1NYRA 4GPBA 1NR1A 4YP7A 2YWBA 3RC1A 2H57A 1Z0FA 1ZFNA 4B6PA 3K4HA 2BT4A 2H0RA 4JASB 2W2LA 3G2LA 1GYRA 2B21A 4WNAA 4EJSB 1BMTA 2J6HA 2XQFA 2E21A 3UWSA 1EJ2A 5FBVB 4AG5A 4KLNA 3ZY4A 4GU5A 2A5LA 2O9JA 2IYEA 3CUEF 4EWLA 1IXZA 3DDCA 3C4QA 2O8EA 2CXUA 2FF7A 2QP4A 3IBTA 5JJIA 4X9XA 3OWHA 1R3DA 4JVNA 3BFJA 4UUNA 4BMYA 4CT0A 1P18A 1KSJA 1E2UA 3DBLB 4KRFA 4ZYZA 2WZDA 3C7DB 2C2MA 4JUBA 5L3SB 5JMOA 2QYSA 3K0CA 3N2GA 4PG4A 4H0FA 4ROTA 2WV7A 4PRLA 5FNVF 3SN6A 4BBAA 4C14A 2DB3A 1USGA 2XY4A 5H70A 5E1BA 2XSZA 3B60A 1YUNA 4D2IA 4Q6WA 4IFIA 5TE9A 2X76A 5SYAA 2ZIVB 2ZJZA 2HYIC 5KSYA 1JDBB 2PPVA 1VIYA 2QPAA 4W5TA 1EP3B 2W6PA 4L5JA 5CCDA 2IDJA 2JAPA 1U3TA 3IVXA 4WA8A 4ITUA 3HWRA 5DYYA 1UOQA 1RLTA 2X0RA 3L6BA 1DEXA 1X1AA 4B74A 1IY0A 1QQTA 1AM4D 3V4SA 3FDJA 4Z53A 2BBSA 1FDVA 1VG9B 2IWHA 1E8MA 4LTMA 4IOMA 4BNUA 2H1CA 3HU5A 4QXOA 3ZOZA 3MD0A 2J09A 4KO2S 2GZAA 4BUJA 1E3SA 2EZ8A 4YRDA 4BB5A 4KR7A 5LN1A 4LV5B 1J20A 2YY7A 1G0NA 3DNFA 2XWJI 3KKLA 1NQUA 1UZAA 3KEOA 3T9EA 1RYBA 3HB5X 2FWRA 1E7RA 4TV9F 2ZRJA 3WGGA 1RMQA 4U2EA 4I50B 2PUFA 1HURA 4D4MA 3MM4A 4DSNA 1NC1A 1UZMA 2OP1A 4I81A 2B4QA 1QR6A 4IHJF 3QPCA 1BXGB 4FONA 4DYVA 1PFUA 3EJ6A 4YXWA 1HE1C 1T0JB 4S1WA 4EL0A 3LLMA 3ZV4A 4GMGA 2JAOA 3G9QA 5KJCA 3ROKA 2XMCA 3PIDA 4YRLA 4P3YA 2NUAB 4KH0A 3VO1A 1HDXA 3USZA 5JCJD 4ZC1A 1M7HA 1HYGA 4PLYA 3AJ8A 1UDXA 1CTQA 2P5TB 2EFJA 2PUWA 4JC5A 2ACKA 3V3TA 3TOSA 4B80A 5CUQA 1G18A 1IHXA 1IU9A 1WY5A 2G4CA 3R5HA 4RVSA 3SQDA 1BA3A 1CUZA 4PPYA 3UW3A 1NKSA 1FRQA 1PJCA 3ETNA 2ENUA 1NRWA 3E15A 1QGOA 4PIPA 4CQNA 1YIAA 2QWXA 3WHLA 1A8QA 3FAKA 1I2AA 1NVVR 3VPHA 5JS2A 2EQAA 1KO1A 3UJ7A 5D5HA 1OUMA 3B5IA 2QLNA 1G1AA 3C3WA 2X0IA 4Q1BA 5DX1A 