4UORA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes in complex with glycerol phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
Knots found
sequence length
418
structure length
417
Chain Sequence
SSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOTEICHOIC ACID SYNTHASE
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transferase
total genus 168
structure length 417
sequence length 418
chains with identical sequence B, C, D, E, F, G, H, I, J, K
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uorA02
4UOOA 4FDIA 2G9YA 1E33P 3M8WA 3KD8A 2RH6A 5LRMA 3MK2A 1HJKA 4GTXA 2W5RA 5TJ3A 3WBHA 4NWJA 5DLVA 5LRNA 4QAXA 3BDGA 4GTZA 2W5VA 3NKPA 1ELZA 1KHLA 3Q3QA 1KH4A 1N2KA 3NKNA 1KHJA 2QZUA 2W5QA 3MK1A 1FSUA 3T00A 2IUCA 4KJGA 1ALKA 1AJBA 2W8SA 1AJAA 1EQJA 1ZEFA 2D1GA 3BDFA 1E3CP 3TWZA 3TG0A 4CXKA 1ZEDA 5DLWA 3NKMA 4LR9A 3UN5A 3M8ZA 3T01A 1EW2A 1O99A 4LQYA 4LRFA 4ZG7A 4LRDA 5GRRA 4CXUA 4YR1A 1ALJA 3M8YA 1HQAA 1O98A 4GTYA 5IJQA 3WAVA 1B8JA 4MY4A 1Y6VA 4MIVA 4B56A 5HRTA 1P49A 5K4PA 1ED8A 1EW8A 3BDHA 3LXQA 1KHKA 5LIAA 1SHNA 4UPHA 3IGZB 1ANJA 5GOVA 2IFYA 2W5XA 1URAA 4MHXA 4ZGAA 1KH9A 3NKRA 1AJCA 4KAVA 5AJ9A 1AJDA 2W5WA 3UNYA 3M7VA 1ALIA 2IUCB 2ANHA 4FDJA 4UPKA 5INHA 1ELYA 4KAYA 3WAXA 4KM4A 3OT9A 2W5SA 4LRBA 1ED9A 3ED4A 4N7TA 3DPCA 4CYRA 3CMRA 1EW9A 2VQRA 5L0BA 3T02A 4UOPA 3WAWA 3IDDA 2GLQA 3B5QA 3BDGB 1ANIA 4KJDA 2W5TA 2XRGA 4TN0A 1HDHA 5DLTA 2XR9A 4CYSA 1URBA 4LRCA 2ZKTA 1ZEBA 3NVLA 2X98A 1SHQA 3NKOA 1EJJA 1N2LA 4GTWA 3MK0A 5LQQA 1KHNA 5C66A 4UORA 2GSUA 1KH7A 1E1ZP 4LREA 4LRAA 3UO0A 4ZG9A 1Y7AA 3UN3A 1EI6A 5IJSA 3SZYA 1KH5A 1AUKA 4UPIA 4NWXA 4LR8A 5KXAA 4UPLA 4ZG6A 1K7HA 3NKQA 4LR7A 1ELXA 4LR2A 2W8DA 3WAYA 5EGEA 5L0EA 3A52A 1E2SP 2GA3A 3IGYB 3E2DA 5EGHA 3SZZA 3UN2A 2GSNA 1ALHA 4CXSA 3TX0A 3DYCA 2GSOA 5L0KA
chains in the Genus database with same CATH superfamily
