4UREA

Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
248
structure length
248
Chain Sequence
MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOHEXANOL DEHYDROGENASE
publication title Molecular Genetic and Crystal Structural Analysis of 1-(4-Hydroxyphenyl)-Ethanol Dehydrogenase from 'Aromatoleum Aromaticum' Ebn1.
pubmed doi rcsb
source organism Aromatoleum aromaticum ebn1
molecule tags Oxidoreductase
total genus 98
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ureA00
2GLXA 4A0SA 4I08A 2HMUA 4MP6A 5TJHA 2Z1MA 4FJ1A 2O7SA 3PTZA 1NPTO 1L1FA 1NHGA 1MLDA 1VJTA 4GGOA 4A27A 4M54A 3GY0A 1NAIA 3QVOA 1A4IA 4HFNA 1MXFA 3JD0A 5TGDA 5KVCA 1FK8A 2I6TA 4C4OA 1HZJA 2NTJA 1ONPA 1V9LA 4MKRA 1EFKA 4IIVA 3DHEA 2EXXA 2PLAA 3DBVO 1X13A 1TT5A 4CMCA 3BMQB 3A1NA 1HWYA 4R69A 3RUCA 4WASA 1UZMA 4J4TA 3ULKA 3RVDA 2ZB4A 1M6WA 4W6ZA 4YT8A 1EEHA 4Z6KA 4XD2A 2HJRA 5JNLA 2YV2A 4FR5A 4ND1A 3FNHA 3L77A 3RKUA 1E3SA 2AEJA 1X0XA 3PQEA 1I36A 3IC5A 1U3VA 4FC6A 5IDQA 4ZA2A 2E4AA 3NDRA 4GBJA 1YB4A 2Q1TA 2NWQA 3ROKA 2OUIA 3UCFA 1JKIA 1HE4A 1HLPA 1I3LA 3WJ7A 1GUYA 3VZPA 1XA0A 2YJZA 2YDXA 2FY8A 2BFPA 1C0PA 4NMHA 4DQVA 4IJKA 4R1SA 3K8ZA 1VPDA 5HBRA 4CV0A 4JBGA 4UAGA 4UULA 4KMSA 1NTOA 2VZ9A 1JN0A 2ZCUA 3DMYA 3NRCA 2ZTLA 4FFRA 1K0UA 2ZB7A 3I23A 4RQTA 1PGQA 4ZJUA 1EFLA 3WDSA 2JD0A 1UDAA 1NM5A 1LXCA 4DPMA 4PLVA 1SB9A 2O23A 1Z45A 4HADA 4JBIA 4PLPA 1C1DB 3R3JA 1UP6A 2HJSA 1OFGA 1DC5A 4GSKA 3P5SA 2DPHA 1AE1A 1D7OA 4E3ZA 3WIEA 2X1HA 3GVCA 3QWBA 4CM6A 2CUKA 2PZKA 3GNSA 1A9ZA 3BXXA 3HN2A 3VDQA 2RH8A 1DC6A 5JY1A 1E1NA 3EUWA 3RU7A 3WQSB 4ESOA 2PGJA 4B79A 2QX7A 2UUOA 3F9IA 3OA0A 1XHLA 4YCAA 3RUIA 2JD1A 1DOHA 2YV1A 1FDWA 4GPD1 4M49A 3ZV3A 5DCWA 3OF2A 4K28A 4NJMB 4FSHA 1N5DA 2HMWA 2J5RA 3GUCA 2D8AA 2DAPA 4YA6A 3QVTA 5CDGA 1RJWA 2GN6A 3Q9NA 3H2SA 5JCJA 4RVGA 3TWOA 2IZ0A 5L3ZA 1BMDA 5G4KB 3GVXA 5EMHA 1U2GA 1GADO 3NV9A 5CAEA 3Q0EA 2Y1FA 2B4RO 4O1MA 2P91A 2VTEA 3PWSA 2HUNA 4XB1A 3HE3A 5F5LA 4XR4A 4TSKA 3QLJA 3WWYA 3A28A 3DHNA 2DTEA 2B36A 3WSWA 4U0JA 3X2FA 1D1SA 2PGDA 1YQXA 3B1FA 3RBVA 3RUFA 1EQUA 4RVDA 1LUAA 3JQ8B 3AUAA 2GNAA 1LDGA 3KOUA 4ZQGA 4CLOA 5A3VA 2BF7A 3CPSA 4E5YA 1PS8A 3ANMA 4DXHA 2WYWA 2H6EA 3PJGA 5EQDA 2H9IA 1ISGA 5DP2A 3WGYA 2R00A 2B35A 3RC7A 2J3IA 4M1QA 3ZWNA 3ZN2A 1DRVA 3O26A 3X2EA 5IFLA 2GDZA 3PQDA 4E31A 1A7KA 3G17A 4M87A 5HTOA 4RF4A 5G0TA 2IEDA 2BI7A 2BKAA 2B5VA 3KYCA 3PHHA 3S2EA 1UXHA 3FHLA 4I9HA 4RPJA 1V8BA 1ZXBA 4GKVA 1QYCA 3GEDA 4RZIA 3PIIA 2W2KA 3VPGA 4Q3CA 4BGUA 5HRUA 3L6EA 1HDXA 4BQPA 3F1KA 4ZRNA 5GZ1A 5I7SA 3JD3A 4UUNA 1FDUA 5F5NA 5DDIP 5AQ1A 3GN1A 1CIVA 3FWNA 3G3EA 2ZKLA 3RC2A 3DR3A 1TA4A 4QUKA 3D64A 2IXAA 4ZHSA 4M89A 3DBLA 2NTVA 4N7RA 1NR7A 1ENPA 4HP8A 1C1XA 3AUTA 5FF9A 4PVDA 4FD3A 5A5FA 2R2GA 4S1VA 3I3OA 2DFDA 3EVNA 3WQRA 4MVJI 2A9FA 2ZQYA 3OBBA 3Q2IA 1YDEA 1U7TA 1BRMA 4WE3A 3ZU3A 3KEQA 3IDSA 2GRAA 3WYCA 4E32A 4CLHA 1T2CA 3CEAA 1E3LA 3R1IA 5U1PA 5KJFA 1R4MB 2W8ZA 3I9OA 5IAAA 3PVZA 2EP7A 4BMVA 3E5RA 1HYEA 1F12A 1HTBA 3UGKA 4CMBA 4MVJH 4GI2A 3ZV6A 5EIOA 4MO2A 3V2UA 1K6IA 3FSRA 1E7QA 3ZHXA 3WFIA 1XQ6A 5L7WA 2EHDA 4IUYA 2GZ1A 1KS9A 2WYUA 5DT9A 3PK0A 3BIOA 3HWRA 5AXBA 4Q3AA 1PGJA 2VT3A 3Q6IA 5COQA 3SLGA 3BTOA 3TL2A 1Y5MA 2P9EA 4W99A 2HO5A 1T4BA 3AWDA 3GPDG 4XQEA 2FWMX 1I3NA 2X0RA 3AU9A 5A05A 3ANNA 4BV8A 3NUGA 4ND4A 3VH1A 4DBZA 3AUUA 2VRBA 3HDHA 4FOOA 3JQFA 3AOEA 1YB1A 1T25A 1LNQA 4RGBA 4RZHA 1B7GO 4MVJD 3RD5A 5DNAA 1P1HA 