2I6XA 4TMYA 4UBKA 4P5EA 2W8BA 3EG9A 1O95C 1WA5A 3MJRA 4KLCA 1RIFA 5IW8A 3TZKA 3ZWMA 5BWBA 1HTWA 1DIOB 4I9HA 3S40A 4EO9A 3A6DA 3W2TA 3KT8A 4BL5A 3ZNQA 4IV8A 4JEIA 4L57A 4IL5A 5SZKB 3TQOA 3O8QB 4E32A 1BN7A 5I01A 3B13B 5IF9A 1Q15A 2C07A 3R23A 3AVXA 4A0QA 2BEKA 2AYXA 3ANNA 4LK3A 3MAJA 2FMIA 3AI7A 1TX4B 2IXEA 2QRMA 4AO7A 4V2IA 4NNOA 4WJZA 4MS1B 4XJTA 4IXWA 4YCJA 1UDBA 2EWWA 1IOLA 2RAUA 1QAQA 2QTRA 4JSTA 2GPBA 2F3QA 3RGGA 3ZUPA 2GT1A 2FWAA 2BMJA 2J4CA 2UZIR 3CGWA 3DFUA 3HR4A 2G0NA 5BQOA 1L4KA 2IHKA 2QG9A 3H5WA 3P8ZA 1Z0SA 2F9LA 5D1HA 2JHGA 1N78A 4BV8A 5EEHA 2O0LA 2R6DA 3IT1A 3PGXA 2R1TA 4PAWA 3KYIB 2BMDA 2SHKA 5FRDA 2YZ2A 4KWCA 1K7XB 2A5FA 2IY9A 1PP4A 4MPJA 3DO8A 3A9RA 3ASVA 2B2XA 5TC4A 3VOAA 4HWPA 2K87A 2RGBA 4CIXA 4I1PA 1X1CA 1R0KA 2PL1A 1VJ0A 5TF4A 4ER3A 5CA1F 3QWFA 1GARA 1KORA 1M34A 4P0TA 5H8WA 1CVIA 2I67A 1N5JA 2IOFK 2XKJE 3H86A 1PR1A 3ZS9A 4ZDWA 621PA 2EP5A 1XQWA 3INYA 1EAYA 4JJIA 4P33A 2BJHA 1A8HA 1KAHA 1SFRA 3F6CA 3ICPA 4HN9A 4I4NA 2X0EA 3BXOA 2XVAA 2J3MA 3KRTA 2R8RA 4DBVO 4IKOA 1TM2A 5KYXA 1BC5A 1II8B 4EJFA 4ISBA 3WIBA 3TNLA 4EW2A 1QV7A 3PXCX 4WLNA 4ZCIA 3VKVA 1H1LB 3PD7A 3AF0A 1ZSYA 1R4AA 3OZSA 2QI9F 4TT3A 1W4BA 1E5QA 5EMKA 3SKYA 4MVJM 4H1VA 4J7CA 3G2QA 4ZN6A 3OUUA 5DGTA 1IDOA 4OK3A 2PZMA 2SKDA 1EZ1A 4UZFA 4U5XA 1XAGA 2P9ZA 4RH3A 1XTUA 1R9NA 4I1VA 4Y1FA 1AT1A 4DAOA 4Q4DA 4QULA 2QRJA 4K9MA 4RD4A 4D8XA 4DOMA 2YV1A 3FMPB 4K9DA 4Y7DA 5CXQA 4EUHA 1E3TA 1Y33E 3H6HA 3GUYA 2QYOA 3L7JA 1CEQA 3E48A 1P7ZA 1U3GA 1FLVA 3WKDA 1TK2A 2JZOA 3OSZA 5KVAA 2CNDA 4LJ7A 3ZVLA 3H4VA 3LRPA 4NHEA 3WQQA 3CM0A 1L4BA 1Q7RA 2D2EA 3DMYA 5ICMA 2R8EA 3F5FA 4IZOA 4R9RA 4F96A 5A3SA 3OCYA 5CA1B 1NW7A 4CYMA 