4UOOA 4FDIA 2G9YA 1E33P 3M8WA 3KD8A 2RH6A 5LRMA 3MK2A 1HJKA 4GTXA 2W5RA 5TJ3A 3WBHA 4NWJA 5DLVA 5LRNA 4QAXA 3BDGA 4GTZA 2W5VA 3NKPA 1ELZA 1KHLA 3Q3QA 1KH4A 1N2KA 3NKNA 1KHJA 2QZUA 2W5QA 3MK1A 1FSUA 3T00A 2IUCA 4KJGA 1ALKA 1AJBA 2W8SA 1AJAA 1EQJA 1ZEFA 2D1GA 3BDFA 1E3CP 3TWZA 3TG0A 4CXKA 1ZEDA 5DLWA 3NKMA 4LR9A 3UN5A 3M8ZA 3T01A 1EW2A 1O99A 4LQYA 4LRFA 4ZG7A 4LRDA 5GRRA 4CXUA 4YR1A 1ALJA 3M8YA 1HQAA 1O98A 4GTYA 5IJQA 3WAVA 1B8JA 4MY4A 1Y6VA 4MIVA 4B56A 5HRTA 1P49A 5K4PA 1ED8A 1EW8A 3BDHA 3LXQA 1KHKA 5LIAA 1SHNA 4UPHA 3IGZB 1ANJA 5GOVA 2IFYA 2W5XA 1URAA 4MHXA 4ZGAA 1KH9A 3NKRA 1AJCA 4KAVA 5AJ9A 1AJDA 2W5WA 3UNYA 3M7VA 1ALIA 2IUCB 2ANHA 4FDJA 4UPKA 5INHA 1ELYA 4KAYA 3WAXA 4KM4A 3OT9A 2W5SA 4LRBA 1ED9A 3ED4A 4N7TA 3DPCA 4CYRA 3CMRA 1EW9A 2VQRA 5L0BA 3T02A 4UOPA 3WAWA 3IDDA 2GLQA 3B5QA 3BDGB 1ANIA 4KJDA 2W5TA 2XRGA 4TN0A 1HDHA 5DLTA 2XR9A 4CYSA 1URBA 4LRCA 2ZKTA 1ZEBA 3NVLA 2X98A 1SHQA 3NKOA 1EJJA 1N2LA 4GTWA 3MK0A 5LQQA 1KHNA 5C66A 4UORA 2GSUA 1KH7A 1E1ZP 4LREA 4LRAA 3UO0A 4ZG9A 1Y7AA 3UN3A 1EI6A 5IJSA 3SZYA 1KH5A 1AUKA 4UPIA 4NWXA 4LR8A 5KXAA 4UPLA 4ZG6A 1K7HA 3NKQA 4LR7A 1ELXA 4LR2A 2W8DA 3WAYA 5EGEA 5L0EA 3A52A 1E2SP 2GA3A 3IGYB 3E2DA 5EGHA 3SZZA 3UN2A 2GSNA 1ALHA 4CXSA 3TX0A 3DYCA 2GSOA 5L0KA
chains in the Genus database with same CATH topology
4UOOA 4FDIA 2G9YA 1E33P 3M8WA 3KD8A 2RH6A 5LRMA 3MK2A 1HJKA 4GTXA 2W5RA 5TJ3A 3WBHA 4NWJA 5DLVA 5LRNA 4QAXA 3BDGA 4GTZA 2W5VA 3NKPA 1ELZA 1KHLA 3Q3QA 1KH4A 1N2KA 3NKNA 1KHJA 2QZUA 2W5QA 3MK1A 1FSUA 3T00A 2IUCA 4KJGA 1ALKA 1AJBA 2W8SA 1AJAA 1EQJA 1ZEFA 2D1GA 3BDFA 1E3CP 3TWZA 3TG0A 4CXKA 1ZEDA 5DLWA 3NKMA 4LR9A 3UN5A 3M8ZA 3T01A 1EW2A 1O99A 4LQYA 4LRFA 4ZG7A 4LRDA 5GRRA 4CXUA 4YR1A 1ALJA 3M8YA 1HQAA 1O98A 4GTYA 5IJQA 3WAVA 1B8JA 4MY4A 1Y6VA 4MIVA 4B56A 5HRTA 1P49A 5K4PA 1ED8A 1EW8A 3BDHA 3LXQA 1KHKA 5LIAA 1SHNA 4UPHA 3IGZB 1ANJA 5GOVA 2IFYA 2W5XA 1URAA 4MHXA 4ZGAA 1KH9A 3NKRA 1AJCA 4KAVA 5AJ9A 1AJDA 2W5WA 3UNYA 3M7VA 1ALIA 2IUCB 2ANHA 4FDJA 4UPKA 5INHA 1ELYA 4KAYA 3WAXA 4KM4A 3OT9A 2W5SA 4LRBA 1ED9A 3ED4A 4N7TA 3DPCA 4CYRA 3CMRA 1EW9A 2VQRA 5L0BA 3T02A 4UOPA 3WAWA 3IDDA 2GLQA 3B5QA 3BDGB 1ANIA 4KJDA 2W5TA 2XRGA 4TN0A 1HDHA 5DLTA 2XR9A 4CYSA 1URBA 4LRCA 2ZKTA 1ZEBA 3NVLA 2X98A 1SHQA 3NKOA 1EJJA 1N2LA 