4U39A

Crystal structure of ftsz:mciz complex from bacillus subtilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
294
Chain Sequence
SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIALDFADVKTIMKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 99
structure length 294
sequence length 302
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4u39A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4u39A01
3N2GB 4HNAA 5J2UB 4EI7A 4F6RB 5LOVB 4I55B 3RYHB 5EZYB 5LXTB 3HKCB 4B45A 4I4TB 5JH7B 5KMGA 4M8IA 2RHOA 3HKEB 3JASA 3N2KB 3JARA 5CB4A 2VAPA 5EYPB 4I50B 5KX5A 5LP6A 4U3JA 5C8YA 3RYCA 4ZHQB 3JAWA 5LP6C 2BTOA 2R6R1 5JQGA 4O4HB 4WBNA 3VOBA 5IJ9A 4ZOLA 2VAWA 5LOVA 1JFFB 4TV8A 4DRXB 5ITZA 2R751 3M89A 4X1IB 4EB6A 5CA0B 4TV9A 4O2AB 4B46A 3JATB 5EYPA 1W5AA 5C8YB 3RYCB 3RYFB 4YJ2B 1FSZA 1W5EA 5EZYA 5LXTA 2XKAA 4KWEA 3RB8A 4O4LA 5KMGB 1JFFA 5EIBC 5ITZB 1TUBB 1OFUA 1W59A 5MN4A 5IYZA 5LP6B 4X1IA 4ZHQA 3HKBA 5CA1A 1SA0B 1RQ2A 1FFXA 4O2BB 4X1KB 4O4HA 4WBNB 3C8LA 1TVKB 3JALB 4LNUA 4ZOLB 5FNVB 4FFBA 3N2GA 4HNAB 4U39A 4X1YB 3WGLA 3WGMA 5J2UA 2XKBA 3RYHA 1Z5VA 3VPAA 1W5BA 4O2AA 3M8KA 5MN5A 5JVDB 3JATA 5LA6B 2Q1XA 3JASB 3HKDB 5IJ0A 4E6EA 3RYIB 4O4IA 3HKBB 4F6RA 1SA0A 1W581 3JAKA 4O4JB 3JAWB 2BTQA 4FFBB 5JCOA 3ZBQA 1TUBA 3HKEA 3VO9A 5JCOC 5CB4B 4ZI7B 4X20A 5JVDA 2RHLA 1FFXB 2RHJA 4O2BA 4DXDA 5LYJA 5KX5B 3HKDA 5IJ0B 2RHHA 4IHJA 5IJ9B 4TV8B 4DRXA 4YJ2A 3E22A 3UT5A 4O4LB 5M7EA 3V3TA 4TV9B 3WGNA 3VO8A 3R4VA 5CA0A 4X20B 3JAKB 2BTQB 1W5FA 3RYFA 5LYJB 4X1KA 4TUYA 1TVKA 3JALA 3CB2A 4LNUB 5GONB 4I55A 4IIJA 5BMVA 3E22B 3HKCA 2Q1YA 4ZI7A 2VAMA 5J2TA 4YJ3A 5CA1B 1RLUA 3JARB 5IYZB 4EI8A 4IHJB 3ZIDA 2VXYA 4U3JB 3RYIA 5MN6A 3VOAA 1Z5WA 4X1YA 3ZBPA 4O4JA 4EI9A 5FNVA 4TUYB 3WGJA 3UT5B 4I4TA 5JH7A 5GONA 5EIBD 3N2KA 4IIJB 5BMVB 4I50A 1RQ7A 4XCQA 5J2TB 4EB6B 5LA6A 3WGKA 4YJ3B 4O4IB 2GVIA 5JQGB
chains in the Genus database with same CATH superfamily
1E79D 1RPJA 3B3GA 3AB8A 1YVUA 4Q9IA 4ITUA 4GX2A 3S4YA 2GJ9A 4PWYA 4FW9A 2FZVA 4EG6A 1V5EA 3EISA 3EODA 3ZU3A 2GB4A 1XU4A 5ED4A 1P1JA 3T3DA 5FL7D 1P0CA 3L7DA 5G4LA 5L3RA 3VX4A 1U63A 1XN1A 1K06A 3MWLA 3S2IA 4OREX 4BVTA 4ZKEA 3T1TA 5DNVA 3I8SA 4BGEA 4Y0NA 1MRZA 1XK6A 4OXYA 4UBNA 5AT1A 1M0TA 2GCPA 4PO9A 1KYQA 4DGSA 5HTOA 1T8YA 1GLVA 1GRQA 1LDGA 4M87A 2X7XA 2WPNA 1L5RA 2OE2A 2XQVA 3JZFA 4JOBA 4MVJI 5LB4A 3T3HA 2WUGA 2F90A 2HV8A 5JVDF 5MFZA 1R5JA 1EHCA 1E64A 3BICA 4RIEA 5ALHA 4TX1A 4BRZA 1H6AA 1FX0A 2ATXA 1XZBA 4RV4A 3I73A 5ED0A 2WTAA 1PT9A 1EFVB 3ZN2A 5BR4A 5H68A 2OV1A 3RTEA 1P19A 3TZEA 1XZNA 1PG0A 1RYNA 3EDCA 3KEFA 3L8YA 2IIQA 4OGLA 4C0HA 5JH7F 3EULA 5EXSA 2B6NA 4P4NA 5GTDA 4JEHA 2YV1A 3PV0A 3O2NA 4FYKA 5I5EA 1QU3A 3R40A 3SSAA 3MHPA 4TKUB 5AW4A 1DBRA 1JLKA 4RVUA 4WKCA 3UKDA 1SA0B 2PWPA 621PA 5DLEA 3EIFA 4MICA 5H59A 3MF4A 2ZM5A 2MU1A 2LCAA 3I83A 3MINA 4PIPA 1N2ZA 2BJHA 3RAPR 1CJSA 4KP7A 2YHBA 2MYUA 3BMQB 4Q3OA 3LHSA 3MRSA 4Y2PA 4A2WA 1MU0A 3GP5A 4KXUA 2Z9CA 1Z47A 4B6OA 2R6FA 1SR8A 2BEUA 2FEKA 3EDRA 3FROA 3H1AA 4PPFA 2BTQA 4G1MB 2QMZA 3ZTTA 1P6XA 2O0KA 2Y6VA 1DCKA 2XA2A 3CVOA 3STWA 1ZIXA 3I04M 2VTDA 3PB3A 2R5WA 3OVMA 1R16A 5TSDA 3HDHA 3SF8B 3VPBA 4BO6A 3O8LA 4CBVA 4NPCA 1MDBA 1P2TA 3M3HA 4GR9A 4TL9A 5BQ5A 3GD5A 2DFTA 3DP9A 4TZKA 3ZQUA 1BGWA 3KSDO 2YCBA 3GJ6A 2D2XA 4CXMA 1S8AA 4RH1A 1I14A 3OZEA 4Q16A 3UT5A 1YDFA 2CMHA 4NFYA 2AG6A 2OCYC 4AURA 4CWAA 4DIMA 2G1AA 4N39A 2O5VA 1CK2A 2OTCA 3I2KA 4UAVA 5ES3A 1HG1A 3TB6A 2AYYA 1CDEA 1USIA 2QTFA 3T34A 1WMBA 5DHRA 4XAQA 1V2GA 2VNIA 3A25A 4YJGB 5H1YA 1SKUA 2XAAA 2XUPA 1P75A 4AC9A 1TK2A 1IHUA 2IAFA 1TJ4A 5FWYA 5K09A 4YJ3F 2I6FA 1RWVA 1WEHA 5HF6A 4A36A 2BFCB 1G3QA 2GPBA 1YAJA 4PZEA 5CUQA 3W34A 4Z3DA 1CJKC 1F5SA 2VJYA 4FGJA 4HY3A 2CHQA 4Q7MB 1YS4A 1LLUA 1BJKA 1W87A 5JLJA 1MGOA 1R00A 5ECWA 4Q9AA 3IBCA 4RABA 2HVYD 1B6GA 3LKZA 3VYSC 1SVSA 3MW8A 3NEJA 4LQCA 1Z7GA 4NCKA 1T36A 1T6BY 3WJ1A 3DT6A 1ANKA 1MPTA 4INOA 2FWBA 1FS4A 3OAAD 3WDSA 4LV6A 5A3VA 2AXQA 3IVXA 2CNLA 3CNOA 4LDPA 4G37A 1UINA 2C58A 1TYBE 1U9IC 4YROA 1J8QA 1YASA 3FVWA 3PRHA 4L5JA 5AR1A 3QMMA 3SXPA 1GNVA 5CX1A 4LZAA 2FX5A 3M4JA 1YZYA 4MV7A 1UFQA 4H6PA 5JXHA 2I33A 2CB9A 5IAGA 3GN2A 4Z8XA 4CG2A 4RL4A 1NZFA 2E37A 2I4IA 5EXEA 1JFFB 4CTNA 1GQRA 1EIWA 1QCZA 3WK9A 5HG0A 3RSGA 1CFZA 1BDIA 3TLKA 5FOQA 3WI7A 2IH4A 4D0LB 1T1JA 1U3DA 2IQIA 3QYJA 2JJ2D 1BEUB 4G81A 4NYIR 1I10A 1GKLA 4XDYA 4Q4CA 3OKAA 3DL7A 4F9TA 1CQZA 3E1KA 5LBIA 3QQ5A 2E3JA 3BHNA 4J94A 4KWCA 3AEUA 2QHXA 3ZJUA 4EGAA 1YFKA 5MN4A 2F6RA 2XBUA 5CDUA 3LWRC 1WPRA 1RJ9A 4HEA6 3D6VA 1JR3A 2WIFA 2ZYTX 1NBMD 3IA2A 3MHTA 4OLHA 2DFKB 2N3ZA 5CW1A 3ANTA 2QUIA 3AOGA 4I4LA 3Q1LA 1XNGA 1P17A 3IQZA 4G01B 4EHKA 3BWVA 3WLOA 3QLJA 3OUZA 1JTFA 1UZLA 1BX0A 2BUAA 2V1XA 3MTGA 1IIRA 3QIVA 3IKFA 1Q1NA 1K8QA 2FYTA 2V96A 1NF3A 3BL8A 3BD6A 1UBLS 4H9GA 4M0PA 5K0SA 5AVSA 1VHLA 3F7TA 3N59A 2QT0A 2W6CX 4YMGA 2RKBA 3ZK8A 4PSVA 1VJTA 4HDQB 4TYNA 3D6MA 4ZGGA 1ZAYA 3VDRA 3CYQA 4MV8A 4QDZA 1TD1A 2FDXA 1W4BA 5BYJA 4DLVA 1RLJA 3ENQA 2WMYA 5HJ7A 1ORRA 4O2BF 3LRTA 4Z1OA 1YONA 4B6QA 1GVHA 5CEFA 5JXWA 