2B6NA 1CR1A 1BW9B 2W6ID 3BQNB 2QXYA 2GI4A 3LNCA 2PTHA 3E3OA 3O1IC 3PNKA 2C2ZA 2FGKA 2R00C 4LXHA 1UWCA 2UZAA 4OHRA 4MRMA 2IX3A 3EF1A 1AD2A 3QOFA 2X7HA 4FNMA 3RADC 2ONZA 2H5IA 1ZJ6A 2NVBA 3GARA 1DO2A 2P1DA 3QFTA 2JDIA 4MHSA 4L73A 1OFIA 4RXTA 1NJ6A 3PUIA 3VSCA 2FGJA 1EJ6A 1PJQA 1X0XA 4DUPA 1AHIA 3A9UA 4Z51A 3H8JA 4RDHA 2HA7A 5ALYA 2RD2A 2IUEA 3AESA 3EVGA 3M0EA 5KTOA 2AJCA 4O1MA 3AXTA 5MGBA 5E95A 1PWZA 2YVKA 2PL9A 1A9ZA 2OZKA 1P73A 4R0MA 1S02A 4LHZA 2C82A 4PN7A 4I46A 5BRJA 2ZJ7A 3IS3A 1CR2A 3AM4A 4NNPA 1DV1A 4MJ7A 3T9BA 5BQ5A 2VPIA 1ZAKA 5CBKA 4HS9A 2CV1A 4WINA 2Q6LA 1LWNA 4DPLA 2GCEA 2XLBA 2I6UA 5KDDA 1KRWA 4EPVA 1MRSA 1GU1A 1XPUA 3B20A 3WK9A 2ONCA 3AY3A 3DW1X 3Q3JB 4QYIA 3MWFA 5C8YF 1LC3A 1FUIA 1J42A 2AC4A 1N57A 3FIJA 4B8ZA 4R8VA 1MV5A 4HDOB 4M60A 3KZKA 1YRWA 1UKZA 3T7AA 3I39X 3MERA 4G5FA 1Q1ZA 4LYAA 4P58A 1QUEA 5JSQA 4WT7A 2BUCA 4AXBA 2NWQA 1N5MA 2QM3A 3W6OA 4BNZA 4PGHA 4L8FA 3PWTA 2E37A 2O1WA 4D96A 1T3GA 4XIYA 4RK1A 4DXDA 2ZQ5A 1DQRA 5E0KB 1H85A 5DXJA 4F4IA 1OXXK 3W9UA 5IC4A 4WDQA 4AY6A 3B38A 3P0IA 3QBEA 2PT5A 4FMDB 4L4UA 3TSCA 2O0HA 2JGAA 1QVAA 2NZVG 1GZDA 1J70A 1NTRA 3KT0A 3FOFC 1JIQA 2QA5A 1NNEA 1EX7A 3TI9A 3AO0B 2PRYA 2WK1A 3A6ZA 3LX5A 5K03A 2V58A 1JHRA 3ASUA 2CBXA 3E5HA 2HJSA 3P9SA 5HBRA 4ZCRA 2IQ5A 4JK3A 2ZJOA 3U19A 3K0SA 4LJLA 4CE6A 1UBGA 3GH3A 4BJ6A 4D0SA 3A2NA 3TJZA 3H3XA 2AD1A 1CVLA 5E8RA 3PBKA 4O4JB 3UTDA 5F2NA 3UK7A 2VRCA 2AEJA 2IV3A 2EHJA 2OBYA 1ECLA 3WKBA 1NQXA 3AR6A 3VU9A 5TX7A 1DKQA 5BXYA 2OGUA 3JVIA 1P39A 2FQQA 4L2IB 3UK1A 4G0WA 2JLVA 4PFQA 4BDSA 1UP4A 5JWRA 2C04A 1QHXA 1T4CB 1N3BA 2JFGA 2Y1WA 2C3UA 3PR1A 4HF7A 4TWIA 4YAOA 3DFMA 3B7WA 1D5CA 1XHLA 1QRAA 2GVDC 1BHQ1 