4GTWA 3MK0A 5LQQA 1KHNA 5C66A 4UORA 2GSUA 1KH7A 1E1ZP 4LREA 4LRAA 3UO0A 4ZG9A 1Y7AA 3UN3A 1EI6A 5IJSA 3SZYA 1KH5A 1AUKA 4UPIA 4NWXA 4LR8A 5KXAA 4UPLA 4ZG6A 1K7HA 3NKQA 4LR7A 1ELXA 4LR2A 2W8DA 3WAYA 5EGEA 5L0EA 3A52A 1E2SP 2GA3A 3IGYB 3E2DA 5EGHA 3SZZA 3UN2A 2GSNA 1ALHA 4CXSA 3TX0A 3DYCA 2GSOA 5L0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOO A;  4FDI A;  2G9Y A;  1E33 P;  3M8W A;  3KD8 A;  2RH6 A;  5LRM A;  3MK2 A;  1HJK A;  4GTX A;  2W5R A;  5TJ3 A;  3WBH A;  4NWJ A;  5DLV A;  5LRN A;  4QAX A;  3BDG A;  4GTZ A;  2W5V A;  3NKP A;  1ELZ A;  1KHL A;  3Q3Q A;  1KH4 A;  1N2K A;  3NKN A;  1KHJ A;  2QZU A;  2W5Q A;  3MK1 A;  1FSU A;  3T00 A;  2IUC A;  4KJG A;  1ALK A;  1AJB A;  2W8S A;  1AJA A;  1EQJ A;  1ZEF A;  2D1G A;  3BDF A;  1E3C P;  3TWZ A;  3TG0 A;  4CXK A;  1ZED A;  5DLW A;  3NKM A;  4LR9 A;  3UN5 A;  3M8Z A;  3T01 A;  1EW2 A;  1O99 A;  4LQY A;  4LRF A;  4ZG7 A;  4LRD A;  5GRR A;  4CXU A;  4YR1 A;  1ALJ A;  3M8Y A;  1HQA A;  1O98 A;  4GTY A;  5IJQ A;  3WAV A;  1B8J A;  4MY4 A;  1Y6V A;  4MIV A;  4B56 A;  5HRT A;  1P49 A;  5K4P A;  1ED8 A;  1EW8 A;  3BDH A;  3LXQ A;  1KHK A;  5LIA A;  1SHN A;  4UPH A;  3IGZ B;  1ANJ A;  5GOV A;  2IFY A;  2W5X A;  1URA A;  4MHX A;  4ZGA A;  1KH9 A;  3NKR A;  1AJC A;  4KAV A;  5AJ9 A;  1AJD A;  2W5W A;  3UNY A;  3M7V A;  1ALI A;  2IUC B;  2ANH A;  4FDJ A;  4UPK A;  5INH A;  1ELY A;  4KAY A;  3WAX A;  4KM4 A;  3OT9 A;  2W5S A;  4LRB A;  1ED9 A;  3ED4 A;  4N7T A;  3DPC A;  4CYR A;  3CMR A;  1EW9 A;  2VQR A;  5L0B A;  3T02 A;  4UOP A;  3WAW A;  3IDD A;  2GLQ A;  3B5Q A;  3BDG B;  1ANI A;  4KJD A;  2W5T A;  2XRG A;  4TN0 A;  1HDH A;  5DLT A;  2XR9 A;  4CYS A;  1URB A;  4LRC A;  2ZKT A;  1ZEB A;  3NVL A;  2X98 A;  1SHQ A;  3NKO A;  1EJJ A;  1N2L A;  4GTW A;  3MK0 A;  5LQQ A;  1KHN A;  5C66 A;  4UOR A;  2GSU A;  1KH7 A;  1E1Z P;  4LRE A;  4LRA A;  3UO0 A;  4ZG9 A;  1Y7A A;  3UN3 A;  1EI6 A;  5IJS A;  3SZY A;  1KH5 A;  1AUK A;  4UPI A;  4NWX A;  4LR8 A;  5KXA A;  4UPL A;  4ZG6 A;  1K7H A;  3NKQ A;  4LR7 A;  1ELX A;  4LR2 A;  2W8D A;  3WAY A;  5EGE A;  5L0E A;  3A52 A;  1E2S P;  2GA3 A;  3IGY B;  3E2D A;  5EGH A;  3SZZ A;  3UN2 A;  2GSN A;  1ALH A;  4CXS A;  3TX0 A;  3DYC A;  2GSO A;  5L0K A; 