1GTMA 3E9MA 2JFFA 4E13A 1Y5RA 2PY6A 3C85A 1NPYA 3JSAA 4IXWA 4FIZA 5IN4A 3V5NA 1HDZA 4BNXA 9LDBA 4I1IA 4D3DA 4IJVA 3MJSA 3OA2A 4MDHA 3NX4A 3F4LA 4YAGA 2PZJA 4DREA 4HNHA 3ZI0A 2Q99A 3SJ7A 4GAEA 1XU7A 3WYBA 1HE2A 1DRWA 5B4UA 4FJ2A 1EVZA 3FPCA 2BFOA 3BA1A 3ZV5A 3L4SO 2WJPA 1VJ0A 4UVHA 1BSVA 2DLDA 4UVGA 1SC6A 2FR8A 2X22A 4WLNA 2GZ2A 1HEUA 2C54A 4MIOA 1VE9A 4Y6RA 1U4OA 5JAZA 1JQBA 4LK3A 4LRTB 3W4JA 5K9ZA 1WZEA 3H9GA 3JQFC 4WK6A 3NKLA 1B3BA 2Y0EA 3GEGA 4YJHA 2D5CA 1I8TA 3GMSA 4PZEA 2D2IA 3GLQA 1RYEA 3KLMX 4MP3A 5EERA 1E3IA 4RPGA 4CV3A 3DAFA 1LX6A 3ZCXA 3WICA 3ABIA 4I5FA 4IINA 3H2ZA 4NJMA 4YB8A 2GERA 1GZ6A 4IBOA 1P1IA 3K92A 1SOWA 2EG9A 4NBWA 4Y98A 4II2A 2VQ3A 4A7PA 4MVJG 1U7HA 4PLZA 3F5SA 5DCYA 1K6JA 2R6JA 2AHRA 1XSEA 4D79A 1JKJA 3WX0A 4KP7A 1ORRA 2X9NA 2YYYA 2O3RA 2VOJA 4A26A 2CF5A 2D1YA 1WAMA 3OICA 4DA9A 1CEQA 1HETA 3I83A 4AJOA 1UP4A 1LEHA 3IUPA 3KO8A 4BNMA 3A9WA 3K31A 3FF4A 3H9EO 1DIRA 1RM3A 2JAPA 3AI1A 3DZHA 1WP4A 4HUJA 4OSOA 4YT4A 2EW8A 3I6QA 1DLIA 3B1JA 1X0VA 3ZWBA 5JMWA 2NM0A 1ISMA 2FP4A 4MVJP 4NFSA 1H2HA 4XIYA 4EDFA 4YACA 3HFSA 2EGHA 3WTBA 1X15A 2BHLA 3CH6A 2Q1WA 2I5PO 3KM0A 1HDGO 3KBOA 1JKFA 4KTTE 4NHEA 1JLLA 4ROSA 1NAHA 5HS6A 3BHJA 3ZNPA 3L07A 2E37A 1PZHA 3MJTA 4EEZA 1FJHA 1PTJA 1UDBA 5CG2A 1TT7A 1H5QA 1UAGA 2QRLA 4LMRA 1D8AA 4CMKA 1FDTA 1DRUA 1EDOA 3JYOA 4GVXA 1NVGA 2VHZA 2Y1GA 1J4AA 2EJWA 1XKQA 1ZSYA 2PKQO 3GZ4A 4J49A 4UEJA 3EHEA 3H65A 1NWHA 4YJFB 5JMPA 3UICA 3FRJA 1PJCA 3GR6A 5BNFA 4XQCA 4BNFA 2F00A 4WOKA 4K9DA 4IPTA 2O3QA 4NU6A 5F1PA 4Z0PA 3I5MA 1F8FA 3RIHA 3R6DA 5FEUA 1PSDA 1LRKA 4CUKA 4Z0HO 3C8MA 2A35A 3DZJA 4TKMA 4P8RA 4BOYA 5MGBA 3ZHYA 2W98A 4KDEA 2V6GA 3O8QB 3AUSA 1D4FA 4B3JA 3WGZA 3ZU4A 5I9NA 3H4VA 3DBLB 4OAQA 1YJ8A 1ZW1A 3OECA 4KOAA 4AJNA 4R41A 2NU6A 2R00C 4FPXA 4EUEA 1IHYA 2V65A 3DXFA 5EN4A 5K6AC 2JCYA 2A4KA 3ENNA 3F4BA 2AG8A 1OZAA 3FD8A 4WCDA 1P1RA 5IDXA 1PWZA 5JCJD 4P4NA 1Z74A 4D42A 1E7MA 4OJNA 4OH1A 3ZHBA 4JLWA 5JAQA 1ZK0A 2BI8A 1NFRA 1R0KA 3OIFA 2ZYGA 4UREA 3DB2A 3WGIA 1GEEA 4OM8A 2QRJA 2YZ7A 2O3UA 3UKOA 3RC1A 2VRCA 2Q1SA 3GK3A 3P7MA 1AN9A 2O3TA 4OOEA 3DHYA 5TX7A 2VUSA 3H6KA 1C0IA 3MZ0A 2CMDA 4BKOA 1QORA 2FPPA 2I99A 2EEZA 1DJNA 5DOZA 1KVSA 5C7LO 4PCVA 4BNWA 3EAGA 1YE3A 3WBFA 1NHWA 1KVRA 3W4KA 3VH3A 4KUEA 3ZZNA 2H5LA 2JKVA 3TPCA 3HB5X 4BGVA 1RM5A 4IZHA 2NLOA 4NPCA 4ZVVA 5TC4A 2QW8A 3TRIA 3OP4A 2O3JA 3QW2A 4C7KA 2NNLD 1T2FA 3ADOA 4GVLA 2JFHA 1LLUA 4OYRA 1MG5A 4CLRA 3VTZA 2HK8A 3KSDO 3QHAA 1PJ2A 4K6CA 3HUDA 4PLHA 4BQRA 3DZIA 4XZ3A 4CMGA 5B1YA 4BNIA 2GO1A 1ENOA 3GAFA 3WJAA 4CQMA 1JTVA 3BMNB 1QLHA 3STHA 4TRMA 4QEDA 1LDYA 1KIFA 3UCXA 2WEKA 1WVGA 1Z6ZA 4Z3KA 3I9MA 2IYPA 1T1RA 1SEVA 4FFPA 3LC1O 4JJIA 4FQ8A 2BGKA 3M2PA 4XJSA 1A27A 5IN5A 2HAEA 1DHRA 1RM4A 5DZSA 5JDIC 1H6BA 3NAQA 4B3IA 2WYVA 1A9YA 1UZLA 3PXXA 4R1NA 5GMOA 2XPCA 3TZKA 3WMXA 3AW9A 2F1KA 3EGOA 4BO7A 3T7EA 5AXCA 3WGGA 4NZ9A 5IZCA 3AFMA 4WLEA 1ZK4A 2B83A 3D7LA 3HZZA 3CMCO 1HL3A 1SNYA 3PHIA 2EERA 3ZW8A 3LU1A 3GGOA 1Y8RA 1DC3A 3EW7A 4IJWA 3GZNA 4D0SA 3E48A 1ENZA 1QV7A 1N8KA 4YWJA 3GA0A 4CJXA 1PL8A 2B37A 2EP5A 2O50A 2XAAA 3NEPX 3I9NA 3OM9A 3WLEA 4A5OA 4BO5A 6LDHA 5L53A 4YR9A 4U5QA 3OQBA 5JBIA 1IUKA 3MWEB 4G2NA 1IL0A 1GQYA 2PFGA 2YHIA 3CMMA 3OEWA 1YBAA 2CDBA 2DBRA 2AXQA 2ZK7A 1C14A 4G65A 4I8XA 5AXDA 1HSZA 4I9NA 1BXKA 1P44A 2ZJ0A 1I2ZA 2P5YA 4YQYA 2VNAA 2YFQA 2X8LA 3OJ0A 4OKIA 3UXYA 2PGLA 5B4VA 3ZGYA 3IL2A 2W2LD 1OC2A 2XOXA 5CEEA 4KWHA 