2BFFB 2OZLA 3RVDA 5HRCA 4AQ7A 1ZAYA 2XWSA 1G7SA 3AV3A 3OUZA 4GM0A 4NBNA 2I65A 5C3MA 2FK7A 4FBGA 2OAEA 4F93B 5BQPA 1KSFX 4C06A 3A1VA 1HLDA 3P7MA 3HYCA 2IXGA 1JKJB 3LXMA 4M0EA 2EX0A 3NHYA 5DN9A 2YMQA 3HMKA 4DCPA 3KWLA 1ZM9A 1O6ZA 2NZWA 4LDAA 4TTSA 1E9AA 3AEQA 3KZVA 3X1JA 5KOJA 1WB4A 2NPOA 2C8LA 4BRZA 3G89A 4ZO8A 1ZR4A 4RJIA 1SXJC 3DB2A 3LPLA 3PWSA 1LBSA 1SA0A 2ZOSA 3W77A 2B36A 4R1PA 4EARA 4EUNA 3OU2A 4JSRA 3RANA 3IO3A 1H23A 2G5TA 1UM9B 4QDZA 5CVUA 1EVIA 2JK0A 3A3PA 2PQ0A 3EVNA 2PX3A 4IOLA 5ALXA 5DV9A 5E7IA 3SLGA 3M70A 2C20A 3Q5DA 3V9PA 3IAXA 3Q6NA 1P1HA 3THYB 1GL6A 5EWLA 4Z4EA 1T3ZA 3FM9A 3ONNA 3KDPA 1XRPA 5LOVA 2FFQA 1EDEA 2WTEA 5EKXA 3ICCA 1C7QA 2H48A 2R97A 4EYQA 2GZMA 1V71A 1OT3A 2OHXA 1P7WA 2ZRKA 4KFSA 1R4ZA 3DA8A 4OM8A 2C9OA 2LV8A 2V3WA 1JN0A 3LT5A 5LFAA 1HQDA 2XZPA 1BCSA 1FRVA 5BMVA 4B2YA 1OV4A 3MIZA 5FB3A 3DOCA 2D1RA 5HS4A 2EZUA 4ARSA 1MVOA 3ZK7A 1U0JA 4HMPA 4X8OA 3WMEA 2AFVA 3FDFA 2NPFA 1FNSA 2HCFA 2GJ9A 2AOUB 4FZVA 4KEAA 1HX7A 3HDYA 5E2BA 3GUCA 2JFHA 2WYWA 3SR0A 4GI5A 1DAIA 3LBAA 4NBWA 4PTZA 3RROA 1KIMA 1G3IA 4LY3A 1RRCA 1JWLA 3GL9A 1C1DB 1GRQA 3QWIA 3WQHA 2D1FA 4Q4AB 2B4RO 3IYLW 3U7JA 1CK4A 2YYAA 4LRSB 4P3OA 5JNRA 4OH7A 2W71A 2BFPA 3HQ4O 4BO8A 2EJVA 3DV2A 1RDFA 5KCZA 5ILQA 1AXGA 2V4UA 3C8DA 2X9NA 3N3BC 4JC0A 2PX4A 1ADJA 3G0DA 3CR3C 3BHMA 2I71A 3U0VA 1QBGA 1CUYA 3G82C 4CCYA 1K08A 2BI8A 2EATA 2V03A 2GEFA 5AESA 2BSAA 1LEHA 1LTKA 1JA1A 5M5BA 2AMFA 4XB2A 1MC1A 4QDXA 2W42A 5U4QA 1WVGA 3L8YA 1AS0A 1PS0A 2C84A 3GLRA 3GRRA 4XOIA 1N6RA 3UGKA 4N47A 4JLWA 2X5OA 4Q48A 3LOQA 1WRBA 1X14A 2FAXA 4LECA 2AN5A 2BEUA 3KL2A 3UMCA 3WX0A 1G20A 2FZ5A 2QQ5A 3ENVA 3N58A 4BLPA 1CIJA 2NO0A 1PDWA 