2JGEA 3UUWA 3M81A 3W3AH 1Q0HA 8ATCA 2WLSA 1VHAA 2AEFA 4WFIA 4DN6A 1XEAA 2BMWA 3F5SA 3AKYA 4PYIA 1PSDA 5FO0A 2ECKA 4BATA 4BO5A 3PFIA 5M2QA 1EESA 4L6IA 3H8JA 1RE1A 2RJ3A 2BFEB 2X7HA 3PYXA 4KZKA 3D8SA 3SR3A 3TGLA 4TKZA 4TLLB 4Y2HA 1UCFA 4AY2A 3LIIA 1TGVA 3NGLA 1P7ZA 1PEAA 1XZEA 4LJ9A 3TLBA 3FOFC 2VYCA 1A8PA 2I3GA 2XUOA 3C5HA 2IODA 2FGJA 1NX9A 1YZTA 3U7QB 5FPYA 3EMDA 4U6SA 4F11A 3ZGXA 5GZ3A 1VQ6F 2GRUA 1VIDA 5GZ1A 2H6LA 3VR1A 3ZIDA 1ICIA 2AK3A 2F3RA 1M6VB 1O94D 5DTMA 3IUYA 5EQDA 1IBSA 5FPHA 3RVMA 1DQYA 3H11A 4TUYB 1MZVA 4FDTA 4ER6A 5LWHA 5GONA 4OHWA 4GE0A 1HA3A 1PJQA 2D3TA 4LOLA 4U7JA 3BJIC 1W19A 4WOBA 1TVMA 1PV2A 2XV1A 1NNI1 2YJ6A 3VPDA 3V8PA 3R7WA 4O4IB 1S8OA 2I87A 3PD0A 3LP5A 3IOCA 4HYYA 5ENZA 1Q3TA 3KSAC 3H87A 1SOVA 4RANA 3CGGA 3MJEA 1HEYA 2OBYA 1ENYA 1Q86H 1OX6A 1CEXA 1R0CA 2C8VA 2ZYIA 3X1JA 2WJ3A 3FWHA 1WPGA 4O2LA 1OSNA 2C3MA 2H5JA 3HY6A 3KOZA 4WE3A 4XGKA 3SXJA 5CTJA 4XEHA 2O5RA 1M6VA 2DVMA 2XNDD 3W6PA 1V1JA 2VIIA 1CWUA 4MW6A 3PXXA 5JV5A 1MV5A 4ZT4A 4F97A 1N6HA 4AJKA 5AKEA 5KYYA 1FRVA 4B3HA 1IQUA 3Q6IA 2ZSEA 1CR2A 2O6HA 1PJ3A 1RT9A 3P0HA 1KOLA 4C88A 1L6RA 1E77A 1XQ1A 2CJPA 4MA4A 3JXEA 1PR3A 3R5TA 1U81A 4N6GA 1GAQA 4TWRA 5IMBA 2FETA 1MVOA 1RRKA 3IR7A 3AC0A 3GLHB 1NJ6A 2HP0A 1E3TA 5BRAA 4YUVA 3VPCA 1LZKA 3HYNA 3NB0A 2WA2A 3USZA 1C4XA 1O9GA 2A9JA 3K1TA 4C7XA 1XJ5A 3T9CA 3WVNA 4C76A 4BVFA 4BFLA 3EFBA 2MIIA 3VYUC 5FFFA 2NO4A 3DP7A 1AK1A 2W58A 3HVKA 1I24A 2BYTA 4I3GA 1MEJA 3FBTA 4PHTA 4RK1A 1FRQA 1W8DA 4OBEA 1KARA 2XHEA 2X0RA 4NULA 4PX3A 4DARA 3AR5A 2PZBA 2EX1A 3U5ZB 1PJRA 1KEKA 1P0QA 3KUCA 4O4IA 1SD2A 2RIRA 4KQ2A 5EJAA 5K8IA 1CZLA 5KQLA 1X38A 4LSMA 1O6CA 5HW0A 1QH8B 1NR1A 1Q82H 4DVJA 1P7PA 2BP7A 3EXIB 5A4IS 2IYLD 5DXJA 2K2WA 4K03A 4MHTA 1HG0A 2P41A 1UADA 3KJGA 3ROPA 4DDHA 2BGLA 1EJ0A 3DFZA 3K72B 5DV9A 5CURA 2R48A 3DO5A 1DTWB 2O9JA 4FS8A 3DEKA 4YNBA 4JOQA 2WD7B 3S8MA 4GW3A 2R8XA 4WNAB 4C05A 1W52X 1GOTA 1OIXA 5REQB 3W78A 4MAMA 4C1NA 4C3VA 3ILVA 5ALXA 4URVR 3PPIA 3DLTA 3MMZA 4GSLA 4QDTA 3ROFA 4DNFA 3UJCA 4N8SA 2RK4A 3OLXA 4ARBA 4G86A 4IH4A 3LF1A 2YXLA 5B7PA 1Q1EA 3B5IA 2IIPA 1N36B 3Q72A 3PQ7A 4MP8A 1HRKA 2CT8A 4LRWA 4LV5B 4WXYB 2ZWMA 1K6EA 5FNZA 4EL5A 1U1EA 3HYCA 4KL8S 1XKQA 3VPFA 3I55F 1OXVA 2JD2A 3G7UA 4TTQA 4UMEA 2OVBA 4XRRA 3ZIAA 2JL1A 4Z1MA 1GSOA 1FXSA 4DSNA 3Q8LA 1H5UA 4X6YA 4MV0A 2XW6A 4ALIA 5LDGA 1V45E 2R79A 3CWQA 5EWJA 5IAEA 3UB3A 2PRJA 1JTEA 1K7SN 4WEQA 2O8EA 3P7MA 1AMUA 4B7UA 2Z58A 4NU8X 4LZZA 1Z5ZA 1C9NA 3CU5A 1U4OA 4ZODA 4U7PB 2B37A 1JKFA 1FVHA 4RTNA 1QANA 4H7JA 4IHJF 1SFRA 4M1QA 5TV2A 3RTDA 3W5VA 4F3RA 4JI0B 2YIJA 3I42A 1OTXA 4KXYA 3KLPX 4EYGA 2AK2A 2RK3A 2WU8A 2YVAA 4GXRA 4G8BA 3NBAA 1P4RA 3WGQA 1XCGB 2WTMA 1MR3F 1T2UA 3OE1A 4JL8A 3V48A 5CJPA 3O8QB 4CKEA 1JEOA 1GL9B 2H48A 3ESZA 5HFAA 5J4HA 3AXTA 4QBFA 5JROA 3ZLBA 2K2QB 1ACLA 1OE0A 3DDOA 3NYQA 4FD2A 3X1YA 2GLTA 5KVVA 2IHJA 1YO6A 3WGTA 3NANA 4KE6A 1YR9A 3HLYA 4TXMA 3L82B 3EHEA 4QGBA 5J3JA 3OLCX 3DMDA 3G49A 4ZQHA 3AR2A 4Z0TA 3RUIA 3WOVA 5IDQA 4Q6WA 2GILA 1UKBA 1NHGA 4L75A 1BKDR 4MPRA 5E6UB 3NVIB 2W2MA 4HN4B 1JHAA 1UKEA 2JFZA 1D4FA 2BLLA 2YH2A 4E1VA 3D64A 3CX8A 1NUUA 4J75A 4LK2A 4CMBA 2DHDA 1CUUA 1FSFA 1NDQA 3AR8A 4N82A 4TYMA 5CFMA 2XQJA 4D4GA 2WFZA 1NY6A 2AKAB 2JCXA 4G1EB 5ELMA 2PGOA 2QR3A 1DQSA 4ILEA 2QGZA 1NNUA 3L8ZA 2I4RA 2NW6A 3JYPA 4JBXA 3K6SA 1KAMA 4G4GA 4ZZIA 3U7EB 4X66B 1M2VB 4ESVA 3RARA 4WNCA 3SF8A 4J0FA 5KDLA 2IYZA 4XCVA 4ND2A 3UJBA 7GPBA 5BW6B 4N40A 4R8MA 1P31A 1I51A 2J0VA 2XVYA 3G2PA 3U26A 1KXJA 4F91B 1WXXA 1XP5A 3RFFA 3RU3A 1UFKA 3WMGA 3I4FA 3A9VA 4C0JA 5HZGA 1ATIA 1N2CB 5A4JA 1IPHA 4Y98A 3W1WA 1G8MA 3N87A 4V1CA 1KVQA 1O03A 1QNFA 3PZRA 3D7RA 4W8GA 3SQMA 5FNVF 4QGHA 4Y2YA 4CEJA 4OI1A 2QT1A 2CNWA 4LHZA 3QFFA 5I7HA 3AVYA 4L0DA 1ZUNB 5JTUA 4L4ZA 5A2QA 1T9CA 4CKCA 1KS9A 1XVUA 1DZ3A 1ZD4A 1XQYA 1VE9A 3AWIA 5IJ0B 2DBQA 4FOSA 4EY8A 2WV9A 2WYOA 2Q0QA 1RWXA 1UC5B 3RBAA 3WLIA 4EIWA 3FCUB 4AQDA 4NCBA 1H85A 1F8GA 1NJ8A 1PZNA 3V3TA 4MRAA 1L9KA 2B94A 2H0RA 2WYUA 4WZBB 3P9PA 2R00C 4P82A 4F38A 5C2JB 3K2BA 2PUHA 4G1BA 3QFCA 3Q9NA 4RZSA 1YACA 1IZ9A 4IP0A 2HA4A 4TWJA 1FYEA 2EGHA 5E6SA 4BQOA 2VH1A 1K3FA 5JADA 1CE8A 1ZK2A 1T5LA 3OJFA 1DEAA 4JROA 1W57A 2F8LA 4KI7A 1BFDA 3TE7A 3ZJVA 3ABRB 2GM9A 1WU8A 3O4GA 4BMVA 1P7YA 4I0WB 3F74A 4BLOA 2EEZA 3H3FA 4JC8A 3ZU2A 3M6IA 2B4KA 1IN7A 4EO9A 2IHYA 1RJDA 2WDPA 2NO0A 1LI7A 1RWKA 2E87A 3O1IC 3ONVA 1CDZA 2G4VA 2L0XA 1LDNA 2OKCA 1EUZA 2WKPA 3BH6A 1EXWA 2RI0A 1IATA 3HWWA 3KVRA 3KZXA 4LEIA 5E9JA 3TL6A 1SCJA 5T4EA 1QF6A 3GRZA 2NZJA 4TZ0A 1A1VA 5FOSA 1QBKC 3C70A 2QEXF 3N86A 3DXYA 4KXXA 5H3HA 4XQ9A 2Z8ZA 3R6WA 2I66A 2X2PA 2FVXA 1QCDA 5ALMA 4E30A 3PVZA 3TZHA 3IP5A 3KYCB 3LFHA 2B2CA 4B09A 1JDZA 1Q5PA 3BXZA 4WWHA 4BVHA 3B1WA 3WTBA 4EEXA 4UTRA 4AY4A 2OB1A 3TNLA 2GEVA 3IAXA 4KXQA 3HB5X 2Y92A 3R8XA 3SZLA 3WJ2A 4YASA 4B45A 3PQEA 4A0RA 3A4TA 1BD4A 2V9PA 4BTEA 4ZTUB 2Q4RA 3GUHA 4BFZA 3MSCA 3COJA 5BPFA 3QOWA 3HWX1 3H3JA 4MP6A 1J21A 3S7TA 4B6PA 4K1LA 3OZFA 3QUAA 3V9AA 3GFPA 4Z0HO 3GWZA 4BMSA 5JNRA 3DOHA 4ITRC 2EP5A 3IOEA 4RPIA 4YQFA 3WAKA 4N5DA 1Z37A 