#chains in the Genus database with same CATH topology
 4UOO A;  4FDI A;  2G9Y A;  1E33 P;  3M8W A;  3KD8 A;  2RH6 A;  5LRM A;  3MK2 A;  1HJK A;  4GTX A;  2W5R A;  5TJ3 A;  3WBH A;  4NWJ A;  5DLV A;  5LRN A;  4QAX A;  3BDG A;  4GTZ A;  2W5V A;  3NKP A;  1ELZ A;  1KHL A;  3Q3Q A;  1KH4 A;  1N2K A;  3NKN A;  1KHJ A;  2QZU A;  2W5Q A;  3MK1 A;  1FSU A;  3T00 A;  2IUC A;  4KJG A;  1ALK A;  1AJB A;  2W8S A;  1AJA A;  1EQJ A;  1ZEF A;  2D1G A;  3BDF A;  1E3C P;  3TWZ A;  3TG0 A;  4CXK A;  1ZED A;  5DLW A;  3NKM A;  4LR9 A;  3UN5 A;  3M8Z A;  3T01 A;  1EW2 A;  1O99 A;  4LQY A;  4LRF A;  4ZG7 A;  4LRD A;  5GRR A;  4CXU A;  4YR1 A;  1ALJ A;  3M8Y A;  1HQA A;  1O98 A;  4GTY A;  5IJQ A;  3WAV A;  1B8J A;  4MY4 A;  1Y6V A;  4MIV A;  4B56 A;  5HRT A;  1P49 A;  5K4P A;  1ED8 A;  1EW8 A;  3BDH A;  3LXQ A;  1KHK A;  5LIA A;  1SHN A;  4UPH A;  3IGZ B;  1ANJ A;  5GOV A;  2IFY A;  2W5X A;  1URA A;  4MHX A;  4ZGA A;  1KH9 A;  3NKR A;  1AJC A;  4KAV A;  5AJ9 A;  1AJD A;  2W5W A;  3UNY A;  3M7V A;  1ALI A;  2IUC B;  2ANH A;  4FDJ A;  4UPK A;  5INH A;  1ELY A;  4KAY A;  3WAX A;  4KM4 A;  3OT9 A;  2W5S A;  4LRB A;  1ED9 A;  3ED4 A;  4N7T A;  3DPC A;  4CYR A;  3CMR A;  1EW9 A;  2VQR A;  5L0B A;  3T02 A;  4UOP A;  3WAW A;  3IDD A;  2GLQ A;  3B5Q A;  3BDG B;  1ANI A;  4KJD A;  2W5T A;  2XRG A;  4TN0 A;  1HDH A;  5DLT A;  2XR9 A;  4CYS A;  1URB A;  4LRC A;  2ZKT A;  1ZEB A;  3NVL A;  2X98 A;  1SHQ A;  3NKO A;  1EJJ A;  1N2L A;  4GTW A;  3MK0 A;  5LQQ A;  1KHN A;  5C66 A;  4UOR A;  2GSU A;  1KH7 A;  1E1Z P;  4LRE A;  4LRA A;  3UO0 A;  4ZG9 A;  1Y7A A;  3UN3 A;  1EI6 A;  5IJS A;  3SZY A;  1KH5 A;  1AUK A;  4UPI A;  4NWX A;  4LR8 A;  5KXA A;  4UPL A;  4ZG6 A;  1K7H A;  3NKQ A;  4LR7 A;  1ELX A;  4LR2 A;  2W8D A;  3WAY A;  5EGE A;  5L0E A;  3A52 A;  1E2S P;  2GA3 A;  3IGY B;  3E2D A;  5EGH A;  3SZZ A;  3UN2 A;  2GSN A;  1ALH A;  4CXS A;  3TX0 A;  3DYC A;  2GSO A;  5L0K A; 