2WA2A 1YE8A 1R12A 2OY0A 2QMOA 3L8EA 3PNSA 1BH6A 2I7DA 1ENZA 3HBNA 3M49A 4KPGA 2P79A 1EQUA 2QROA 2P3LA 2LCIA 4QXMA 4FMCB 3KTAA 2PZAA 4KQKA 1UJ6A 3LUFA 3D4IA 3UAZA 4LJ6A 4KMSA 3C0KA 3D7LA 1YA6A 3ELUA 3HA7A 1WBBA 4P4SA 4G25A 2XMGA 4Q3OA 2QTVB 4MVWA 2UU9B 3WLIA 1YRYE 3CTMA 2GPTA 1YR9A 2GF0A 4RORA 2E4VA 3OQHA 3W3AA 4UASA 5EKUA 5BT9A 3DMRA 4JZKA 1FDIA 3GNLA 5E0OA 1RMYA 3BZUA 1NJSA 3GYGA 3FR8A 3F8WA 1DJPA 3PXXA 4CLHA 4NE7A 5ILGA 2X0FA 1YQEA 3HV0A 3AUAA 4I1RA 3BXZA 4MW4A 5DLQC 2ID4A 1K7CA 3U37A 1T3SA 3GP5A 1T5IA 2YTZA 4U7TB 3DD5A 4R8RA 5DNEA 2HCRA 1Z0DA 3LBIA 4MNTA 2XCLA 1N2GA 2ZT6A 3RW9A 4IUCS 1PHPA 1G41A 5B58T 1KO7A 2VP9A 5IKPA 3HDJA 2EWMA 2PXCA 3M6IA 3V97A 1QYRA 1C0IA 2QAGB 1CNEA 1XF9A 3L7LA 5K6TA 4U9IS 2GEKA 4BHTA 1F7UA 1XAIA 3ABRB 3LJKA 4BQEA 3GGCA 4M76B 4YH1A 2ST1A 5J63A 1ITZA 3BSYA 1LQTA 5KQGA 4UCWA 1K3FA 4PO9A 3IUJA 3ZDRA 1JTFA 2HOQA 1TYDE 2WSBA 1TTTA 2A3RA 1ONOA 1MRNA 4PINA 4C0SA 1SXJB 5ES3A 1EFVA 3RASA 3ZVRA 2GO7A 4CBVA 4C2BA 1DJNA 2P35A 2Z1DA 2DY1A 3SIWA 4GP9A 3AY7A 2KM1A 4CKCB 5I6DA 2JLBA 5IF3A 2BFDB 5A3JA 3AHJA 5CNJA 2Q27A 4DC0A 4F9FA 4Z2YA 2WAYA 4Y98A 5BN4A 5B2FA 1YZ3A 2IH5A 1NXTA 2G5CA 4IX1A 5TB5A 1CP2A 5HGXA 2WSSD 4ONEA 3PEFA 3B5JA 1UQUA 2PZ8A 4BNTA 4JJKA 1TO6A 2WMYA 1UOEA 2AXEA 1DIBA 2WZQA 4PLHA 1B16A 1V1MA 3G8YA 3GZJA 2NUPB 4RPIA 3DCIA 5CH5A 3AR4A 3ZZNA 4ISCA 2A9RA 3L6CA 5C8VA 1EZ4A 3WC4A 2O6HA 2CHUA 5JNSA 1JQKA 3BFPA 3Q8LA 3C6YA 5KWSA 4TXNA 4KVZA 2B99A 2DECA 3KV3O 2ZBQA 2Z8YM 4U7HA 1MW9X 3L46A 1RKVA 2WF6A 1EESA 1U3WA 4F3NA 1SVLA 2PUHA 4MUJA 4M1ZA 3WJ1A 1TKCA 3NKVA 5LQMA 4MB6A 2GDJA 2OBFA 3B89A 4P4TA 1RFLA 1IBSA 2C42A 5YASA 3SYMA 5CB4A 4BKOA 2XVYA 2CKDA 1EGAA 3GFTA 3L4BC 