3C1OA 4Z0TA 1GUFA 1KEVA 2IE0A 1BW9A 1XYGA 2JL1A 1BDBA 4DLAA 3M2TA 5KKAA 2BMAA 3LLVA 1VJ1A 3LT2A 3DTYA 2OMEA 3PGXA 1U4SA 3TSCA 3U09A 3L0DA 4NBUA 1E7WA 2ZTVA 2WE7A 1R4NA 4YT2A 1AGNA 2Y1CA 1WDLA 4IDAA 1E6WA 3JQAA 3LDHA 4J7CA 1DAPA 2X5OA 3S2FA 3O9ZA 4BMSA 1NWCA 1PR9A 2YHIB 5K0ZA 2C29D 3PQFA 4HKTA 2I3GA 3N74A 3DDNA 4D44A 5A9SA 2HKIA 2G76A 4OQYA 4URFA 1M66A 3GEMA 1WMAA 4AJKA 4OKNA 3AM5A 1YDWA 1SO8A 3U3XA 4GL4A 4XIJA 2I65A 3W1VA 2OBNA 1I30A 1PJ3A 4U0KA 1Q7BA 2VT2A 4OHUA 3DO5A 5ER9A 4K26A 1N92A 3JQ9C 4PLTA 4BNGA 5CHEA 1A4UA 3LT4A 1YXMA 1IPFA 5L4NA 1PQPA 2DTDA 3PHLA 3U4HA 4CM7A 3MCVA 3ENKA 3FPLA 1LSUA 5DOVA 1ID1A 2XXBA 4PG6A 5TS3A 1IE3A 1MFPA 3Q3CA 2NU7A 2NU9A 5DF1A 1DHTA 4WGGA 3UFXA 2B4QA 4NH4A 4BNZA 2HK9A 2WWRA 4W9NA 2J5QA 4AJ1A 4INAA 1FMCA 1X7HA 2CNBA 1W6UA 1EK5A 4YJGB 3NJ4A 4FOSA 1B2LA 1Q7GA 4ALJA 2EKLA 1ADGA 3NGLA 4PLGA 3T4EA 4XGKA 4U6QA 4H16A 1QRRA 4NFHA 3ROPA 1JU9A 3HJAA 3MEQA 4UVEA 4GQAA 3QJ5A 4ZD6A 3WNQA 3E6AA 2X7HA 2PTGA 1UXKA 3I9LA 2VYVA 4R3NA 2FPIA 5TIIA 1CQJA 2NUAA 2Q2WA 3TDKA 1X7DA 3DBHB 4DTIA 4WLVA 3OH8A 1ISJA 4B4UA 3RQSA 5L40A 2AQHA 1EUCA 2X0NA 1DEHA 1ONOA 4TZTA 4L73A 3UHAA 4LSMA 4E5NA 3HN7A 1Y1PA 2UVDA 1IY8A 4TZKA 6ADHA 4L76A 2C5EA 1KEWA 3INTA 1WPQA 4BHTA 4DYDA 3JQBC 1U8XX 2X23A 4JROA 1PR3A 2NADA 4PLFA 3FNEA 4E0BA 2OORA 2Q45A 1N7HA 4J16A 4E30A 4BGEA 4YTEA 5CPFA 2W2LA 3ZU2A 2G17A 3RKRA 3ROMA 1WDMA 3H7AA 3GGGA 4BKUA 3VKVA 3IQDB 5TLSA 4BIIA 1CRWG 2OP0A 3BMCB 3IP1A 1MP0A 2WE8A 3IAHA 3NTOA 5DULA 4E6PA 2NSDA 4BKQA 3CUKA 3FNFA 4JIGA 2HDHA 2RH4A 4YJHB 3C24A 3RASA 3WXBA 3ZNNA 3KXDA 4G81A 3L6OO 2NV6A 3W8FA 3H3JA 1DDOA 3ICCA 1I24A 4BO0A 4ID9A 4XDZA 3K30A 1YOVA 4B4OA 3U9LA 1DAOA 3L9WA 4YT5A 3GRKA 4FGWA 3P19A 4HNGA 4IDDA 4PG4A 1A5ZA 3SC4A 3W8DA 3B70A 3ST7A 3TZ6A 3PWZA 3B6ZA 3COSA 4QTZA 5A1TA 1LJ8A 4M86A 1S6YA 3N58A 5JW6A 4IDCA 4Y9DA 1OOEA 2RIRA 3CZMA 5A03A 2IDZA 3ORFA 3QWHA 2P4QA 4CMEA 5B4TA 4TRNA 1VL6A 2YQ5A 1VL8A 4Q3EA 2DC1A 4H7PA 2CVZA 2Q49A 1GCUA 3QV1A 2JFGA 2NACA 4D7AA 3KUXA 1YQDA 2Y99A 1ZEJA 1CQIA 3INGA 4FGSA 1RYDA 5I8ZA 3JQCA 5IXSA 1LDBA 1YJQA 4U6SA 1VKOA 4MP8A 5EJ2A 3VPFA 1VSUA 1W73A 3F46A 1CJCA 4QX6A 4QFDA 4JBHA 3PJDA 4CLDA 3GNTA 1J0XO 1MG0A 3PLNA 2YHUA 1EBFA 1YOVB 2PNFA 5B37A 3K2EA 1ISFA 3VZSA 1YB5A 4CMJA 1H0KA 3MOIA 4CM3A 1PZEA 3L9XA 1B8VA 3VH4A 8LDHA 3JYQA 4EGFA 3ZHZA 2AQ8A 1EMDA 4A03A 1PZGA 3E5MA 1BHSA 1LQTA 1UJMA 2GD1O 5BSFA 1LSOA 2Y66A 3G0OA 4RVFA 4BMNA 2NQTA 3GDGA 1LRJA 4JNKA 2AE2A 1NR1A 3VPXA 3ICPA 4B7CA 1B3RA 4PN3A 3ASVA 3EC7A 3IKTA 4LISA 1L7DA 3DFUA 5JDCA 1T4DA 5FYDA 3EZYA 4AJIA 4Q3NA 1KVUA 2AQKA 3BAZA 3INRA 2OL4A 2UYYA 1KYQA 3SXPA 1Z82A 1Z73A 2PD4A 4CQLA 3KVOA 3AOGA 5I8WA 1SOVA 1HYHA 5T8KC 2FRDA 2FPGA 2OHXA 3HNPA 4R4JA 4PRKA 1YS4A 3SJUA 2PZLA 3ONEA 1ZMTA 4B4WA 1I5RA 5L45A 2O2SA 2B4TO 3U49A 3LLSA 4BNUA 5JAMA 2VTDA 1ZH8A 5BT9A 3M1AA 4W7IA 3VPSA 5JAIA 3GVHA 3WB9A 3S2IA 1QMGA 4MPDA 4NI5A 2WDZA 5TRTA 4GX0A 4DIBA 4P22A 2P2SA 4MJLA 1QR6A 1GZ3A 1ADCA 1C0LA 3UVEA 5L4SA 1BGVA 2V7PA 3EVTA 1SPXA 4GX2A 1F06A 4QQRA 4YJGA 1UUFA 1E7SA 1BXGB 4CQLB 1AUPA 1EZ4A 4LVUA 2J3JA 1UDCA 2ZATA 4XJTA 4Z9XA 1JVBA 4DYVA 2BRUA 1CF2O 3TZQA 3DZFA 1NFQA 4BO6A 4WPGA 5IZ4A 3AY6A 3E1KA 1VRWA 3HFGA 4GX5A 1ISIA 2X5JO 3PZRA 4HY3A 3P2YA 4HFMA 2FZWA 1QYWA 1ADFA 4GSLA 4PG7A 4U7WA 1U3UA 3AY7A 4NDNE 4HX5A 2GR9A 1VSVA 3JQ9A 4F6CA 3FTNA 2GGSA 3LF1A 3UH1A 2VZ8A 3S1LA 3K2BA 4LCEA 4OO3A 2QG4A 3VTFA 2BELA 3PGJA 1NBOA 1IOLA 4DVJA 