#chains in the Genus database with same CATH homology
 4UOO A;  4FDI A;  2G9Y A;  1E33 P;  3M8W A;  3KD8 A;  2RH6 A;  5LRM A;  3MK2 A;  1HJK A;  4GTX A;  2W5R A;  5TJ3 A;  3WBH A;  4NWJ A;  5DLV A;  5LRN A;  4QAX A;  3BDG A;  4GTZ A;  2W5V A;  3NKP A;  1ELZ A;  1KHL A;  3Q3Q A;  1KH4 A;  1N2K A;  3NKN A;  1KHJ A;  2QZU A;  2W5Q A;  3MK1 A;  1FSU A;  3T00 A;  2IUC A;  4KJG A;  1ALK A;  1AJB A;  2W8S A;  1AJA A;  1EQJ A;  1ZEF A;  2D1G A;  3BDF A;  1E3C P;  3TWZ A;  3TG0 A;  4CXK A;  1ZED A;  5DLW A;  3NKM A;  4LR9 A;  3UN5 A;  3M8Z A;  3T01 A;  1EW2 A;  1O99 A;  4LQY A;  4LRF A;  4ZG7 A;  4LRD A;  5GRR A;  4CXU A;  4YR1 A;  1ALJ A;  3M8Y A;  1HQA A;  1O98 A;  4GTY A;  5IJQ A;  3WAV A;  1B8J A;  4MY4 A;  1Y6V A;  4MIV A;  4B56 A;  5HRT A;  1P49 A;  5K4P A;  1ED8 A;  1EW8 A;  3BDH A;  3LXQ A;  1KHK A;  5LIA A;  1SHN A;  4UPH A;  3IGZ B;  1ANJ A;  5GOV A;  2IFY A;  2W5X A;  1URA A;  4MHX A;  4ZGA A;  1KH9 A;  3NKR A;  1AJC A;  4KAV A;  5AJ9 A;  1AJD A;  2W5W A;  3UNY A;  3M7V A;  1ALI A;  2IUC B;  2ANH A;  4FDJ A;  4UPK A;  5INH A;  1ELY A;  4KAY A;  3WAX A;  4KM4 A;  3OT9 A;  2W5S A;  4LRB A;  1ED9 A;  3ED4 A;  4N7T A;  3DPC A;  4CYR A;  3CMR A;  1EW9 A;  2VQR A;  5L0B A;  3T02 A;  4UOP A;  3WAW A;  3IDD A;  2GLQ A;  3B5Q A;  3BDG B;  1ANI A;  4KJD A;  2W5T A;  2XRG A;  4TN0 A;  1HDH A;  5DLT A;  2XR9 A;  4CYS A;  1URB A;  4LRC A;  2ZKT A;  1ZEB A;  3NVL A;  2X98 A;  1SHQ A;  3NKO A;  1EJJ A;  1N2L A;  4GTW A;  3MK0 A;  5LQQ A;  1KHN A;  5C66 A;  4UOR A;  2GSU A;  1KH7 A;  1E1Z P;  4LRE A;  4LRA A;  3UO0 A;  4ZG9 A;  1Y7A A;  3UN3 A;  1EI6 A;  5IJS A;  3SZY A;  1KH5 A;  1AUK A;  4UPI A;  4NWX A;  4LR8 A;  5KXA A;  4UPL A;  4ZG6 A;  1K7H A;  3NKQ A;  4LR7 A;  1ELX A;  4LR2 A;  2W8D A;  3WAY A;  5EGE A;  5L0E A;  3A52 A;  1E2S P;  2GA3 A;  3IGY B;  3E2D A;  5EGH A;  3SZZ A;  3UN2 A;  2GSN A;  1ALH A;  4CXS A;  3TX0 A;  3DYC A;  2GSO A;  5L0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...