2V9YA 1ORWA 4YECA 5JDIA 1OBVA 3IXQA 1CEYA 5ELLA 1L8OA 4UM8B 1M3SA 2A33A 1MZPA 3UJHA 2GBFA 1ZISA 3KK0A 4ZC1A 1QRAA 1TPZA 1SB8A 3F96A 2FE4A 5KSOA 1RQXA 5ALJA 1I1QB 5FOWA 3ELCA 4ARCA 3TR6A 2EWWA 1VL1A 1U0GA 2PIDA 3EJWA 1SBZA 4DQXA 3TTWA 3KJIA 2PCJA 1VA4A 5D2CA 1N2JA 4NL4H 1T4CB 1TF2A 5D00A 2C2YA 1UMCA 1QRDA 5AOAA 1GNRA 1A82A 1IDOA 1Y1QA 4PQRA 3T7IA 2B82A 1N5JA 3EXFB 4R2WA 1DIRA 3NAZA 3O4IA 4YJ2F 1NVGA 4Q15A 1Q15A 3H9JA 4JB0A 3KFXA 3VC1A 2A84A 4ATNA 4R01A 4QSHA 3KOMA 3BSSA 3QUQA 4UTPA 4K1XA 4YWHA 1IN1A 1NMEA 4R6WA 1MH1A 1OROA 5DDIP 2CHTA 2A9KA 3FNGA 1JQLB 3PPYA 4IZIA 2CL7X 3RA6A 1RBZA 4W1QA 3OPYB 5K3FB 1VQNF 5CYGA 4BNYA 3PYMA 3JAMA 2BHLA 2YXEA 2PN1A 1C3XA 1NMZA 4MWGA 3ZH9B 2ZVQX 1B42A 1TFUA 5LMCA 5CCXA 4LSWA 1EK1A 1RYBA 4ZAVA 3GDFA 3PCTA 5IRCD 2CXTA 2BH9A 4EVSA 4AX4A 4XJSA 2VK8A 4ZFNA 2HFJA 1AF7A 2FK7A 1L5VA 2IQ5A 4U7WA 2QPTA 1V7CA 1G38A 3I9MA 5A71A 1J8VA 1VMDA 4GKVA 2CVPA 4MS1B 4WESB 1OFTA 2OBLA 5H16A 1KE1A 1IM5A 1O54A 1XLTC 2CZGA 3T1VA 1U0RA 2A9FA 2AZTA 4NNPA 4G36A 1G7TA 3K9HA 1OREA 4JOCA 2VRCD 1UZMA 2ZM6B 1G8KA 3UJ3X 4EW2A 3PU6A 2ZBQA 4M9ZA 1CSEE 2YR0A 3AERA 1CR4A 1E7RA 1NVVQ 4E2FA 5LDDC 1WA5A 1Z75A 3BBLA 1H22A 2F48A 5LC1A 5TT0A 4XARA 2E7ZA 4KPUA 3I01M 5AO9A 5BURA 4H15A 1JFTA 1PHRA 1TJYA 3WKDA 3EXEB 1BQEA 4NAVA 3KELA 2AT1A 2P11A 4FNGA 1SU6A 3PNYA 3W3AA 5EMHA 2A1UA 3IRVA 5ILQA 2MSNA 1P8AA 2P5UA 5DVZA 1XMOB 1PL8A 1TCAA 1NSTA 5I51A 4QT0A 4PWTA 3D5EA 4KTTE 5DBIA 1ECCA 3GV0A 3NV9A 2XTJA 4Y2XA 4P36A 3UOAB 4EYEA 3IAEA 1CUCA 3BDVA 4I6EA 4IIEA 5BOVA 3NWOA 2HM7A 1HE2A 3RBXA 2HF7A 1NVDA 4NMMA 1TNDA 1Y6GA 3ON1A 4KGZA 2C00A 1MIHA 1U0NA 3BK7A 1E1YA 1GTZA 4KN9S 2WJHA 1RI2A 3T3GA 3ZI4A 1AB6A 4UFPA 4IIYA 4L5AA 1VG9B 3ZU6A 1BDBA 1YZFA 3CMAF 3LDTA 3UJNA 3T1QA 3R77A 2F3TA 4X91A 4Y9DA 2G9VA 5DCUA 5THKA 3W79A 3DV0A 3EYWA 1PL6A 3DO6A 5LOVA 2VBIA 2ZIAA 1DKMA 1LUAA 3Q5DA 1JZSA 1XVIA 3UWOA 1E89A 1QHHA 1Z7WA 2IE0A 3K0FB 4RS4A 4AY3A 4GZ5A 1RXEA 2GXQA 3KYIB 4KGVA 3USCS 4OHYA 4CKZA 3CLUD 3K70D 1AV6A 3THOA 1D07A 4BEBA 5LFAA 2R11A 5KAMA 2OT3B 4HNQA 3PKZA 3L0IB 2H4JA 4I08A 1L5QA 1T8WA 2QROA 4ALNA 1A7KA 4CDGA 3U9LA 3NRJA 5ESRA 1RFLA 4ZMSA 2AZMA 1FUIA 3HO8A 1GFZA 3OM9A 4FINA 3KAJA 3DWIA 3GZNB 4RHFA 5JAUA 1N9ZA 1MO4A 1JFSA 3DTTA 4ON9A 1BHJA 3IIMA 1EP3B 3WBFA 2YY5A 2GUWA 2JFNA 2NYVA 2RG7A 3MD0A 4M1ZA 5FYDA 2AUNA 1GPKA 3GQBA 4FBGA 1ST3A 5LA6B 3RVRA 5JEDA 2AHRA 1RSZA 2QU8A 2XBLA 3BMCB 3UANA 2EYQA 3PXUA 3P94A 4O29A 3C9SA 5EUBA 5FR2A 4YT2A 3L7NA 1PJZA 3HKBB 4M0CA 1JEQA 1LF0A 1C8VB 3H4TA 1W44A 4H60A 4RNCA 3E1SA 4BB0A 1R5OA 4HQ6A 4W5WA 2C9MA 2HNBA 3KYDB 3TLZA 3AMVA 3VJRA 5BSFA 1SBTA 4JI8B 1K73H 4BCCA 4H7FA 5SZIA 1NLZA 2EJVA 3O8OB 4BZWA 4E94A 1KAOA 1NXOA 1QFSA 2EFEB 3PRJA 1GT6A 5DLQC 3T9BA 3K12A 4DSTA 3WL3A 4UTNA 2NXNA 4I2NA 3NUGA 5LLTA 3ZD7A 3ESRA 4FBLA 5CXSA 5JAQA 4POAA 3ZCXA 5P21A 2IZ6A 4B84A 4C6TA 1GTL1 3OE4A 5CH5A 4RQAA 3BZWA 4KGDA 4TSFA 1HDXA 5FD8A 3SC6A 2TMGA 1UZAA 1W5FA 1YBAA 2A92A 4BVQA 4BE4A 2G7MC 5B55A 3AVTA 3CCLF 5GONB 4ZVRA 4I55F 3WNBA 4LOAA 3KYDA 3DXZA 3GNTA 1DG9A 1I8TA 2JIQA 3JWJA 4BDTA 4E5NA 4RORA 3LH5A 1ELOA 2RFLA 5TRTA 4YJ3A 2MSLA 4CTOA 4GMXA 2YV5A 2C7RA 4Q82A 3W0LB 5JJKA 4IHAA 1VLLA 1R1MA 3KSBC 4QU9A 5TQ0B 2JGDA 3L9XA 1NQWA 1T43A 1Q7CA 3PL1A 3KSRA 4TMXA 2AH5A 5IH3A 3MDOA 1QDLB 3QU7A 5A6SA 3D1LA 5IVIA 1R37A 2AS0A 4JEIA 1FYVA 4BT2A 2YBEA 2VJLA 4NEGA 3M0EA 1Y8CA 4BP3A 2PSFA 4DT1A 2R8YA 4IFTA 1U2GA 1LCIA 3CY6A 2W6NA 3AI3A 5FQOA 3MUFA 3I45A 4QJIA 3U0BA 2QIPA 4W5RA 4JQZA 1FFAA 1RABA 2AFHA 4I4TB 3DH0A 1HLFA 4IDHA 1E6EA 1ZONA 3UY4A 2O3SA 3SC3A 1LS1A 3L04A 2W6ZA 1EP9A 3OCJA 1R8SA 3VDXA 3WICA 4E07A 4QG7A 2BTOA 1EUDB 4IIXA 5F1PA 4N6NA 1JX6A 1U80A 3A0RB 4P7JA 5DU2A 5K6RA 2VAWA 2WIAA 3KWFA 4HN2A 1FL9A 3ZCRA 3D6UA 1E2KA 1PUIA 1OIVA 3PNBA 2X0KA 2ZUDA 3H8VA 4R3WA 1ZCBA 2KSQA 5F4ZA 3HAXD 4TZ6A 2KMLA 4ANFA 4B3MB 4OK3A 2J87A 3AR4A 3VR4A 3K20A 5BSEA 2X0DA 4AZ0A 2CCKA 5DHPA 2JLVA 1KP9A 4KO1S 4H35A 3FKQA 4IR7A 4OQXA 4MS3B 4C4ZA 2GA9A 5IEJA 1LNQA 3KJHA 1N33B 3JTMA 1AX9A 1OY1A 3GUZA 2PR2A 4N5LA 3VPSA 4K2HA 2ABWA 1TADA 3VJKA 3OMXA 5F77A 3CKKA 2HQOA 3GMTA 2NT3A 3G4SF 2YJTD 3OQBA 1UKVY 1E5QA 4KMSA 4JUDX 4LHVA 1Y9AA 4OMDA 4YTEA 2WD7A 3VNUA 1R0BA 4RW0A 1PNTA 2JGDB 5D5PA 4GOND 3STTA 3SF0A 4YMUA 4GC5A 1GFWA 3IP3A 1OXTA 1I6LA 2R6ZA 4RD3A 5ALDA 5JRJA 1TCUA 3USES 4YMVA 1KQGA 5LP6F 1GNSA 4F3KA 4DR2B 1QQ5A 1ZN7A 3GVPA 4RVCA 4UHFA 1LBIA 4OYRA 2X0FA 2W2LA 4ZPJA 1Z0UA 3OE7A 1KWGA 1HOTA 3RDPA 1BFUA 1DBSA 1MQ8B 4FQ7A 4KE9A 1V8ZA 4K9SA 3G6WA 5F21A 1LV7A 2XEXA 5LMZA 1OA1A 2Y1CA 1KI4A 2LCIA 4GBGA 4XYLA 1LNZA 3G5LA 2QJFA 4HNVA 4P92A 3V7UA 2AL7A 3TGWA 1QCCA 4HWTA 5BRNA 5DNYB 1AUQA 3GBVA 2XOEA 2DRIA 3B9PA 5IAKA 3CH7A 3KKOA 2FN7A 3LXXA 3AESB 4WLEA 1RC0A 4LJ6A 1U8CB 3DVAA 1WMDA 5J4LA 1FYWA 1U98A 1JHYA 2P8SA 3CUKA 2UV8A 1AOXA 4LX0A 4NRDA 2I91A 1XYYA 1CQIA 1KRHA 5AVXA 3BT7A 2JH8A 2ZRQA 3THWA 4BEWA 4MVJD 2VJNA 3K9FC 2NO1A 2BKEA 2JFYA 1M7HA 2QE6A 4GZ3A 4N01A 2ZT8A 4RJKA 5HP4A 1PR9A 3PVCA 2FRVA 4N7RA 5L7TA 3UA4A 4EUFA 5T6MA 5IKXA 4MQBA 3Q7RA 2MT9A 2CHEA 2QNBA 2CEAA 2NZUG 4HRAA 1NP6A 3D2CA 