3KTDA 4AJPA 1FXSA 3DFZA 1PJSA 1C0KA 3FNGA 4L75A 4CM1A 5CFZA 4DPKA 3LK7A 3ASUA 4FN4A 4YAEA 4TRJA 4W82A 1QSGA 3JQAD 4DIFA 3KSUA 4WOJA 3V2GA 1E1KA 3VZQA 4AFNA 4JXKA 3U5TA 4CLEA 3ZWYA 4CUZA 1V35A 1QYVA 2Q50A 1F0YA 3GQVA 4S3MA 4CQMB 1MXHA 2HCTA 4RV9A 5JDIA 4PLYA 3BHMA 4BO4A 4JQCA 4YAKA 5LC1A 3GMDA 4BO2A 1EE2A 2VOEA 4CM9D 1N2SA 3MWDB 4QECA 5JO9A 3T7CA 1ZMOA 4XB2A 3UN1A 1HDYA 3PRJA 1DO8A 3AI3A 4B7UA 4ALLA 3KV3O 3JV7A 4BO8A 4M55A 3K6JA 4O63O 5A9RA 5T67A 1MC5A 1Z7EA 4BO1A 3DC2A 1WNTA 4JP2A 1LTHR 2UUPA 4MKZA 1PZFA 1NQAO 4XYMA 2PH3A 4WUVA 4NBVA 5U4QA 5L4LA 4AJLA 3WGTA 1E1MA 2P68A 3GF4A 1N1EA 1ZVMA 5A9TA 2Q2QA 1P0CA 1LC0A 1EE9A 1Y9EA 2VWGA 4MVJF 2VWHA 5EPOA 3WWZA 4BB5A 2HK7A 3Q9UA 5AYVA 2C59A 2BGMA 3C7CB 3FR7A 4LW8A 1DLJA 3PHGA 4I9UA 4NR0A 3F47A 3ZWXA 4PG8A 3TL3A 3B1KA 4ZQHA 2X5KO 4CMHA 3ZW9A 1KC3A 3WG9A 3KB6A 2H1SA 4LVCA 4IZIA 1DIGA 3VDRA 3M6IA 5CP8A 1XCBA 2I67A 1EDZA 5FI5A 3WGQA 1WWKA 4J9VA 3CZRA 3CKYA 3OEYA 4WKGA 2RBEA 4ZN6A 1R16A 3D3WB 3D4NA 4J9UE 4DQUA 2HRBA 4CUJA 2OGUA 4D41A 5CPBA 4BL5A 1YVEI 1WZIA 2E82A 3BTSA 3IMFA 3PYMA 1PL7A 1GL3A 2AMFA 3TFQA 5JYDA 3G49A 2ZYAA 4DIOA 1J6UA 3QWIA 4K6FA 5G0WA 2Y1OA 4R01A 4P38A 4AJJA 4IQGA 5AXAA 3DOJA 1RM0A 3DOCA 5K6AA 4RL6A 4ND5A 3IJRA 4IS2A 4Q3DA 5KOIA 1AXEA 1Q0QA 4DQXA 4FFMA 4WNIA 1PGOA 3EY4A 1BXGA 1ZKMA 3JQ6A 3GAZA 1PQUA 2Y05A 5EQFA 4ALIA 4RDHA 1BG6A 3EYWA 1G6KA 4JJFA 2RAFA 1JAYA 3HDQA 4CM4B 3W8EA 3ITDA 1R0LA 3ONFA 4DL9A 2EKPA 1XIVA 1KVTA 1YL5A 3W6UA 4J1NA 5JC8A 2DKNA 4OL9A 2JCXA 5JFOA 4AJ4A 1JVSA 2IRWA 3FR8A 5G0SA 1WW8A 4HBGA 1LSSA 2J3HA 2P9GA 2WMDA 1O9BA 5I7VA 3E18A 3OQ1A 4A73A 3DQPA 4PZDA 5CDSA 4DWVA 4OIMA 3HB4X 3G79A 3TOXA 3TQHA 2PD6A 4R9RA 2Q2VA 4I5GA 5F21A 5TT1A 3RCBA 3TNLA 3LQFA 1P3DA 4TWRA 1XEAA 4BNVA 4BNKA 5HM8A 1ONNA 2QIOA 1LI4A 3SVTA 1LSJA 4JK3A 4R54A 1TLTA 3OIDA 3TJRA 2W2KB 1O0SA 5KJ1A 3SBOA 1WLYA 4EUHA 3KHUA 4NBRA 1E6EA 3JD1A 3PFFA 2JD2A 1WXDA 1NVTA 2DFVA 3PLRA 3TN7A 4A2CA 3QWFA 3SX2A 1PJLA 1VLLA 1SAYA 3OJFA 1GV0A 4HFJA 4CMIB 4E5MA 1E3WB 4NQZA 5KIAA 4O5OA 1N9GA 3WTCA 2FHSA 3TOZA 5KTKA 1QG6A 4XR9A 2AEMA 3A14A 3TZCA 3WGOA 1ZFNA 2CY0A 1GQ2A 2IXBA 2POQX 3G1TA 2LDBA 5IDWA 1AHIA 1IULA 1IZ0A 4L0QA 3ZWCA 1GAEO 2OP1A 2HSDA 5FWNA 3E8XA 5FI3A 4BO9A 1HE5A 3GVPA 1GY8A 2GUGA 5LCXA 1KETA 1ARZA 1HF3A 3CTMA 4CMAA 3JQBA 2VN8A 3OFSA 3GT0A 1W4ZA 3O8QA 2GYYA 2FSVA 4X54A 1TEHA 4WLOA 1UH5A 5CEFA 2D0IA 4AVYA 1DJQA 4CR6A 3VVCA 2JHGA 3U0BA 2X9VA 1ZK2A 3CINA 3HHPA 2B69A 3Q1LA 3ANLA 7MDHA 3RC9A 1PS0A 1U3WA 1HDRA 3LF2A 3O03A 4CMIA 3PHJA 2O48X 3U4IA 4FW8A 2YY7A 2C7VA 4R1UA 4WCFB 4XDYA 2YQ4A 1EVIA 3EMKA 4N5NA 3UW3A 5BR7A 3I4CA 1B14A 1GD1O 1M76A 2EF1A 4YBZA 3HQ4O 4R5MA 5HS4A 2CVOA 3FN4A 2EIHA 3NJ8A 1ZK3A 3PJFA 5H83A 4ZU3A 5ES3A 2FR1A 5IDYA 4AICA 4NJOA 1EVYA 4QO8A 3PP8A 1XG5A 1PIWA 3VKUA 2RHRA 1I2CA 2BGLA 3GUYA 3KETA 1PJBA 4IMPA 4WEOA 3W6ZA 2X0JA 5A04A 4TRRA 3AY3A 3JQ7B 5I9MA 1JDJA 2DM6A 1U1IA 3HG7A 1SMKA 2AQIA 4WECA 1YONA 4PLWA 4ND2A 1E5LA 1E7RA 1B16A 1ZIDA 4JCOA 4JX8A 1PGNA 3A4VA 2AE1A 5C37A 1H6DA 4CM8B 3ON5A 3PDUA 5TSDA 2Q1UA 1U5AA 4OQZA 4L74A 1IHXA 3L4BC 1FDSA 2HMTA 3RFXA 2EV9A 2VHWA 4R68A 2G82A 4OSPA 2JJYA 4IXTA 3ADPA 1N1GA 2BFMA 2C0CA 1SEPA 5A06A 3OETA 2SCUA 2QZZA 1DIAA 1KERA 3ONDA 3DBHA 3ZH2A 3GG9A 1BWSA 2IZZA 3RU9A 3KYDB 4QT0A 4RQUA 4QO7A 5GZ3A 1Z7BA 1OAAA 4RF3A 2PR2A 1LLQA 4BGIA 1XR3A 1P74A 4ITUA 3C1TA 3RUHA 5CDUA 2Q3EA 1GYRA 4PVCA 5COBA 3GHYA 4FFOA 4Y6SA 4DC1A 4Z3DA 4WLFA 1PGPA 