3OPXA 5ALKA 5JMTA 5MN4A 1BWSA 3KB6A 3AG6A 4D45A 2BCGY 3N1UA 1XEXA 5CG2A 1GFZA 5LZ8A 3SZMA 5LMZA 2OSBA 3RVQA 2PZGA 4B73A 5ADVA 3Q15C 2SKCA 3N8NA 3CEMA 3KVNA 3AFOA 3CT6A 1JXMA 2XNKA 2CVPA 5CNIA 1XHEA 3I6QA 3V1NA 1XI2A 2J45A 4NR0A 4EGFA 3T7EA 2F43B 2FEOA 3CH4B 4MVXA 1M7BA 4BOYA 4F91B 2ZUFA 3A4NA 3WAGA 2H9YA 3VR6H 2QG4A 3UM9A 1O0CA 4LXTA 1VRWA 1Z5VA 2ZG6A 4I5DA 1R6UA 2ZUVA 1C4OA 2FJPA 3PPWA 1XYGA 2X4GA 1E20A 3HMQA 4CF6A 4DRXA 1YR2A 2CUKA 3I73A 4E07A 1GQSA 1G3QA 3MHTA 1YZTA 2CXTA 5ELLA 1Z12A 4J9UE 4KO1S 4FEEA 4A0FA 4ALJA 4DWJA 1LDMA 3ESQA 4LXUA 4YB8A 2BFCA 1PG0A 1OAOC 2EHDA 3OLZA 4X6LA 4F56A 1D0SA 2QG6A 1CS0B 1BU5A 1N6OA 2BM8A 2YINC 2YWHA 3ED5A 4IEFB 2GK7A 3QVGA 1YFZA 4XE5A 3RVSA 5HZKA 4HQFA 3RYHB 3D0RA 2AXNA 1IN8A 1S7CA 2CW5A 1BYIA 1WDTA 3BD9A 2QN6A 2DKOA 3ZIUA 1SXHA 2VAVA 3A6LA 3RLIA 2PGXA 3DFIA 2ACWA 2NU6B 2EJWA 3AFMA 3GB9A 4K7JA 5FEUA 1RZRD 1XCLA 2KLHA 3V1TC 2WILA 4RJ2A 1Q0ZA 4MLZA 2OILA 2G5PA 1NHWA 3P96A 2ILTA 1XLWA 1CUUA 2VSQA 2C61A 3C4VA 4XDZA 3OCJA 5HIMA 3CLHA 5BN5A 4QHYA 2FCRA 3VSDA 1Y7LA 1JJVA 1GG8A 1VGVA 1J8DA 3LTNC 1WULS 1YZYA 5K6AA 3FMVA 4IWNA 2NPIA 1C4KA 1X92A 1Z4MA 1X1BA 3OHMA 3Q41A 3GA0A 3LRXA 1YA4A 5GJWC 1GRCA 1R0SA 1ZGHA 3OZEA 2J85A 1IHUA 2RH4A 5EHXA 2BPOA 2XODA 3MJ4A 4M87A 1CDEA 2HMUA 4QOIA 4WESA 1NMYA 1Q19A 1A5BB 1CUGA 1QK5A 3P0EA 4ZRMA 1KY3A 3BWCA 4D81A 2WPDA 3QW4B 2ZTMA 3EAGA 4PC2A 5I4BA 1MHTA 4CTKA 4M7PA 1PZXA 1TNDA 2BISA 5MHTA 2FMHA 1BG6A 1WMAA 3NYWA 4O8ZA 5L7TA 1JFLA 1NPTO 4TSFA 2DXIA 5TVGA 3SS7X 3QFSA 1YUMA 5KNDH 4MMYB 3OWXA 1Q7BA 3ROFA 2HLPA 3TIFA 1SVOA 1LDBA 2B78A 2ZTHA 3AUTA 4KPUB 1W44A 4WZZA 1M3SA 2ODAA 3SEZA 1M2VA 4HR7A 3SYLA 1XTIA 1G3MA 1AN9A 4D99A 1PLKA 