3C98A 2YS7A 5G4KB 2C82A 3RS9A 1U8TA 1WCIA 1JMVA 1WXFA 1ZRMA 3D54D 4JLDA 2F1RA 5A0TA 1WJGA 4M9UA 3KRTA 4MHSA 5KYYB 3DVAB 2ALEA 5AHXA 3L84A 1SDSA 2DU8A 2WHQA 3LV8A 4RDXA 2H5EA 5T6BA 1CUAA 1VPLA 2CZQA 2YFHA 1EVJA 2NO9A 2C7VA 3AF3A 2L42A 5TEVA 4NCNA 2VQ3A 4Q21A 1SCUA 3DAOA 2YJNA 4WBSA 3UV7A 2WMOB 4D02A 5FBVB 2XWQA 3KPYA 3CCBA 4B6RA 1PVVA 2AV6A 1PQYA 2EZ8A 1KEUA 2FSIA 2GN1A 3NP9A 1C7ZA 2CD9A 2ZJ3A 2OORC 3C3PA 5D5QA 2Q9UA 1NDUA 3M5CA 2O6LA 1K0FA 3OY2A 2IKQA 1BC5A 4G4IA 4LOHA 5AW3A 4Q1FA 5HRUA 4UNRA 2PMFA 1V3TA 3FMIA 4NABA 4IJVA 4E4TA 5AVOA 1HSZA 3L7MA 1NBIA 3NDJA 1KGSA 5AVJA 2AG0A 1BKYA 2DFLA 1GYRA 4TZTA 2PLNA 3G5UA 5FHQA 1WV0A 2PUWA 2P6PA 2CNBA 1GZSA 2B5VA 3K2QA 5A9TA 5IWCA 1FP6A 3KVNA 5DM2A 3NHYA 4AKTA 3U16A 2MYNA 5AQEA 4YP7A 3DF7A 5K3BA 3SZRA 2MHCA 1D4OA 3VOSA 1N2SA 2OLKA 4JELA 2VRCA 1KNKA 3FB1A 3IT2A 5F7JA 1MNQA 3QWBA 3SSNA 1Z8DA 1KQOA 1WUYA 1W34A 4X1KB 5FL3A 2C59A 5SYMA 4RIFA 2G06A 5JFGA 3GFBA 5GAPK 3NAMA 4NXNB 4IUBS 1TAQA 3PZBA 2JLRA 4RXUA 3IKLA 4CM1A 3TZQA 3LY9A 2Y93A 4Q24A 4M1SA 5I7WA 4CGZA 1VRVA 3KKZA 2P3OA 4H0NA 4Z4FA 4MW4A 3DV2A 2X2EA 4CQMD 3GLFE 4UW9A 3U3ZA 5B7NA 3RV3A 4ZQGA 1E9FA 2IYPA 4TKMA 4JIGA 5JISA 4FNAA 2C7OA 3K0BA 3ZH2A 4E5YA 2J09A 3IAHA 4MTLA 1BSVA 4M99A 2OO5C 2H1WA 4BNDA 3VU9B 1OU0A 2ATEA 2RI6A 4DNPA 4NEQA 2J59A 1CE8B 3U31A 1GADO 4JP5A 2BM9A 1F17A 1NLYA 4DDTA 4FM9A 2YOFA 1MF7A 4ZDKA 1H8EA 2DLDA 1R8JA 3GXBA 2IS1A 4JLBA 3CF6R 3AL2A 1Z15A 1IAQA 2ZJ8A 3GH1A 2VT7A 5HS4A 2X2FA 5DLDA 2UYCA 1RKXA 1G20A 3X1DA 4HYQA 3TNFA 3IP6A 4JDPA 1X7PA 4V0LA 2AFHE 4FGLA 4HQOA 3GT0A 4MQ6A 1CF9A 2E1PA 2NU8B 5IPFA 4XXHA 5D3ZA 4CLDA 2WWYA 1XQ6A 3AVQA 1C8KA 4HB3A 1CLEA 4PLHA 4RIHA 4K2AA 5EXDA 5G0WA 3CYPB 4H1TA 3ZCQA 1G7CA 2FW6A 2VAMA 1U8FO 1YVDA 5BSGA 2HJHA 4OI4A 1P5JA 2GQ0A 3GJ8A 4BFWA 3C8MA 1CHDA 1O96B 4GOLD 1I80A 1H2EA 4HTFB 4RD0A 5FPSA 2BRUC 4JLUA 4HUQA 3RVOA 1BS1A 1BXRA 2CUTA 2EFGA 2EQAA 1IJBA 2GTPA 2HK6A 3K5WA 5DI9A 5EL0A 1FZQA 3D8UA 1RWBA 5J2TB 1LRLA 2HBYA 4AZWA 5KJFA 4MIOA 5TJHA 3HM9A 3PC6A 5DE3A 1LZLA 4EAQA 5F1YA 2Y9MB 4GPBA 4B3RB 2OGTA 1KEZA 1NC1A 1CZKA 2Q45A 3L77A 3O3OB 5HM6A 1P2SA 5FTJA 1K9SA 1TC2A 2FP4B 2P6UA 4OJKA 4R69A 5J1SB 4WHMA 1JDJA 1AXGA 3PC2A 5JH7B 3AR3A 4UVIA 1XD2B 1YFZA 3OECA 1ONSA 5BVGB 4CEHA 1JKIA 2INGX 2EHDA 3I58A 2XCUA 4UEKA 3ZE6A 4Z86A 4C0QC 4YAIA 5KX5A 3E5RA 4QPCA 3K4PA 3HHPA 3LW8A 1O96A 4J3FA 1NMXA 4NATA 3UAZA 3WZ2A 1NA5A 1VTKA 3BX1A 3EH1A 3M4XA 5IKPA 1LD3A 3J7AC 1P8JA 2X6RA 2PGLA 1IZYA 1CQJB 4JVMA 1KJQA 4OM7A 5FUXA 2AJBA 2C5FA 1CUJA 5FTNA 1G291 3UO8B 4YAWA 4R8RA 4Y2UA 5J5CA 1CC1S 2DR0A 3RVJA 1NHWA 2NPIA 3UATA 4HQRA 1XX6A 2J3QA 3EZNA 2X0JA 1QVAA 3R5SA 3WBBA 3B1FA 5B1IA 2IXBA 3D02A 3T9FA 2ADFA 2VYFA 4QKQA 4ZOEA 1WB9A 3AHEA 3X1WA 2O1EA 5F7XA 4OGKA 5JI3E 1GKUB 3F9IA 1QVVA 3EWSA 3SJ7A 1JA1A 3QE2A 1SVNA 5F52A 1KKMA 1KJJA 1IN6A 1OYYA 1ULHA 2RI1A 4MQMA 4S12A 3MJTA 5H82A 3IKTA 4DB4A 3NFYA 5CA0F 5D6NA 2QJOA 4GPTA 4XVQA 5KTMA 4IMJB 1QRSA 4UQOA 2D2IA 5BUZA 2DAPA 3DFMA 2H17A 1VYTA 2QKYA 1U2TA 5JAZA 3AR7A 5JJCA 4C07A 3QMWA 1VQ1A 4K6HA 5I9MA 4Z99A 1ZKDA 2R8BA 3E9YA 1O87A 1ZGCA 3M6UA 4OFXA 3TK1A 4B32A 4D96A 4UHJA 1L8QA 1UM8A 3KX2A 5BXYA 5IF3A 1ENOA 4TL6A 4YK7A 5KYKA 3P26A 2V5UA 2QZSA 4J90A 4TWIA 3T06B 2OVFA 4IKOA 4KXLA 4R0VA 3ZWYA 3BREA 4JXXA 4RAOA 1BMFD 5AK4A 4LXTA 3R0IA 3ZZMA 1NURA 2QX4A 3INTA 2D3WA 3ZY4A 4C4AA 1DWOA 5LA6F 4BNMA 1WCWA 1QZ3A 3HCCA 2VQDA 3O91A 1UBSB 3QVLA 4DHWA 2JANA 4JQSA 4AO7A 1K8AH 3DT8A 1Y9ZA 1T8PA 3RUDA 4YUWA 2J4DA 1L7EA 3D3JA 5JAMA 4MINA 2Z1NA 1ESDA 3TFWA 2V58A 4RKQA 4YRAA 1WPXA 1BMFA 3PEUA 5LL6P 5JNUA 1DJNA 3E58A 4A03A 2Q1WA 4DTCA 5K8VA 2R1TA 1Z2PX 2ZIGA 5I9IA 3UICA 2J3MA 4UUOA 1V1RB 5CRIA 2VJCA 2N75A 1I5OA 3HR7A 3I52A 4P7KA 3I04A 3QYPA 3UUFA 4ARVA 3JAMM 3TD3A 3QLVC 1L8XA 1SWVA 2HBZA 3LBHA 2WMDA 5LZ5A 5EZ6B 4QOJA 1RLUA 3QF4A 4IXDA 5IBPA 1T0IA 3TTXA 3AOEC 1LPOA 2PRKA 5MN6A 1V8OA 1J2TA 1TO2E 3NDRA 3GGCA 3NTXA 5KWVA 3GFRA 4EFNA 2VUSA 2XMZA 1DKLA 1GGEA 3BL5A 3CMMA 3Q3IA 2MINA 2P8JA 3G1WA 5CYFA 3K8YA 2NSLA 1M67A 1WCXA 1VGVA 4N12A 3GNQA 4COKA 4EGQA 2QMEA 3U60B 5KTSA 1TO1E 4J1QA 4NCJA 4TLAA 4B4UA 1K7FB 5FBLB 4UEQA 4PXAA 4ZTZB 4DR7B 3R9KA 4EVQA 2R6CA 1XZMA 3IEUA 1HUQA 5JBQA 1Y98A 2NSHA 3B7WA 1HQKA 4G0ZA 3SHWA 1X7YA 4LTNA 4JY7A 4WXPA 1IWOA 1PT6A 4LBVA 1QG2A 4U2KA 3SQDA 3FBWA 5BN3B 4DR1B 1P1IA 4GRDA 1GUAA 2YZNA 1RLMA 1XDGA 2MJLA 3PCRB 3F71A 5K3FA 4BLSA 3I6IA 4DCOA 2R4QA 3Q4GA 5K3OA 3AFNA 2EKQA 2OWDA 3DGEC 2NT4A 2P27A 1ACJA 4IG9A 4Z1MD 1SXIA 1G64A 2HDOA 2J5QA 1Z16A 2PV0A 4QSMA 4RE5A 5HKOA 4ABTA 1ZXBA 2AYZA 1VIVA 4ZDWA 1ZA2A 3B8EA 1XF1A 1E6MA 2V6IA 4I5GA 4KEAA 1E1CA 1T1RA 1V8BA 5BSUA 2AC2A 2EATA 4AWBA 4WI1A 1YK0A 1IWBB 4ONEA 4ZV7A 1TJNA 1WL8A 3GW8A 2HPAA 3M83A 3VAZA 3FD5A 1EDDA 2X5XA 1Y42X 3T0GA 1H0SA 5KQGA 4J3JA 5CA1A 1DQZA 1L5GB 5FTLA 2QY6A 2FXIA 4D9JA 4MEJA 1WLSA 2IGBA 3UXEA 1G5HA 4OAOA 4GM4A 4OKSA 3ITEA 3ZLTA 1I33A 1EK5A 2XZDA 2QN6A 5EFZA 1HYHA 4BMZA 1W41A 2PKXA 2UZ1B 4BNHA 4IGEA 5I3CA 3K6KA 3LWVC 5JZOA 1X9GA 4NICA 4JJ8A 3HJAA 1M2KA 4DQ0A 4HFJA 3I0MA 4KX3A 4QQFA 5HJ5A 3AYXB 4LWPA 3GRAA 1OT5A 