2DQ4A 3JD4A 1P33A 3LVFO 2VYNA 1T2AA 4KDFA 3TF5A 3AOEC 1SBYA 4HV4A 1V3VA 2FSSA 1F17A 2ZYDA 4XQGA 1HDOA 1YH3A 1PEDA 3K5PA 2DBVO 3EK2A 3FBTA 3LC7O 3GVIA 1R4MA 2Y67A 5L7TA 5G0VA 2P5UA 2TMDA 4EW6A 3RROA 2JCVA 3H8VA 1N7GA 5KKCA 5T64A 2ZTMA 4D43A 1CERA 2CVQA 1QKIA 1DBVO 4J1QA 1UAYA 3KYDA 5IZCC 1QP8A 2ILTA 2WD8A 4D3SA 3GRPA 3P2OA 4WCFC 4YDRA 2VHVA 2HQ1A 1P0FA 1VC2A 3KZVA 3AFNA 2OFPA 2P4HX 3D1LA 2E49A 2O2YA 5ER6A 5TQVA 2FN7A 1HSOA 3UUWA 1JWBB 2V6MA 1X1TA 2JHFA 1HZZA 4W7HA 2HU2A 3GDOA 5ITVA 3TFOA 3ZDFA 3NDJA 5TF4A 1HKUA 1JAXA 1K3TA 3I1JA 2J5KA 1T2DA 4XCVA 3OHSX 4OXYA 1U8FO 3NYWA 4XYLA 3GH3A 1ZCJA 4ALKA 3WFJA 5JC1A 1K89A 1NX6A 2C2YA 2Q46A 1ZO8A 3U62A 1DPGA 2VYVD 2FMUA 4LN1A 1QYDA 4E2ZA 4DLBA 3H9UA 2NU8A 3VHRA 1K2WA 4E5KA 3PI7A 1G0OA 4TQGA 4RVUA 4DUPA 1EK6A 2VRCD 3DBRB 2J8ZA 3QIVA 3LYLA 1G0NA 1Y81A 4IGFA 5GZ6A 2UDPA 4XA8A 5LDGA 1PQWA 1WDKA 5COAA 4RJTA 5B12A 4EJMA 1MB4A 3DWFA 3RUAA 3PIDA 1ML3A 5JSFA 4Y6PA 3JQAB 2PD3A 1OC4A 4IDEA 1UP7A 1VL0A 3U4CA 3ZWMA 3DL2A 4CV1A 4EBFA 1GU7A 4MKXA 1QV6A 4GMGA 3N7UA 3TZHA 4LSWA 4AG3A 2Y0DA 4KTVE 4BKRA 1R4NB 5THKA 1GV1A 1SB8A 4MVJE 3H5AA 3OJOA 5JCXA 2GCGA 4UEOA 4OXNA 4D46A 1XGKA 1W8DA 1GYQA 5ICMA 2LDXA 2QQ5A 4F45A 1VM6A 2I76A 1UXJA 2PKRA 3JQEA 3DBRA 3JQ7A 1P77A 3DZBA 3ETEA 1E3WA 3KLPX 3NT5A 4Q9NA 3PJEA 4W4TA 2AG5A 2DBQA 4ILKA 4EYEA 1YWGO 4ZRMA 2YFHA 3BTVA 3D3WA 5IF3A 4E2YA 1Y8RB 3RUEA 4J4BA 4GWKA 2Z5LA 4TVOA 3GNQA 4J1SA 4XWYA 4CMEC 2V6BA 2PK3A 3IOYA 2XXJA 1E6UA 1PJTA 1YKFA 2CFCA 4GH5A 1M2WA 4L4SA 3BMOB 5A5EA 1P1FA 3RAJA 3RFVA 2X9GA 4CL3A 2XF8A 2NVUB 4JP3A 2VUUA 3EDMA 3IP3A 1ZXLA 4L8VA 1D3AA 1K5HA 3V1YA 4J0FA 4E4YA 5KVSA 1Y9AA 5J23A 1T24A 4J7XA 3E9NA 4CODB 2NVBA 1MV8A 1H6AA 1L7EA 3H9QA 4RPKA 1UXIA 1F14A 4NBTA 4B4VA 4CR8A 4C7JA 4DLLA 4ZICA 3ETDA 3H9JA 1E7YA 1PL6A 5DBFA 1I3KA 3FI9A 1MFZA 2DUWA 4IY1A 2VHYA 1ZSVA 3GOHA 1NQ5A 5TJ9A 3K73O 1Y6JA 2C07A 3CXRA 3E03A 1GEGA 1U2DA 4RF2A 4XYGA 3RJ5A 2C2XA 5F1KA 7ADHA 5G4KA 5JY6A 1NNUA 1CDOA 1BW9B 2WM3A 1OMOA 1HYGA 4CLRB 2BLLA 1U5CA 1YRLA 4XYEA 3WLFA 5KWEA 1ISHA 3L4BA 2JAHA 1E3EA 4OXKA 2A92A 3JD2A 4J91A 5LDHA 2BD0A 2RHCA 4NIMA 4PG5A 4BNHA 3L6DA 3HSKA 3BMNA 3A06A 1R66A 1V6AA 4JGBA 2X6TA 4OOFA 3WS7A 4FS3A 3JQ8A 3WOHA 4N5LA 1FDVA 2ET6A 5I9LA 2HMVA 1ZBQA 4CM8A 1E92A 5TT0A 4ND3A 3JYPA 1GFSA 4FDAA 3LC2O 3D5TA 1B8PA 4TKLA 4IJUA 3KSZO 1LDMA 1N9GB 3PWKA 1UZNA 1CWUA 2NTNA 4RF5A 3SLKA 5IXYA 1Q2XA 3B20A 4RLHA 4UEKA 2OXIA 1U3TA 4EJ0A 1HLDA 3GZNB 2AW5A 1B15A 1B26A 4UVIA 5JYEA 3ZWOA 3FTPA 1IPEA 3F5QA 1UR5A 4DGSA 3JTMA 1KEPA 1A7AA 3VZRA 4J2OA 1V3UA 4PFJA 3IKVA 2E6UX 1HT0A 3DAPA 1NVMB 5AVOA 4GGPA 1I01A 3BZUA 4O59O 2VYND 5EL0A 4BO3A 3PYXA 4XGNA 5GY7A 3QY9A 4YPOA 1C1DA 5EESA 4ALNA 4YVFA 4EI2A 4CQMD 1D1TA 1LU9A 2B5WA 1PJ4A 3HADA 4QFCA 3QVXA 1ZK1A 3IIEA 1DFHA 4NU5A 4Z9FA 1O6ZA 5TNXA 4FJ0A 4FFLA 3ZWVA 2ZIZA 1JWAB 3RSHA 1NQOA 1I10A 2BH9A 4Y8VA 3NTQA 3LZ6A 3JQDA 4MVJA 1IYZA 3AJRA 4HWKA 4EEXA 2C20A 5IJZA 4D0RA 4DMLA 3Q2KA 2ZB3A 4NK5A 3RFTA 1X14A 5JLAA 1NASA 5ILGA 4RO0A 1J49A 4R3WA 3PPIA 4HXYA 4PRLA 2QYTA 3OIGA 2YV3A 1BXZA 1VKNA 2W4QA 1EQ2A 5F3RA 3GC6A 4HFRA 4BVAA 2GF2A 3QVSA 1GCOA 1ZJZA 2HRZA 3H5RA 4CV2A 2RCYA 4JJGA 2GN9A 1MGOA 4L4RA 3BYZA 2Z95A 4Q3BA 2NVWA 4GLOA 3S55A 2EGGA 1NXQA 4WJZA 4TROA 3BMQA 2DPGA 3T4XA 2D3TA 3LSYA 1YBMA 3NDIA 3NGXA 3S8MA 3DMTC 3QA9A 5A3JA 1HXHA 4EITA 4GKBA 3QSGA 5H82A 1LLCA 1O94A 3LT1A 1XWFA 4AJEA 3R0IA 3WBBA 5F1OA 3MTJA 4R9SA 2PA3A 4UUOA 2DT5A 