1TIBA 5F51A 2RH8A 1LW7A 1AKWA 2DLNA 1U3CA 3JQCA 2LDBA 5C1IA 3PFKA 4ND6A 5AVOA 4CF3A 4A91A 4F12A 3CLSD 3GF4A 3HBJA 3LBHA 2G5GX 2I2DA 5L3RA 2YY5A 2Y2VA 7ABPA 4H7KA 2ZRPA 2DWUA 3LKVA 3FTCA 3OJOA 1E1CA 1XIVA 2R8YA 2M98A 3AINA 4DA8A 1QCDA 4X1IA 2BLNA 1G4HA 2MYNA 4RKFA 4BNIA 2Q4BA 1FNMA 1FP4A 1ONBA 2EGHA 3EIFA 3T5AA 3U7HB 4P2BA 2FPRA 3K9QO 4XARA 3TTXA 4L2IA 3UW1A 2Y77A 1ESEA 4ZALA 2BV3A 3W3AH 5CM9C 1FFDA 3BXEA 1Z7GA 3NMUF 5BURA 1BA2A 4YXWD 4HOYA 1MOZA 4Y6QA 3VDMA 1NXPA 3FUCA 3X2EA 4EG7A 4MGIR 4OAQA 5K0CA 4WKCA 1MPTA 1VKZA 3H9GA 3NCHA 4L5BA 3OZAA 4CEIA 1L8XA 1ZU5A 3PWZA 4ASUD 1TE2A 3PXUA 1DARA 1L5SA 2GM9A 4HH4A 1GDDA 4EGSA 4QC2A 1PS9A 2QVCA 2Y1XA 3A1WA 4TXHA 1PS8A 5DN6A 1R64A 2OENG 3GBSA 1FDTA 3HJBA 5LYYA 6Q21A 2EJBA 5TDHA 2V54A 1T1JA 3UWMA 3WTBA 2WT4A 4M88A 1PFVA 3L02A 4MUGA 3K5WA 2G76A 3BWYA 1Z4QA 1Q57A 3UNXA 2QTZA 4K40A 3SQXA 1DAMA 4F2PA 5T5QA 1D0VA 2ZTUA 2Q5QA 2QY6A 3WNDA 1P8AA 2VPZA 1U0BB 1YRHA 1PEDA 1TUIA 4DPKA 1V9LA 1R50A 1XTTA 1TA4A 4HB2A 4UVIA 2WUWE 4JLPA 1Y8QA 4OOFA 3URMA 4R1OA 6NULA 4MWTA 1B8UA 4AYXA 3QVWA 3I5YA 3QX9A 2YFHA 3INNA 3OZVA 1E1CB 5IDYA 3L4SO 5BT8A 1KJ8A 3A6KA 3SP1A 1SR8A 3OPVA 4KQFA 3VR0A 5I7OA 3PF8A 3JWEA 4GMFA 4IIGA 3DAHA 3LT2A 5T3UA 3GQBB 4XWGA 1CRPA 3BCHA 2HU2A 4WFKA 4EI2A 3CEHA 5KB3A 4GF5A 2R7MA 1I36A 3ULKA 2O8FB 2PRKA 1KYQA 2VHVA 3TDKA 1SXQA 3QYAA 3BREA 3I2GA 4L07A 5JCJA 3COVA 4ZYLA 3SVTA 3IVAA 1GZ7A 2AH5A 4FZJA 4JUCA 4NBTA 5FP0A 4XDYA 2ZE7A 4AF8A 1I10A 3V6LA 2R00A 2ZB7A 4XUDA 3PGLA 4BXOA 2NTVA 4QLAA 3QA3E 4NI5A 3AGPA 5TEVA 1EVLA 3F4LA 5GZ6A 4QHTA 1P2VA 4ZAFA 1BAPA 5SY9A 1UEJA 3A4MA 1QIEA 4UOZA 4IV0A 1I2MA 4DLXA 1JXQA 3EZYA 3C1OA 4HDAA 1DX4A 1EG2A 1G8FA 