2JLYA 1I1NA 4LJ4A 1CF4A 1TYZA 4B3JA 1K9MH 4LGCA 4H0FA 3NBQA 2D0DA 2ZAOA 4OGGA 2VQSA 3DL0A 5CFNA 4RPLA 2IY7A 5HIJA 2VF8A 1C30A 1PZXA 1E63A 2ID8A 4HAZA 2X14A 5LYJF 3LWBA 3T4UA 2WUVA 5GM2A 1UAGA 3PNLA 2HB6A 2QR2A 5EMKA 4Y9UA 1DQRA 1N32B 3DEYX 1K0UA 4L72A 3W77A 5H0IA 3IUNA 3PEYA 2PVSA 4N7MA 4TLCA 3WGNA 3DEIA 3I2YX 5KPJA 4CFSA 1VKOA 1C8BA 2KBEA 2VPTA 1JIJA 3PLRA 2P9EA 3ZY3A 4X45A 5B57C 1FSPA 4ER5A 3SMVA 3RYFA 1J7HA 2FPSA 4QASA 4Y67A 4DG9A 1CR6A 3MLAA 1HDRA 1RJFA 1JSRA 3I9OA 3AI7A 5CX4A 1QV7A 1GQQA 1GL3A 4CQLB 1BU5A 5DBGA 4CMCA 1AKQA 2ZWVA 4MQEA 1EUQA 5F2EA 4CR8A 1FP4A 1CS0A 1Q0UA 3DTVA 1HLPA 2BUBA 3MTJA 4IO1A 5IVHA 4R7GA 1M1YE 3A6FA 1KR5A 3FOZA 1IOZA 3IEKA 1IZ8A 1Q7GA 4J7CA 3GLUA 5JZSA 5CDGA 3OZSA 4J7XA 4LHWA 1TMKA 4D0SA 4QBTA 3IR5A 4MGHA 4XQGA 2V8OA 3EVCA 5FBHA 3V4OA 4AMUA 3IDOA 2LDBA 4MUXA 4UCWA 2EF0A 3D01A 3TCXB 2FY8A 4DABA 1FCJA 1TX4B 4D8XA 4PAQA 2QRJA 2VP4A 3PQ4A 3ABZA 1OGIA 3JV7A 4B7XA 4BUCA 2DPHA 2Q4OA 4L3VA 3TGPA 3FTFA 3KR9A 1PJSA 1JJ7A 1Z4JA 2Q0XA 2ZRLA 4RVNA 5ALSA 2HQSA 3VR5D 2AG8A 4FFDA 4YUAA 3ENWA 2ZRKA 1RAAA 3I2HA 3DS8A 3AXSA 3D7MA 2RBKA 4BIIA 2XWBF 1CNMA 1E9DA 1MTZA 4KO4S 4I14A 4LMPA 5DN9A 3T1HB 3QWHA 4JNKA 3WLSA 4E2ZA 3RHSA 3RRBA 1NMSA 3G82C 1JKJB 3L07A 4DMMA 2AW5A 3DTYA 1FXWF 1H4VB 3MELA 1U2SA 1MT0A 1RIIA 4G67A 1TCBA 4DCJA 1NMUB 4H7HA 1DAHA 5CMLA 1SXJC 4DMHA 2GXSA 1XP8A 1V9LA 2OECA 2H9YA 3SQNA 2MSKA 1CY2A 1FC0A 2P68A 5B30A 1KGDA 1ISHA 1Y8AA 2JJYA 3QVVA 4EZEA 3CO5A 1DIBA 2C2WA 2JJ1A 4C6TB 5JASA 4E5KA 4C22A 1N6NA 4GM1A 3TQCA 3HCRA 2VL7A 1HT1E 3HQ4O 4XTRA 3I9JA 1ESZA 2Q50A 3DOOA 2CEKA 3EA5A 5J1TB 3VMFA 4F5YA 2JIOA 4ZHQA 2EGUA 2FKNA 1PFGA 3WJPA 1NI3A 1QPBA 3EEYA 2LBTA 3O8OA 4HCJA 2XF8A 4JLVA 3K70C 2O5EA 1KI6A 1TKRA 5FBWB 1PX2A 1X1TA 2FMXA 1O6ZA 2FR1A 2Q8QA 4WKPA 2BRUA 1A8SA 1J1IA 1TI7A 2WJJA 2WJWA 3AZOA 3PSHA 1QIFA 2ZRAA 1KD1H 1E3SA 2C5EA 2I2XB 4KG7A 4NQRA 3EC1A 1E92A 1I32A 4JR2A 1NBHA 3DMNA 3K0AB 4WERA 4CLOA 2WWTA 4CMKA 1XV5A 5GADl 5AJWA 1KKUA 1NXTA 1PNVA 2OHXA 3AHHA 3OZRA 1C1HA 1EGVB 1SKAA 4LDQA 1H9BA 4PR0A 5DKFA 3MMNA 2WABA 4X84A 3MCTA 3UHPA 2QNRA 3OBWA 3A6HA 5J43A 2PL5A 1G20B 4RESA 3BKWA 2F4NA 2AXNA 4R2IA 4F72A 3X1KA 3THWB 3TDMA 3WLQA 3IIJA 2I76A 3SICE 3TIFA 3KKMA 2JFGA 2F67A 2QLNA 2AN9A 4MUMA 5AFSA 1C4KA 1ZRHA 4C82A 1K92A 2UVPB 5LNK1 1JBKA 1EP1B 1K5GA 1E1KA 5MFPA 1A8UA 1FE8A 1KQNA 2H3HA 5E6RB 4PAGA 4EUHA 1B93A 5CBKA 1EUDA 2IX9A 2PX4A 3RHZA 1L7MA 5T4HA 1Y1SA 4AJHA 5I7SA 3DZ8A 1NVUQ 1SGWA 1UJNA 3FJYA 4UQPA 1ZI9A 3KZOA 2O8EB 4WNYA 3UGKA 1N1GA 2FU5C 2HU2A 4HUJA 4ND4A 3HSKA 4PF1A 4JQYA 4REQB 4L8GA 3HE3A 4Q48A 1HURA 2GI4A 1F3OA 1MOSA 2WSIA 5E4TA 4F4CA 5CFLA 3GPBA 1VYVA 2YUIA 4OHOA 5E9QA 4R83A 5HOQA 5KQMA 4P3PA 2FP4A 1YL7A 3N70A 3T7EA 4M8SA 1NW7A 1PZMA 3G89A 3WKEA 4BNZA 1MC4A 1SIOA 1ZIYA 4KSCA 1GO0A 2XTMA 5H5JA 2IHKA 1G20E 1Y63A 2OAP1 4HBGA 1I1OA 4KLAA 4CT4B 4DDMA 3I2GA 2QP9X 3K2EA 1FU7A 1HKUA 1G55A 5FO1A 1WS6A 2ZJ2A 3DBRA 2B8NA 1OFUA 1NJGA 1Y1TA 4QO8A 1K98A 2O2SA 4XWTA 5FTWA 3N2GB 4CLOB 5B12A 3T5PA 1ZRNA 1MAVA 3WYNA 1P3Y1 1U3WA 1RXVA 4DHEA 4UHKA 2WWGA 2YWXA 1JFLA 3RRFA 4ZHSA 1NJFA 2C9ZA 4K9DA 3WAGA 3DE5X 4I8DA 4DNQA 2WR8A 1R0ZA 1DKNA 3FVVA 3IVAA 3PX7A 2O8BB 4L8LA 5IFKA 3GJ5A 3GROA 4OL9A 3BWYA 2ILTA 4A73A 3D3EA 1JR4A 1XRRA 3KHTA 3AEKA 1II8B 2YX1A 3FWPA 4JX9A 4V0NA 4BX2A 2X13A 3CVWA 2CSUA 2OV8A 4AXBA 3C9RA 3ZWXA 2P9GA 5ESXA 1BW9A 4CM3A 2XMQA 3E15A 2B1IA 5EJGA 1A0OA 1JG3A 5C51B 2OFPA 2BFBA 2CVLA 5C8YB 2PCLA 4JR0A 4R40A 2AOUA 4RA9A 5IBCA 1MH9A 2ZOVA 2I4LA 2Z5FA 3K94A 1JALA 3REFA 1ZK1A 4M7RA 4B6GA 3QPBA 1JAHA 5KIAA 1S3IA 4BFUA 2YRWA 2ONZA 4TZZA 2FPPA 2H2AA 3QLVA 5SYNA 4C2UA 5CTAA 3HA2A 3SEFA 1UFVA 1A9XA 1C8LA 1K5HA 4KJXA 1YXMA 3RFTA 3SFTA 3ONNA 2F62A 3OIYA 5F3WB 1D6SA 1ZPDA 3EGEA 4MKRA 5J2UA 3EIXA 4QG3A 4X1YB 4B7CA 2IWRA 5BWOA 2VUUA 2B9EA 4RCVA 4ZEVA 3IIEA 3S55A 4XX0B 1W75A 2KPOA 4IOMA 2DJIA 4B7ZA 4HJRA 3KYBA 1UC4B 1P7WA 5DHSA 1CQIB 1LKZA 4KIWA 3WO1A 3TQRA 5CCBA 5LD2C 4K0KB 1YWGO 1FRNA 3C6ZA 1NUPA 4HXFB 4WNIA 5A02A 4BMPB 3GUCA 1TA0A 4QVGA 4EDFA 2PSSA 3RSZA 2B9VA 2JGJA 2K4MA 2VDLB 2NSJA 3QE3A 5L3QA 4NKRA 5TVKA 2PUCA 3SJZA 1ZWZA 4U63A 2NTNA 2WYWA 1K08A 4GI2A 2GZ2A 4EELA 4MB0A 2NU6A 3L7IA 4B7AA 2FGYA 3E0QA 5ALYA 4B6EA 2QQEA 4TQUS 5BR1A 2CJYA 1IUNA 2H65A 2P1DA 4DLZA 2C2GA 1U9YA 3AEKB 3LWDA 4NBVA 2VJMB 2OO7A 1ADJA 5I7EA 4FZ5A 3QUWA 3KQHA 1HQDA 1MJHA 1OTHA 1YD7A 2BTQB 2FUCA 4WCFA 4XR9A 5E2IA 1FY2A 1X0VA 2QRLA 5TMEA 5JHGB 3B2NA 4HVAA 4YP1A 1BXKA 1PLJA 3H16A 5C34B 3TJMA 1AMOA 1Z08A 4F84A 3V33A 3PNKA 3ZWKA 2H2DA 1SVWA 4LZJA 4EFDA 2EW2A 4PNZA 3S8YA 1U8AA 1IJEA 1EE9A 3HY4A 4CCYA 1EFKA 3OPNA 2YOHA 2V7QA 4BMXA 3H9UA 1LW7A 3DBHB 4NFLA 4BB5A 1IOWA 2AIZP 1NX6A 2XH8A 4NAHA 2C88A 4HG2A 5C81A 1QQAA 1J33A 5AKIA 4QDUA 4LI0A 4BUZA 3R0QA 4D4MA 4DZTA 3CVUA 4FWBA 1GZVA 4ZAFA 5LZ9A 1XVTA 1F14A 1C7QA 3R5FA 4KK4A 3ST7A 5LQDA 3V8BA 2MSCB 2ZWIA 1U43A 4I8XA 4NI5A 4Z54A 2Y0CA 1CTQA 3I61A 1I94B 4LE2A 3ZLVA 1XZPA 3IKMB 3MLBA 2Z1DA 3QNUA 5E3IA 1ADGA 1RACA 1TM3E 1GIAA 3HM2A 2R6AA 3TW8A 4DSUA 2C77A 3IMKA 4NENB 4P1ZA 3QKUA 4F2GA 4HLNA 5BSWA 5IN4A 4RD4A 