3ZWAA 3WIDA 4NG5A 2P9CA 4BB6A 4B8WA 5CDYA 3SEFA 1LDNA 1CYDA 4A10A 5A4DA 3JYNA 2WD7A 4MIEA 4QSMA 2OOSA 3MJVA 1GUZA 3O38A 4CM9A 1O5IA 3JYLA 1P45A 4BS9A 1YL7A 1TXGA 1LC3A 1AXGA 3OJEA 1LA2A 2EKQA 4IGEA 3W4IA 4J2HA 1O89A 4KQWA 5DCUA 1B8UA 4R51A 1ADBA 3NTRA 3GPIA 5C5IA 2IEBA 2YDYA 5I7FA 2TMGA 4GMFA 4IDGA 3MOGA 2VNSA 3D3EA 5G4LA 1TI7A 1DIHA 3K9QO 5HA5A 5H81A 2Y93A 3I9KA 1Y8QA 2Y1DA 1YGYA 1X1EA 4YXFA 1E5QA 3KEOA 4II3A 4B3HA 3ZNQA 3D5QA 3F1LA 4IIUA 2VWPA 4IMRA 3DEYX 5JXWA 1EUZA 1B0AA 4LMPA 4YJFA 3KYBA 3QE3A 5KNLA 1DC4A 1LLDA 1C1XB 4WLUA 2GSDA 3WSVA 5KJ6A 5A02A 5IG2A 2IZ1A 2GN4A 2VZ0A 4LCJA 1KEUA 1H6CA 3QRWA 2CZCA 2UV8A 1AHHA 4RPLA 2D4AA 4RVHA 4AL4A 1VI2A 2ZJ1A 3WMWA 4O6VA 1OBFO 3JQGA 3RJ9A 4AJHA 4DMMA 2G1UA 3AU8A 4CPDA 4E2XA 2FR0A 4RCVA 4DBVO 3D0OA 5L9AA 4YEDA 1S7CA 3OJLA 3QVWA 4BNNA 5T8KA 3DONA 3VAZA 3C3XA 3RI3A 2Q4BA 3U4DA 2CDCA 1JW9B 4D3FA 1E1LA 2X4GA 3ZWWA 4KUGA 4MIYA 4BNLA 5THQA 2C82A 4IQ8A 2CDAA 3ZWPA 3FBGA 3E82A 2J6IA 3MTGA 2DU8A 4MINA 5U9CA 3NT4A 1LRLA 2DBZA 4DC0A 5ADHA 3IJPA 3ZNOA 1QLJA 3PFWO 1TVEA 1W0CA 2EJVA 1Q0HA 2O7QA 2O3SA 1I2BA 3HDJA 1SCUA 4Q39A 4XYBA 4XGIA 4B8ZA 5BSHA 3JCZA 4U8GA 3GDFA 1BTOA 3K96A 1DIBA 3OQ6A 1MC4A 1YBVA 5KVVA 2ZTUA 3SC6A 4TMFA 4CLXA 3IS3A 1ENYA 3V1TC 2ZQZA 3JQGB 3VVBA 4RVSA 3DZKA 3M1LA 2X0IA 3O4RA 5KJEA 4MOWA 5DBIA 5JPIA 3ZU5A 5G0UA 1RKXA 4UVDA 2QRKA 1U9JA 4RPHA 1HDCA 3FWZA 5MDHA 2QYSA 4J90A 4NK4A 3I4FA 1HRDA 3WR5A 4W9NC 4YRBA 2VHXA 1M67A 4CR7A 4YAIA 1DSSG 2VWQA 5CG1A 2UAGA 2NQ8A 1R37A 2HLPA 2Y68A 5KVQA 1H94A 1OI7A 4IS3A 2CD9A 2D5AA 2GZ3A 3I6IA 3HDYA 4RORA 5BQFA 1MX3A 3CSDA 5JE8A 4KZPA 1IB6A 1Q1NA 1H9BA 4ZQBA 2EW2A 1SZJG 4J4HA 2PH5A 5DBGA 3G1UA 4CM4A 3WGHA 3F6YA 3DTTA 1R12A 4R5HA 5CDTA 4GWGA 4TVBA 1GPJA 3GG2A 1QXSA 4E12A 2OO5A 1V0JA 3MJEA 2D59A 2DUUA 4E2WA 2YW9A 4BNYA 1CETA 3WQQA 4BV9A 4EZBA 1GR0A 1ZJYA 4D45A 3VPHA 1C3VA 1H9AA 1H2BA 2QZ9A 2FZEA 2NVUA 3DMTA 1K6XA 2X86A 1LBEA 4EJ6A 3MJ4A 1P1KA 4PZCA 2WSBA 4XEHA 1P9LA 1MUUA 4ALMA 3CIFA 1Q7CA 1EBUA 2I66A 2W90A 1FF9A 1I3MA 3BMCA 4FB5A 1XDWA 4N18A 3RBXA 2O4UX 2VUTA 3QP9A 1ULUA 4KUHA 3GFGA 3MJCA 1E77A 3S2GA 4RLSA 1R15A 3C7DB 4UUPA 2A94A 2I3AA 2O4CA 4ZGWA 5L51A 5G2OA 4F6LA 1NP3A 4J0EA 4RDIA 4F3YA 3QQPA 1LDEA 3PYLA 3ITKA 3KYCB 1Z75A 4FCCA 3WYEA 3GGPA 5KCZA 2I9PA 1H93A 3RUDA 4EUFA 1NFFA 1R6DA 4IDFA 2FOIA 4IQ0A 2HMSA 1A71A 4DPLA 1PU2A 1I32A 2CF6A 1PX0A 4Y67A 2Y1EA 1BDMA 4R1TA 2PV7A 4PIVA 5BSEA 4B7XA 2DTXA 4BUCA 4I5DA 3AK4A 3I52A 3CE6A 2V6FA 2VCYA 4J1TA 4E21A 3C1AA 2WTBA 1O8CA 5JS6A 1KBZA 1Q0LA 3VOSA 3ETGA 1X7GA 4N54A 3OSUA 4YRDA 5I7EA 4O0LA 4XKJA 4DRYA 4IM7A 1KY4A 3PZBA 2Y0CA 3RBZA 4MVJM 3QWAA 2G0TA 1E0DA 5ENDA 1YO6A 4J6FA 3BTUA 2ZCVA 3EZLA 1M6HA 4YAJA 3UCEA 5C7OO 1T26A 1E3JA 1XU9A 1MA0A 4OGWA 1DFIA 1U28A 5BNIA 4G5HA 4L9RA 1G1AA 3VH2A 4M8SA 3BMOA 4QXMA 5L7YA 3WNVA 4NFYA 4FFNA 2H63A 4WNCA 3V8BA 1GZ4A 4XRRA 1P1JA 1RWBA 4K1LA 1J5PA 1P31A 3GFBA 1UXGA 2DVMA 1DXYA 2AA3A 2IYOA 4GX1A 4J43A 5ILOA 1T2EA 5JDCC 4YRAA 2C7GA 1KVQA 1M75A 5C3MA 5ICSA 3LT0A 2ZB8A 1ZEMA 1ZZEA 4XQ9A 3DZGA 3GN2A 4Z9YA 4E33A 4CLOB 2OBYA 1YQGA 3UAGA 5A9SB 3OMLA 1IZ9A 1GPDG 5T57A 1WMBA 4JN6B 4LRSB 3IUSA 1V3TA 3I9JA 5T5QA 1LQUA 1DB3A 2PZMA 1GYPA 1KOLA 9LDTA 3C7AA 1BVRA 2GN8A 4L4XA 3DAGA 4N5MA 4NNJA 4J7UA 4XX0A 5FFFA 4ONEA 2EWMA 1PS9A 5JO0A 1BVUA 4PGFA 2GASA 4YYZA 3H3FA 1QYXA 1KY5A 2IODA 2CSUA 4J3FA 3BHIA 4UUMA 5L95A 3E9QA 2J3KA 3F3SA 4KWIA 3UOGA 3AM3A 3H5NA 4YJDA 3AM4A 