1Q91A 5IARA 1YZUA 1TDJA 3GGGA 2BZSA 5FH9A 2IE0A 3NDBB 1G8GA 2VDLB 4OGLA 3K9WA 3OBBA 1X80B 1USWA 4E5SA 5LIPA 4PN3A 2JLWA 2VJMA 2W2OA 1I6WA 1RLIA 3JQFC 3PNMA 5ALDA 3WFJA 2C5BA 5TMPA 1AHPA 3CKYA 4AP6A 2ZWVA 2YJ5A 3AR2A 3K2QA 3ZR4B 5I4IA 3DZIA 5U9CA 2WJHA 4HNHA 4BLVA 3HP4A 4MUMA 1VLVA 3PP8A 4EVIA 3U7QB 1PSZA 1JEJA 1J9ZA 1WU7A 2P91A 3KSUA 1DFHA 2PWAA 2ZSKA 3E7DA 3BN3A 3LX4A 4PYKA 4XOUA 1JH8A 1L4YA 4MDHA 1UXHA 3R1IA 1LVUA 3CE9A 4O2AB 5JZSA 2ZVQX 4FYJA 5EMHA 1NGSA 3I62A 3GLSA 4FN4A 1V45E 5EKSA 3BK1A 1NRXA 2N42A 4PV7A 3VUEA 3WYNA 3ZW9A 5J2TB 1N7GA 3RREA 2FOLA 5THQA 4D0LB 5JFTA 1SIUA 4L76A 1H5QA 2ADMA 4CF5A 4W7IA 4W5RA 3FTDA 1DQSA 5K3CA 2UZ3A 1AUOA 2NXEA 3BGWA 4QEZA 4KG7A 1PUJA 4Q1CA 4BRUA 4YPOA 1WSBA 1XJ0A 3CWCA 2RJNA 1P91A 4H6WA 4HAIA 4LJRA 5HIJA 1ZH4A 3PD1A 2AX3A 3OE5A 1A7AA 2G0TA 4RDCA 1XTVA 1ABFA 1NJ2A 5DHSA 2IA5A 2XPCA 1S2LA 4YAJA 1H2BA 1HXHA 1YQQA 5KTNA 1K66A 3GFGA 3AQIA 3M6LA 3S55A 1S6YA 4KLZA 4GX5A 3LCRA 5H81A 2I3GA 1UXOA 1DBPA 1C7IA 4OHWA 2QV7A 1QG4A 5K1ZA 1MT0A 4IGAA 3GLIA 1W49A 1UOOA 1F3OA 2DFLA 4I99A 2ETXA 4QNMA 1UBLS 3BJEA 3VU1A 2W58A 3EVCA 4MUKA 3UT5B 3W78A 2A67A 4AP9A 3B52X 3QX3A 3KJNA 1OI4A 2NQ8A 2QRGA 3CSSA 3IB3A 4E5NA 2IYFA 1RLJA 1MABB 1GRVA 1CRLA 1H4TA 4ND1A 3VR6D 4R7GA 1RWBA 1R5JA 2AHRA 2R2GA 3B3GA 5LP6A 1N32B 4FD3A 5JEEA 5EUQB 2AKAB 1C0EA 1DDOA 2FSPA 2D0OB 1Y98A 3ORYA 3KKOA 3T9DA 5CFQA 3DBHB 3O94A 1XLTA 2ICAA 4Y9SA 3HU1A 3TW4A 4B3TB 1OILA 1KAEA 9GPBA 3GLFA 2DR0A 4PLWA 2C2WA 2BP7B 1VHTA 5AVZA 1DL5A 1KOFA 1EA7A 4JQYA 1S4MA 1VKNA 3K1ZA 4ZCLA 1FFBA 5EEGA 2P2LA 3NBYC 4IDQA 4KFRA 4F11A 4UTVA 1Q1GA 1TADA 2OQRA 1B0UA 3LHDA 4Q4HB 2BBOA 5EN4A 1G38A 4ZYYA 1Y9AA 1KNQA 2PG3A 4J0JA