4DM4A 3VU0A 3LWOC 1PD1A 3ETJA 3LZCA 5DP2A 5ARDA 1XVVA 1QIGA 2GX6A 2MYTA 3FM9A 3HGQA 2Q46A 4GE3A 1E7QA 4FFSA 4HB0A 4C7VA 3VSBA 1EWRA 1UXHA 5L45A 2CCJA 1W1UA 1HZJA 1ZR4A 1FU8A 1MRSA 3MS2A 4J2TA 3IULA 4GDFA 2W0MA 1VPWA 1VL5A 2ZTHA 4MR9A 4V0MA 4IZ6A 4I99A 1NTRA 3TPZA 4LSZA 4OQ4A 3GYGA 5KSPA 1E0AA 1Y6RA 1VQLF 1R3DA 4E12A 5L51A 2BMVA 2VNKA 3RUPA 4CV1A 1C4OA 4MB6A 1QX4A 4NP6A 2GZ1A 1W5TA 1RPAA 2C3PA 2I6QA 4MKXA 4YP0A 4BGUA 3P19A 2A5YB 5DI3A 1G42A 3M1XA 1QFYA 5U4XA 1QZTA 3NS7A 3FPHA 3TTSA 5HKAA 4RTKA 5EHNA 5EMJA 2O8CA 1V11A 4RPHA 1EM8B 1L2TA 1LK0A 4G1VA 4RACA 1JQBA 1Z7EA 3MPOA 1RE0A 4WLVA 1MD9A 1TECE 3GCWA 1GRCA 2HO5A 1BJRE 4C2TA 4QJ5A 4PLFA 1W88B 3F7MA 5G4UC 2CWJA 4IDQA 1V1RA 2JASA 3DULA 1P5FA 4Q4HB 4AO6A 4A92A 3H65A 3CEPB 1YDMA 4R0MA 1OAPA 1OH7A 4RFSB 3OM0A 1K9VF 2A59A 2ZUCA 5EKSA 1JA0A 4B2PA 1AXEA 1FXUA 3K0CA 2Z5VA 3HKDB 1ZVQA 4E3ZA 5ALWA 1KRXA 2VHTA 1XE3A 1TLLA 2HLPA 1NE2A 2WAYA 3LFUA 5EHIA 2EWMA 3V32A 3ZE9A 2XAUA 4Q1CA 2H5LA 2XCOA 4IW3B 1FS5A 4FT4A 3AEQB 4B3TB 4FDLA 4JVLA 1JJFA 5C8XA 4CYMA 2AI1A 2FDCA 2XDYA 3A6DA 4XLTA 5LUBA 3ZEAA 5ERGB 2GJ4A 3OZIA 1KMIY 1SG9A 1OBHA 4ND8A 1HZZC 5HIAA 4W1PA 1IY0A 3B89A 5IJ9B 1FP1D 2PM8A 4PNPA 2BF7A 3UIEA 2UZIR 2OY0A 1P9OA 1EFTA 2HRZA 2NSDA 2IU0A 1T91A 2FFHA 3FOBA 4TROA 4FGZA 3VYTC 2D8AA 3JYNA 3FPAA 1M1NB 3QVXA 4OYHA 5EZ5A 5IJWA 2C1ZA 3F90A 2EKDA 2O59A 1SXJA 1L7BA 2V5VA 3GNSA 1OJ7A 3GA0A 1CUXA 5BSKA 1UKCA 3F6YA 4D9HA 4P3YA 4UM9D 3MIIA 3NBKA 1XEXA 1RQLA 5IDYA 1KP3A 3H8WA 3A1TA 4Y0AA 3EDQA 4J0QA 3IEWA 4PVCA 5KPDA 4CIVA 3U7JA 3DOJA 4B2YA 2XGOA 5TQJA 2AIFA 1PFUA 2PT9A 4BU0A 5IYZB 1TRHA 5HRCA 4CMIB 4O3FA 3CSSA 1VA5A 1ZCJA 4ESEA 1AM4D 5BN3A 3CH5A 1T0KB 4K28A 3A6JA 4TWAA 5DGTA 2JIRA 3OT5A 3P5SA 5A0VA 1TIKA 2AKYA 1FP2A 2HNAA 1RJ9B 4KXMA 4DY6A 2AKEA 2R97A 4WVLA 2VTKA 1FNNA 2PQMA 3PQ8A 2AZDA 1EEHA 5AW5A 5CA1F 3BORA 1DJLA 4B5CA 3PQ3A 3BUSA 1YU6A 4CPDA 1OPXA 3I92A 4BVGA 3G13A 2YZ2A 1NR7A 2KLHA 3C6XA 1GFSA 3NNSA 4S1TA 3KJEA 5KNDA 3M4YA 4HQKA 3DKKA 5C46F 1D7AA 1YB4A 4UFNA 4IS3A 1G4HA 2D00A 1M1NA 4H4DA 1IHXA 1XV2A 3OCVA 3DVSX 1W8IA 4OLJA 3RSHA 3U48A 4YRRA 5EIXA 1I7NA 4OXIA 1LPSA 4AN4A 3G8YA 3KQNA 3FYUC 1YQEA 4FOPA 3P9RA 3OD5A 4FUTA 5IJ9A 1TZBA 1VKHA 1T26A 2W6ID 3WHPA 4DRXB 1G8JA 2YHIA 3GJ3A 1KC1A 3VU3A 5KYUA 3AF2A 1HTTA 4WDQA 1P1BA 2WFLB 5FI0B 3AQIA 3SXUA 4K9LA 2AFIE 4MQFA 1XNQB 5AXBA 1E1RD 4UBOA 1SBQA 1F0PA 1Q22A 3EFOA 4RWZA 5IHXA 2HRBA 5FH9A 4GEKA 4NZMA 2XKAA 4M8LA 3RS7A 4EBBA 1XZQA 1RPZA 3OMLA 3TSYA 1YR7A 1E2BA 2IH5A 5AUQA 1JHRA 2QTGA 4N03A 1U0JA 2QN1A 1SULA 4BT6A 2JFOA 3AUFA 4Z49A 4RSMA 4Y9RA 2HLHA 3PGLA 4P84A 2VLBA 5I9NA 3B52X 2I65A 2XGGA 4FKZA 2BM8A 2GKGA 3BTOA 2OCDA 3ZGZA 1FX0B 2BELA 5DGXA 1T9BA 1NC3A 1ZD3A 2RHMA 3QBDA 3G2HA 5HIMA 1Y89A 1WNTA 2LXNA 2QN2A 2X3UA 1JHPA 5JQWA 5J58A 4CL0A 3QI7A 1MQSA 3C85A 2VPQA 3BIFA 4IGKA 3ZJ5A 3T80A 4GU5A 2E4WA 2YWBA 3DD1A 1Q6YA 3LOPA 4DILA 2IZ1A 1LY1A 3S1AB 2B69A 2B25A 4K9RA 1A4IA 1U2DA 1OKKA 4Q0MA 1F9EA 1B0ZA 1WBDA 4PGGA 2GEUA 1RRVA 4E03A 2E18A 1U8XX 3E1GA 4N9QA 2H9AA 3PX2A 2C9OA 3ZQ4A 4NZOA 1ZM9A 4CLHA 1Z73A 5FUMA 4MKHA 5LM3A 4WCVA 3Q6MA 2J3EA 2Q1SA 3PQCA 3QEKA 4EY4A 1YNSA 3RT1A 3TPCA 1PK9A 1SBYA 4GYJA 2ASEA 4TV8B 4E32A 3TAXA 3LCRA 3VNBA 2FJPA 1WXEA 3INYA 4RHYA 4D80A 1XZKA 5A5VA 3THXB 4QNMA 1BWQA 2JAOA 5DOZA 4MV4A 3GIDA 2MTBA 3DDUA 3DCYA 1EXNA 1E3JA 3AJAA 4BKMA 2P1ZA 1VBNA 2YVKA 4LBWA 3KDSE 4RHCA 4YRFA 3WXMB 1PU2A 2WOJA 2JHFA 4LVUA 3IHWA 3L9WA 4BJ3A 4AZSA 1SCDA 3U7IA 5JD4A 4CLXA 4DRZA 1E66A 1VLQA 5K3DA 3OFSA 3PIRA 5K5EA 4U02A 1ATZA 1HT2E 2V7WA 1P39A 2COUA 1RRGA 3JQ9C 3VR5H 3MSXA 4GPAA 4CMHA 2C0PA 3OWHA 3NONA 4KFSA 4IINA 3D2BA 3WK4A 2XXBA 2YMLA 1KY2A 1UQRA 3DQQA 3HDTA 5CPBA 5AJTA 3OC0A 2QTVA 1P6UA 1RWOA 5EIHA 3NHLA 5CXXA 1T35A 3GFQA 4P4SA 4QX6A 5KNBA 3O1LA 5C3MA 5I4IA 1OGYA 4DW8A 4KLNA 2QM7A 3N6RA 5JUWA 1GWNA 1QHFA 3T4EA 3EE6A 4UD2A 1X1AA 3WBKA 5FTKA 4BP1A 2WALA 2HZ7A 1TJPB 3QHPA 3ZO8A 2POCA 3HA3A 4L15A 1R66A 1ID1A 1IZ7A 1XWFA 2VDKB 3IMEA 3MJRA 5BQOA 3ICEA 1E6CA 3GPCA 1UBHS 1HTWA 5U4QA 4OJTA 3MQFA 1JJBA 3AJDA 5C8YF 3KWLA 3EZ9A 1GDTA 4ND8B 2BGKA 1ZYUA 2BSXA 2W2PA 3KT3A 4RZ3A 1O5TA 1X1DA 2A0UA 2WD8A 4MR8B 2IDKA 1HDOA 3TL3A 4YX9A 1ISGA 1C2YA 4IKEA 3T5AA 2WHXA 4EO7A 4MB2A 1VQOF 4OXKA 3SGLA 1EPUA 1O94A 2CL0X 4NEHB 2PSDA 2AOXA 4NNOA 4LQ4A 4DLWA 3DM5A 3FLBA 2X6TA 5C7LO 1OFUX 1X74A 3VR3D 1C1XB 1W29A 1ZGGA 3EPKA 3WAJA 3EG5A 5JMPA 4C4SA 2P9ZA 1E2JA 4OXXA 4ROTA 4ZT6A 3OTQA 1SUBA 4YGXB 3R4CA 4WZAA 3ANMA 1GCUA 1PBTA 3HBLA 2VBCA 3CRVA 3L2OB 4R2MA 3JYOA 1DLIA 3C8DA 1GHTA 3HCNA 1DAFA 3LUHA 2QEQA 2ZAMA 5L40A 4U39A 1PEKE 5GJWC 4Z4CA 5JWRA 5ICEA 1JHMA 4FKBA 4GKBA 3U4QA 3G0DA 1LRJA 4J03A 4OB7A 2JAWA 4CMEC 4UTVA 1B26A 3LCCA 4D43A 3V4RA 1NBOA 3H9CA 3MGKA 4NS4A 1SHUX 2DPXA 3T7JA 2OFWA 4B5KA 1U94A 1C7RA 2XNDA 3JTEA 3RM3A 4UXJA 2J33A 4PZUA 4ECAA 3JQQA 1ZOOA 2HF8A 1DBFA 2YVUA 4P58A 2VPZA 3LX4A 4UOQA 1AN9A 5AK6A 3EF1A 3S0JA 4BAZA 4DQKA 2FDRA 4B1FA 4HVCA 1R4MB 4HLUC 4BPRA 1OILA 3NIBA 3KIPA 4D8YA 4MIYA 2ZODA 3WBJA 2BBSA 1RXIA 3VBEA 4PLTA 1CYEA 2DERA 3JQEA 2CFTA 3ELYA 4MI1A 1QVFF 1A8HA 