1NPDA 3V2HA 3AI2A 3PDJA 3PEFA 4WEQA 1KC1A 1I0ZA 4FBGA 5DP1A 4ZQFA 3VC7A 3D4OA 5AOVA 1JA9A 1HE3A 1XLTA 1O95A 2E48A 4FC7A 4CL8A 4LGVA 5T6BA 3KRTA 1Y7TA 5C7IO 1GQQA 1XELA 2B0JA 1GDHA 4WCFA 5DN9A 4BKPA 2X58A 4E5PA 3D4PA 4IDBA 2GPTA 1ZUD1 1EUDA 3ROQA 4F46A 1A72A 2AEFA 1F8GA 3NT2A 3ZV4A 4XRGA 1R0SA 1I33A 4YQZA 2BFAA 3FCOA 5KJCA 3R3SA 2Z1NA 4P4LA 3V1UA 1PJQA 1TT5B 1XQ1A 2OZPA 4H3VA 1NQTA 5BSGA 5CEJA 4BNJA 4AJ2A 1DFGA 1EVJA 2WD7B 4BNTA 2QHXA 4OMUA 5ITWA 8ADHA 1T1SA 3GHHA 1YL6A 4GLLA 1NYTA 1ULSA 4KQXA 3RWBA 4CM5A 2Q4EA 5ENVA 2PWZA 5HWSA 1TB4A 3Q11A 1Y8QB 1ZSNA 4R16A 1PWXA 3DOOA 1ZNQO 2G5CA 4P4GA 4H15A 2YUTA 4I5EA 5BNTA 4ZQEA 4PLCA 1RPNA 2C5AA 2PKQP 5EINA 3UF0A
chains in the Genus database with same CATH superfamily
5AKYA 2W6ZA 4OPMA 2HMUA 3H2IA 4WESB 5CLIA 2Z1MA 4YCMA 2O7SA 4JWKA 1M5UA 1KFJB 4HSEA 3GJ3A 2RIPA 3W2IA 2MCFA 3LNTA 2QGFA 4XUEA 3IDFA 3TLXA 4M54A 1G21B 3GY0A 5AVWA 1NAIA 1S3IA 2SKDA 4HFNA 4JX9A 3HUEA 3ELWA 3ZJYA 3FDZB 3AR2A 4X66B 2BI4A 3A3NA 4UC0A 4BGDA 5KVCA 2O07A 4XVHA 3ZIAA 1LNZA 1RIFA 3TD6A 2Q2NA 1L5SA 3HYRA 2NTJA 4OJTA 1V9LA 1XQXA 3NFRA 4MKRA 1B6GA 4IIVA 4YPVA 2C8KA 4DMUB 1X13A 2HWWA 4CMCA 4R69A 3A1NA 3PT5A 3RUCA 4WASA 4CN8A 1QTNA 1KBQA 1UZMA 1YAHA 4J4TA 4LZZA 2NSYA 3A1DA 3RU2A 3VDXA 1JYSA 2JLWA 1DBQA 5HFNA 4DY4A 1J0CA 1QWOA 4Z6KA 1RJGA 3PUIA 4KIGA 5F77A 2B1JA 4YMTA 1QCDA 2OR3A 3QKIA 4NX2A 4AMYA 2H9YA 1T9HA 3UGQA 1C3OA 3SYNA 2A5LA 2CT8A 1II8B 2FV8A 1RIIA 2XA1A 4IOJA 4FR5A 4TT8A 1UBKS 1CUCA 1QIEA 3BSYA 2I1QA 1I7DA 4DR3B 4JEHA 3THWA 5HMLA 4BMXA 3DYIA 3IC5A 1U3VA 3DMFA 2OA0A 1JPVA 3MHPA 3LAWA 4EO4A 4IIGA 4QXPA 4EBBA 4P3PA 4A8JC 2Q1TA 1E63A 2NWQA 1MAUA 5JSHA 1QHHB 2OXCA 4N5IX 3THOA 3BWVA 1I3LA 1WKVA 2DOKA 3G2NA 5JNSA 3HXQA 5CVJA 5H7XA 621PA 4TQUS 1IK6A 2RK6A 4FFBB 5EWLB 4IHAA 2FKAA 4Z99A 1C0PA 2V98A 3NHZA 4NMHA 2SICE 5DTRA 5BYAA 3EDCA 1BWQA 4IJKA 1QRTA 1RQLA 1NONA 2H1IA 2W37A 3OIVA 4HAUA 4UULA 3TAXA 2BW0A 1Y1TA 3H6HA 3X1ZA 3MGCA 2OGZA 4UXIA 3I2HA 4IEIA 1W4BA 4JLAA 5A2QA 3NRCA 4G1EB 4IZOA 1RRGA 1H2WA 1SBNE 2ZT8A 4RESA 1IBLB 1G5RA 1QK3A 5HM6A 4ZJUA 1DAGA 2OE2A 3FJOA 1W46A 5K0FA 3FOZA 1ID8A 1UDAA 3NPAA 4MW5A 1JTFA 4D4IA 2J0SA 1JIQA 1OASA 1TYDE 1Z45A 2HPVA 1GT6A 2OV3A 3CC8A 4H27A 4B47A 5KQRA 4GS5A 4JI4B 1M33A 2HBZA 5REQA 2HJSA 2OCXA 4FOTA 1AQNA 1XYYA 5H02A 1DC5A 2DPHA 1II0A 1M0SA 1EAMA 3HJGA 1ZUNA 2G5TA 4Q9AA 4BNDA 2F3SA 3TG8A 3GVCA 1P0PA 2AS0A 2X1VA 3OKFA 4CHGA 5CVTA 1P80A 2Q3LA 2CUKA 3K6SA 3BXXA 5E2BA 2RH8A 1EP9A 2FZLA 3HJHA 4OI2A 2MT9A 2R751 1OLXA 3GCXA 2EBWA 3OIYA 4FR2A 3EUWA 2Q21A 2Q4TA 2X76A 1FP1D 2PGJA 2H16A 4TOIA 5FBVB 4Z4GA 1RRPA 1IONA 3F9IA 3FPAA 3OA0A 4CRWB 2OAQ1 3IEXA 4YCAA 2JD1A 2I6SA 3W79A 2E4YA 2P4EA 1M2FA 2GETA 2ZE7A 1OI2A 4NBLA 4L9AA 3OF2A 1CZLA 1N5DA 3Q6NA 1ZMBA 1T5LA 4D6PA 4NCNA 4DZRA 2J5RA 2OHVA 2RI6A 2HHJA 3CNEA 4I50A 1R00A 2DQSA 2DAPA 2GBIA 4LQDA 4N3CA 1RJWA 2XYVA 4KN9S 3UHJA 4XCXA 1RE1A 3H2SA 4YRGA 2FVYA 3KDAA 1OT3A 1VP3A 4RVGA 4ZEOA 1VI5A 4ZI5A 1EFAA 2WVGA 1U2GA 3QH4A 2Q3HA 1G6HA 2AI1A 4BKMA 5JFTA 4QUAA 4BMCA 3WB1A 2Y1FA 4E2FA 3ILVA 3HKDA 5BMVF 3PWSA 1SZPA 2HUNA 2IEYA 2XTNA 4E5UA 2JCBA 1T9GR 2J6CA 3HE3A 2XT0A 1QZZA 4TSKA 3QLJA 2QX8A 3WSWA 2DTEA 1QRDA 1QFSA 2BM9A 1P9NA 1BCSB 3X2FA 5C8XA 3OLXA 5JS1A 1P7YA 4YRZA 4P98A 2FPGB 4RPIA 4RVDA 3ZQKA 1NI4B 1U4NA 2Q4DA 1EX9A 2GNAA 3AUAA 4TTJA 3PD1A 1BXRB 2RK3A 3TTYA 3QOYA 3QE4A 1IUOA 4ZQGA 4CLOA 2TECE 1Q19A 1PS8A 4FDLA 2EGUA 4J0CA 3TB6A 3W5CA 