2PQ2A 4Q4AA 1Y33E 1H2ZA 4BAUA 4F92B 4R1QA 3E22A 1HNZB 2IXEA 3VR6H 2IH2A 2XIQA 3KSZO 3Q3GE 5KAPA 4C4WC 1JQ3A 1AGRA 1SKYE 3GVXA 2M6LA 4PXYA 1LLCA 5PNTA 5A4AA 2A0WA 1I4TD 3B6IA 3UWPA 2ZCJA 4MDEA 1VG0B 4DMUB 4X1KA 1S02A 4O1HA 4PGHA 1ZKMA 4M53A 3JALA 3SOZA 2JGNA 3L5OA 2BF4A 2P6MA 1DPGA 3QH4A 2HSJA 4YRCA 1QHSA 1J90A 1KAHA 1D0IA 2FWAA 2J7PD 4FHGA 4QUEA 2ACWA 4MPJA 5I7OA 1E5VA 3A14A 2QN8A 3GJYA 3OM8A 4BNJA 3NK6A 1DKOA 4DQUA 4JLAA 2B1QA 2PGIA 1C0EA 3KQWA 1QOQB 16PKA 2AOUB 2PUBA 3RRMA 4Q3KA 5IDXA 4HGQA 1XPJA 5ENDA 4PCAA 4Z9YA 4KQ9A 4BT7A 1Y6QA 3K4HA 4MCIA 4RPGA 2QXTA 1IV3A 1OH6A 1GRNA 2ZBVA 2GZLA 5AI4A 3VV2A 3N0TA 3LX8A 3Q10A 4FBMA 3BSFA 2FFBA 3NP7A 4GGPA 3W1EA 2GVZC 4BZXA 1ZEMA 3GH3A 1ECJA 4J1SA 4B17A 4WNAA 1UAYA 1BE6A 5I9TA 5AUPB 4F46A 1AS0A 1CV2A 1O6GA 2RGAA 1JILA 3NHRA 2W4MA 3ROGA 1NULA 1LJ8A 2F3QA 2LW7A 4JAVC 2FEXA 1T4MA 4TMKA 4X9XA 4H1VA 3K1AA 4CDMA 3GLFB 2YFQA 3LUAA 1ECFA 4U3JA 1C4WA 2G4CA 2D74A 3LK7A 3OE7D 4G5YA 5ALPA 1L1FA 4CG3A 4CT5A 4XDHA 3VNSA 3Q7IA 7ABPA 1V9SA 5HBGA 2Z6AA 4C89A 5A3JA 3SI7A 1ZA1A 1E60A 1TEXA 3K9NA 3I4CA 4HZUB 5L7YA 3ZDEA 4LVNA 5KQPA 3ES9A 3HJTA 4GZMA 4HSEA 4IX1A 3U1TA 4F4IA 1I2BA 2XB4A 4P5DA 1BNCA 1UUFA 4OK6A 5DIZA 2PAAA 3TNDA 2GNAA 3TQIA 1QGDA 1VECA 1XCBA 4EB0A 2XVMA 1X15A 2BHNA 1HQYE 4L0CA 1RHUA 4TSRA 2DHCA 2HA5A 5CITA 1QO9A 2J9XB 4P0TA 1I7LA 1D6JA 5AW9A 2NN3C 1MQAA 4X6UA 2JARA 3D6TB 4HFRA 4S04A 3S81A 2B8EA 1UBNA 4LOIA 4ZHQF 3V4SA 1DTEA 4GMFA 4O2BB 3IESA 2AFIB 2ZIXB 2AR0A 3ZW7A 3S2EA 4CM8A 4F8YA 1HE1C 4YMHA 1CX9B 3V7WA 3WGMA 1L0BA 1F20A 2B21A 2ONKA 4WY8A 2CXNA 4TLMB 1UJ5A 2GCIA 3FYDA 4M0UA 1XNHA 4HF7A 1VSBA 1Z0KA 4TTTS 4N18A 5JAIA 1IY1A 3WYFA 3KR2A 4F96A 9ATCA 3LF2A 4NHOA 1XYVA 2WG0A 2DWQA 2G9RA 4FKMA 2GERA 2GXUA 3KTAB 3NNDA 1VQ5F 1OBFO 1AT1A 1T8UA 2O2ZA 4GR5A 3MS7A 3VO9A 1QBGA 1JXOA 3A1CA 4ES6A 5FJIA 2P9BA 2LIVA 3LO5A 2IHZA 3D8NA 3GG9A 3OURA 4O59O 3GBSA 3RW9A 1UPUA 5L3SA 2O8FB 3JPWA 5TMPA 5H02A 1KVSA 4DWOA 5TDHA 2HLDA 2EBHX 1Z0AA 2PTGA 4A27A 3ZXSA 1VQVA 1WKBA 1K6MA 2G9ZA 4WINA 3ICOA 4MR8A 4YY3B 1YE8A 1H9CA 1JZTA 3HPRA 1GCOA 2KQUA 3EXIA 2GN2A 2PYDA 1E1NA 3OX4A 2JRLA 1DCMA 1I1HA 1TQ6A 4MGYR 3OE5A 4K9NA 3F6RA 1E2DA 3I2JA 1ORDA 4F93B 1RZ3A 2CK3A 4MYHA 4NZNA 3IUQA 4WECA 4F21A 3RC8A 1U11A 2QM0A 4C7MA 4NTZA 3EVFA 2ZRBA 1NV9A 3D4BA 1WD7A 3HUTA 4ZI7A 2JAUA 2WNHA 3A4LA 3T12A 3DNFA 1HDCA 5CA1B 1G8YA 1U0HC 1GUDA 2QRNA 3BXHA 3OZTA 5EIWA 4BIMA 4R71A 5GV8A 1YQ9A 3WKCA 2B0JA 1RRCA 4N5HX 3PENA 3BIXA 1FFEA 3GZJA 1RKBA 3SQXA 5C3UA 3ER9A 3JQGB 2ECFA 2G67A 1CJBA 3O9ZA 1UPBA 4BN5A 2XJ4A 3IXLA 3OTGA 4BYGA 4D3FA 5IZCA 5GVRA 1HY3A 3U1VA 4G4ZA 2NO7A 3L4BC 1X8XA 3T7AA 3WWYA 3JS5A 1I0LA 3OCCA 2ZG6A 1XJ0A 1ZI6A 3OPQA 4G9EA 3FHJA 4RJLA 3WGGA 1QF7A 4IBOA 5T7BA 1KZYC 1GNTA 4H1HA 2CLOB 4L0MA 1I0ZA 4D8TA 1S3SA 3CLUC 3MAJA 3AF4A 5AW7A 3ZCUA 4CUZA 3ZWQA 3UUGA 4NQ3A 3S03A 2R6R1 3LC7O 3SEZA 1PW7A 3SX2A 5GINE 1QZUA 2IG8A 1Z34A 1A9RA 2K7ZA 2P2DA 3LLSA 4NYJQ 4FUQA 3SU8A 1KYYA 1R6AA 1XDZA 3CJQA 3N3AC 3OQJA 3M89A 1AKTA 3QHAA 3HLTA 1P62B 2BCJQ 4HMPA 4DCTA 4MKIA 5KNDD 4EITA 3P9NA 4H1UA 2ZOSA 3C1TA 4M2LA 3UMCA 3SX4A 2JC3A 5L7WA 4L4YA 1JDPA 1UK6A 1WHTA 2GM4A 2JHCA 2LIPA 1B41A 1OI2A 3IAM1 3KPJA 3MS4A 3O7MA 4N54A 4CG0A 3MBIA 4MW5A 2HC9A 4DQLA 2QX6A 4BMYA 1AY0A 3IOYA 1CNEA 1FP4B 3G6KA 3KHUA 1E7KA 2CDBA 3MTBA 3RS8A 1IHPA 1J09A 3AHFA 1YNOA 4KCGA 3I23A 1PWYE 1ZHHA 4M83A 4PLPA 4C8GA 2UYYA 4XFDA 4Z9FA 1M75A 4M9RA 1W5SA 3GA5A 121PA 2WJZB 1H0HA 1TU4A 1Z4IA 3NT4A 4J4TA 1QP8A 4O2AA 3NTQA 7AT1A 1WP4A 2VNSA 4URHA 3WNDA 4PX9A 4Z6KA 4JMLA 3UAGA 1MB0A 2V98A 3EDOA 4UXHA 5IXSA 3N0VA 3R20A 1BMTA 3RVQA 4UFOA 1U2QA 4X93A 4RGYA 1XNRB 4N76A 4IXMA 3Q15C 1VBMA 3CCJF 1R6XA 4OAPA 3ZXUB 5MGBA 4F3TA 5AOCA 1TA4A 1E79A 3FYUA 5BW8A 4YCDA 1XAGA 3EXEA 1NUQA 4H7DA 4MI6A 2LD4A 1G18A 2C5LA 4V0RA 3F6PA 4BDSA 3KQSA 3NIGB 3RAFC 3FZNA 5D3MA 3U19A 1OWMA 2Z6VA 1QF9A 4NCAA 5GJVC 1DC8A 3GQBB 5EP1A 3VR5A 3BSWA 4HZUA 4O0LA 2UZ1A 5TPWB 4JH0A 1IV4A 3AF1A 4K6MA 1P2UA 2PKRA 2W6JA 1CXZA 2XUGA 1PQPA 3ADPA 1WHSA 2CNOA 4DPKA 1C7JA 1CJTC 4IXWA 5G41A 3SC2A 4DSAA 2J08A 2NQ2C 4EPXA 3RBZA 1T6ZA 2JCGA 1GSHA 1XZLA 3OT4A 1J2JA 3CCEF 1VG1A 2IUTA 3WSVA 1K1EA 4FHFA 2GK4A 3FFMA 4WQMA 5AKGA 5HWEA 1O2DA 2C9BA 1IEVA 1NQUA 2UKDA 3H4VA 3JVVA 3QOFA 4NE9A 5JCXA 1PDOA 5KNCH 1PKEA 3FIJA 5KU7A 1J8DA 4S05A 3GEMA 3ET4A 4HYTA 2ODWA 3V4DA 1OWPA 3EBOA 2PH3A 3FMPB 4KR3A 5B4TA 3F6EX 3OPYA 3T5MA 3TEMA 2O06A 4IIJB 1YHYA 2XUIA 1SKQA 5SYAA 1MP0A 1Z6XA 4KAJA 4Z8YA 1MV8A 3RS4A 3M1AA 4YLYA 5JBIA 1XZDA 1FFCA 5HBRA 3ZLUA 1XRLA 2ZQZA 3HCAA 3O95A 3QTTA 3WK6A 4NXMB 3ADDA 4TVSA 5CW2A 2OCKA 4RGBA 1GG2A 1J5XA 3EQ6A 4DA9A 2ZI3A 5DPMA 1HBJA 3FMOB 1VIMA 1F51E 4HAIA 1BVYF 4OP3A 2NZVG 4UHEA 3X43A 1WSBA 3VPHA 5L9AA 1Y1PA 4P35A 1R15A 2VTVA 4GC9A 1RCTE 3RYCA 2VT6A 3RTCA 1T3TA 1RYHA 2GPNA 2G5PA 4B81A 4BPBA 5L3SB 2O8FA 1V5GA 4YHBA 1J24A 1FUKA 1LJUA 2JEZA 4MWTA 1Q16A 3L8EA 4UC0A 5F73A 1W4RA 4FXPA 2VHQA 3VH3A 2NV6A 6ADHA 3NJ8A 3U9SA 4HDAA 4L7QA 3G0CA 1BWPA 1YZQA 4FEAA 5A7HA 2ATCA 1FLVA 3CMCO 5IBRA 3ROXA 1MX5A 1BCRB 3TVYA 4EHNA 2AXPA 1KTIA 4IFBA 2G0TA 5B1DA 4EF5A 1H1TA 1Q7TA 1FSZA 2PFSA 2J31A 2WUWE 3MTIA 1KU6A 4AP5A 5BYAA 5K0FA 1L5SA 2B3DA 4PS0A 5IABA 3EA4A 1M1UA 3TFQA 1Z25A 4BL5A 4AUEA 4EW1A 1GGFA 3SQLA 3H84A 5CG1A 3QF7A 3WDKA 4WBXC 4LXQA 1QC5A 3G9XA 5DRTA 4G5HA 5DIFA 4LWZA 2B35A 2VATA 5FOTA 3AF5A 5HFNA 3L0BA 5I7RA 5DYNA 1QVRA 4JU8A 4QU0A 4IRUB 4Q3CA 4YMWA 5CFQA 5AVRA 3LBIA 3WIVA 2H4HA 1ISIA 4IQ8A 4HOYA 1ZJJA 4LYGA 3EY9A 4JS0A 3LDAA 4RZIA 5BNZA 1E1QA 1R10A 1RIFA 4F3NA 1NZDA 3AM4A 4D4IA 4Q4AB 1W36B 1IV2A 3W5AA 1NRIA 3AKDA 4R1LA 4B35A 3CPSA 3THXA 1NMYA 3RI3A 3R3YA 4LYAA 3NVAA 4NBRA 4BVLA 4GSKA 2PGNA 1IXKA 3L43A 3KPWA 1NI4A 1QFXA 5E38A 4OM8A 1Q6ZA 4IGAA 3AKCA 4R1MA 4UQLA 1FFXB 3K5PA 3EUWA 4V2UA 3VRHA 2BJWA 4OJNA 2ZRGA 4XB6B 5D51S 4W7HA 3DZDA 3RS3A 3Q3JB 2VSQA 3A7EA 4CFZA 5CB8A 4Z7OB 1GGVA 2C78A 3P0FA 1YA6A 3NC0C 3B3FA 4I6GA 3MRTA 3G2IA 2VF4X 4GI1A 3BH7A 4GVLA 3ZZ0A 3DLHA 1JDSA 1BZYA 2VTEA 2I5PO 1IHOA 1TUIA 4ZT3A 5B4VA 4IOJA 1QC5B 2IC5A 4I4NA 5EKXA 2C8JA 2XITA 3CZRA 5HZMA 1QYRA 2GZMA 3LDHA 3ADOA 5LOVF 2EW1A 1UEXC 2RB9A 1FSGA 1KDYA 4LYJA 4A7PA 1X7HA 2F59A 3CNQS 3SYLA 1TM7E 1SH7A 2CXOA 1YRQA 1EFPB 3UFXA 2XXAA 1I4OA 1ODCA 1BE1A 2MYPA 1U1CA 2JJ2A 3KV1A 4JGBA 2PZFA 4HX5A 4U9UA 3IUSA 2CDRA 4ZCMA 3LX6A 1DNPA 4C4OA 3IJPA 4FOOA 3ORHA 2DOKA 4TXNA 1PI3A 4LXHA 5IC5A 3ZS8A 4ME6A 2OO3A 4ZMRA 5KYWB 2VEDA 3DFIA 3QVGB 4I36A 3ZU4A 3RU2A 1XMQB 5SY6A 3N2KA 1OR8A 1RW4A 3R1IA 3TKYA 1V41E 2GWRA 2IYYA 3P9CA 2GLXA 4KKXB 4OGFA 3IV7A 3UH1A 3MJHA 2QOEA 1LPMA 2R7KA 3B1XA 3KFVA 3LWZA 5AM1A 3SHFA 5K3AA 1S2NA 4YMLA 4LHSA 1VH8A 2PZKA 3ORFA 4KREA 1RQPA 4GQBA 1H05A 5ESDA 1KFJB 1RYZA 2JIPA 5A3SA 3X3HA 2WT4A 3K9QO 1E3EA 1O3YA 4RK0A 5TMBA 3T7TA 1ZH0A 3V1TC 4V0KA 2PV7A 5DM70 4ND6A 3ZV4A 3HZOA 2QMOA 2V0NA 3IVCA 4DLBA 3PE3A 4MVJM 5K0BA 5FJ4C 1RR6A 2DUJA 5DLPA 4A1OA 4O4HB 3TFOA 4DUZB 1L7AA 2GTHA 4M4SA 2PX6A 2R1UA 3REOA 5HILA 4D44A 5I7VA 1CQXA 1X1SA 2RC6A 1R4MA 1OW3B 3RSQA 3TSAA 2XVXA 5K05A 1ZVJA 3PWKA 1PJAA 2NU9A 3B9RA 3R0VA 1OB5A 3UW3A 5HXUA 4KWIA 3MAAC 1CERA 2HX0A 2OBNA 3DZIA 1VP9A 5U1PA 4YMTA 1D1SA 3OQPA 4IQ0A 1SZPA 1WHSB 1Z5NA 1KFKB 4AUKA 1MJGM 4R0NA 4DLTA 3AIKA 2CVQA 4CMJA 2YZKA 3V7EA 1XI2A 3F1LA 1KJNA 1GPAA 1N3LA 1ZGBA 2W8ZA 1VI6A 3G0OA 1YA4A 2RHDA 3G0HA 2AFRA 4UTXA 2GRAA 1ZC3A 3K0SA 2QRMA 1X94A 4UAGA 2WIDA 1Z4NA 3NIDB 3E8MA 4ZOLB 3KTDA 5CFRA 1U3LA 3WLKX 4UE3S 4NJMB 3CONA 1D3AA 2QWXA 3W9SA 5JNVA 2DR2A 1WXIA 3FYCA 5ALGA 3LPAA 4QATA 1J23A 4MZXA 1PR2A 4UEOA 1KPIA 4YAUA 3NVKI 3EUEA 3SJBA 4E6EA 3L4BA 3T94A 3ZS9A 4LRUA 1TEVA 3JAWB 1NZJA 1OAOA 3A4YA 4L8YA 3MN1A 3QK7A 1WQ4A 1C0IA 2GEJA 2IDJA 3QVKA 3LYHA 4FSXA 1H42A 2HTEA 2OV2A 1G8SA 3PNQA 4KIFA 3CLTD 2J0UB 4GNRA 1UODA 5TPZA 2PH7A 1N5LA 2EFDB 2YMPA 4QFMA 4H7KA 3U2QA 2BGRA 1QYVA 4BJ5A 1E2LA 5IBQA 2NUBA 1FPMA 1HFWA 2HSEA 4I46A 4YDSA 3WY9A 4CF3A 2W70A 3T7RA 3LFOA 2AN4A 3W5JA 1PVDA 4EA6A 4AT1A 5FI5A 3WRYA 3CCFA 4D57A 4DA0A 4MLZA 2W2OA 4CCAA 1Z4OA 3OBBA 5IJAA 2FXVA 4GBJA 4BFXA 2C94A 3JAKB 4C5CA 1T5HX 5J47A 4J9UE 4NARA 5ICGA 2HKIA 3AT1A 1ZXLA 5HMMA 5KKAA 3BPSA 4FILA 4D1YA 3ASYA 3C3DA 1B1AA 4G1UC 1LEHA 2BGGA 2J0UA 1VMIA 3E3MA 4MA0A 4WX2B 2HP3A 3A3NA 1R6BX 3BTUA 2GYYA 2V5AA 3LYAA 4DLNA 2H1IA 1CRLA 3WQSB 1C3VA 3S5UA 3NHMA 3PR1A 1GARA 1AK9A 4LJRA 2OBFA 3WNQA 1JLRA 3OLWA 3D00A 4P98A 4AIIA 3ZP7A 4EENA 5F5NA 2G36A 4HTAA 3TW4A 2VHVA 1XPUA 3F5FA 2F1KA 3GFFA 3KQPA 4XCQA 2XZOA 4ACBA 4EGFA 2PGDA 4IICA 2ON6A 5LZ4A 1FFYA 4AF7A 4IV8A 3U3MA 4C06A 1WETA 1B43A 3BIWA 1ZSNA 3CNBA 3FWYA 4JYMA 5DNDA 2X15A 1JF8A 2H85A 2YV4A 3MFQA 3SHOA 3U7HB 4P7FA 2PKEA 1J00A 3PSAA 4Q47A 1PWXA 1YJCA 3QHQA 5J5AA 1J2UA 1ZD1A 2O0LA 3HEAA 4B4WA 3U4HA 3C6MA 4ZCIA 3R0ZA 2MSWA 4I4IA 5E6RA 2BZSA 5EP4A 1GPUA 2A58A 2MDTA 3ITDA 3MMXA 3O74A 1G16A 5HE9A 2G9IA 4Y2SA 1K68A 2XUHA 1IQPA 2OAGA 3KM0A 1PSZA 1ZI8A 4OQNA 4EJMA 5C4MA 2ANBA 4OHVA 4JBYA 2NV2B 1O8BA 1QO0D 2ATIA 2FPWA 3F7NA 3NMUF 2D59A 4DDWA 4HLCA 5JD6A 1EGAA 4X7MA 3QOYA 2ZR7A 1PT8A 2GJKA 1X92A 4CIWA 1VQ9F 3G88A 1S7GA 2AVNA 2UYPA 4H16A 2V7QD 3PFHA 1N6LA 1I4LD 4TXHA 5G4KA 2V4MA 4E70A 3ONEA 2AR9A 4DV1B 4DCNA 5HY1A 1DAGA 1H4TA 1J0CA 4E2XA 2V3VA 3CUVA 4QUAA 4E4YA 3H86A 5AUOB 3WSTA 1SXPA 4OLAA 3NH6A 1UDBA 2ZVYA 1DC6A 3HP1A 4OQEA 4V1CB 2GFIA 3A1NA 5BYKA 5ILOA 1VE1A 1X7ZA 1K8RA 3H99A 1KQFA 3N2GA 2VSXA 4U6NA 3SHVA 1R74A 4QJBA 3HCWA 5EESA 2V6FA 3T5DA 1RMYA 4S1WA 3RUEA 3EXG1 4D8VA 5JXGA 4YJDA 2HSDA 3P2IA 2Z1EA 2GCOB 4TMVA 1HLGA 4QECA 3R7WB 3FYHA 2WHPB 3KALA 1XA4A 2P4HX 3S27A 1XZHA 1ZU5A 3ETNA 1R88A 2FQXA 5CAEB 1EM8A 1GXSA 1HE3A 1NVVR 1T3SA 5TGTA 4W9RA 4NUTA 3VYRB 4PR3A 5ICMA 1L7XA 2XDQA 1P33A 3E03A 4NX2A 3M6MD 1NXWA 3HEBA 1TVEA 4JU9A 2FP3A 3AUXA 3BN3A 5LB2A 3ZZUA 3ZZ1A 4JJ7A 2V7UA 3ZE8A 3F8TA 4LCJA 1E2MA 2IP2A 3OCZA 5B5SA 2HMYB 1FVOA 1BE0A 4HQ0A 4V2IA 4FI3C 5HCNA 3RVLA 4BTLA 5K03A 1RM4A 3Q3VA 1LBEA 2HHHB 2JCYA 3O5AA 2GAJA 1XZGA 3ESJA 3LSYA 3C16C 4IVRA 2FSGA 4GPEA 3KIZA 2CFIA 2Q3LA 2OGUA 1G1AA 4X8LA 3W5BA 3RF6A 2VA9A 4JYAB 1JG1A 2VCEA 4A10A 2GFQA 3T7KA 3ANXA 3FETA 2D4AA 4JLKA 3NIFB 3A27A 3N58A 4DWWA 3QELB 1WZ2A 4DIUA 1DC7A 1ODIA 2LE0A 5AWFC 2DB3A 1GGHA 2JLCA 4IH1A 4WTOA