2WYWA 2XKKA 2H6EA 5EQDA 4A6XA 2H9IA 2I29A 2EOAA 1FNDA 2CXOA 3ES9A 4HNSA 3MWYW 1AC5A 1L4GA 2WKPA 2XUQA 4M1QA 4JC8A 4E94A 4ECAA 4BUZA 3X2EA 1SUAA 2GDZA 4S24A 4YUAA 1K06A 1A7KA 1ULHA 4P36A 5CW1A 3ZY6A 5LUAA 3Q3JB 3OI7A 4M4SA 1MF7A 2WHYA 4M87A 2GPNA 4RF4A 1DADA 3IERA 5FPSA 5EHQA 4OGFA 1Z0DA 1IIRA 4IV8A 3S2EA 4PWYA 1E0AA 1UXHA 1XCJA 3FHLA 1QLWA 5DSZA 1CE8B 2AB0A 3I6YA 4HZUB 4C6HA 4P5DA 5EKUA 2CFSA 3A2KA 1VRVA 5BUCA 3BH7A 2XUDA 2DMRA 2JIPA 4JA0A 4JT9A 4Y2RA 4YP0A 5DNDA 3U1VA 1UBOS 1J2TA 2YTZA 1DS6A 4LF8B 3DYBA 1JJ7A 1ZISA 4G24A 4R2JA 5K8JB 4LF4B 2QNBA 4P7BA 3ELUA 3HVIA 3GN1A 3G3EA 4TV9A 3U7QA 4HNTA 4X61A 5A0FA 2C95A 4L5CA 1TA4A 3GD7A 1SC4A 1GPKA 2N3ZA 1AVTA 1SVWA 3VBEA 2MINA 3IPXA 4M89A 3TS1A 5K0GA 4N7RA 7GPBA 3N0XA 1ZESA 4HP8A 3L6BA 2PVPA 3TBFA 3HO1A 1Y9JA 2JDIA 1KAGA 1V8DA 4FD3A 5K01A 2ACVA 2R65A 4S1VA 2DFDA 1QO9A 3RYHB 2GKSA 3X1JA 2BEVA 1N36B 3R5XA 3T5BA 2IT1A 5I5GA 2P2CA 3MWDA 1AQ6A 2ZQYA 3Q2IA 4WE3A 2K7FA 2Q6TA 1ML4A 2WAAA 1OQAA 3KEQA 1HT1E 5EZYF 4E32A 4OL0A 3FSEA 1E3LA 1O0CA 1Y1QA 3IPAA 2XMPA 3HBLA 4U7FA 4YASA 1TM2A 4BWGA 4DMHA 5IAAA 5CFQA 3TSOA 3P4YA 2EKDA 2QM3A 5LMNB 3V8VA 1KNXA 1E79A 2IP1A 2UZ3A 4ZALA 4ZT4A 2YWFA 4GRAA 4UCQA 2I1WA 1KO8A 1OR8A 4FXPA 5EIOA 1QMPA 2FDCA 4BEVA 5KQPA 2XADA 1KRXA 3C3WA 2VH2A 3RVNA 4LX0A 1C7JA 1KOJA 2EHDA 1JQ3A 1PEYA 2J32A 3EGWA 5J63A 3VOBA 5HF9A 4HAXA 5L3SB 1ZS9A 1GR1A 5DT9A 4TM7A 4EKGA 2OFXA 4GMXA 1UDRA 3QLEA 4IDPA 1Y4SA 1Z56C 3OZEA 2ID4A 1N0IA 4UNRA 2DY1A 3U5ZB 4BEBA 2JVIA 4LIPD 3TLEA 3O1LA 1BX3A 1MPXA 4W99A 2HO5A 1W59A 4C14A 4EFNA 3VHLB 1CR1A 3N2KB 3O5AA 1USKA 4M1OA 4I0WB 1Z4QA 5GOZA 4FR0A 1Y82A 1T3ZA 1KFBB 2EZTA 2ODQA 3IBSA 2X0EA 3ANNA 3KS9A 3VH1A 4FOOA 2F90A 3O0TA 2QTNA 1R8YA 2VSNA 1CRZA 1T25A 5EIBD 4H7IA 4HMOA 1CY1A 4MVJD 2EYQA 4R1QA 1ILEA 1VFPA 2A5DA 1MV5A 1O5TA 2CKDA 2XNKA 2JFFA 1Y5RA 1ZJWA 3V7WA 4P3KA 2BJHA 4FIZA 3T9FA 3CJTA 1YDHA 2JJ2A 1U8ZA 1O77A 3HY3A 3WMEA 5K0BA 3NBZC 1POWA 1XD9A 2QNRA 3TR5A 4OLFA 1UMDB 5KREA 3F4LA 4U39A 4YAGA 3UPTA 2PZJA 4DCOA 1WB4A 1J1IA 4C06A 2GK4A 4TUYA 2GPBA 3MJDA 3ZI0A 2NO5A 13PKA 1DNPA 2PKYX 2Q99A 1V2HE 1XU7A 2J30A 2WPDD 3LUJA 3WYBA 4EM6A 4FGKA 3FPCA 5AFSA 4QXOA 1U99A 3JZAA 1FYXA 3L4SO 4U02A 1VJ0A 4A82A 4BZPA 2OC9A 3JATA 3R23A 3CVVA 1T3SA 1DZ3A 3COZA 4WLNA 2GZ2A 3IHTA 1DEKA 1HEUA 2RGEA 4L07A 5DTMA 4XX1A 4EY7A 2C31A 2Z08A 1YCHA 1EX6A 5A4KA 4Y6RA 3PPVA 3UANA 4W5QA 1VECA 4RW0A 2V4ZA 4REQA 1R64A 4EKYA 1PAUA 3L1UA 3WK7A 1HGXA 1QS0B 2IW3A 3JQFC 4ENTA 2Z6AA 3ZHSA 3ODPA 3PUXA 2JZCA 3TXAA 3EXFA 3EUAA 2PYDA 2PGXA 3GLQA 4QQFA 4C07A 5BQPA 4B80A 4YQFA 5B2ZA 3N76A 1PFUA 5EERA 1E3IA 2OCAA 5JH7F 4DV3B 1V3QE 3KWLA 4F8YA 4HVAA 4RULA 3H2ZA 1GZ6A 4YV7A 1BZYA 3QEOA 4UCWA 1P0QA 1RWQA 4MW2A 1B73A 3T3HA 1JKMA 4OUDA 5JHGB 3GPBA 1NNI1 3ZOKA 4IGIA 1CUGA 4A7PA 2IOQA 4PLZA 4EWLA 4N0QA 121PA 4IQFA 4CI9A 3TAHA 2B2NA 5E7MA 2AHRA 2D2FA 1JKJA 4KYTA 3GIWA 4EPTA 1ORRA 3I37X 3O2JA 2AZ4A 4KQHA 2OLJA 1BOOA 2O3RA 3Q72A 2Z57A 1QG0A 1V45E 2W7TA 3A1UA 3RVSA 2MINB 4A26A 4XFKA 4YLEA 4BN5A 1ZC3A 1L5HB 3CHYA 4ZRDA 4DA9A 1CEQA 1N8SA 4JXJA 3Q8WA 5H0IA 3D6UA 5JSQA 2FFQA 4QPPA 2CSXA 2FSVC 2HPZA 2X6RA 3I83A 4AJOA 521PA 4ZO8A 2DWOA 1OSNA 2FA9A 3A9WA 3AZOA 3MBOA 4P82A 5ALPA 2ZRIA 3FF4A 2XGSA 2ATCA 2ECFA 1RM3A 1YFKA 2JAPA 3QVGB 3SNKA 2BGWA 2EW8A 5K3CA 3G8DA 3R7BA 2EC5A 4NPAA 2B4YA 4WK4B 5JMWA 3ACCA 2HHHB 4H6WA 1Z2AA 3OU6A 1EIWA 4TQ9A 1UBUS 4EDFA 1MJGM 2EGHA 1X15A 1E8NA 2IYLD 2JBAB 2W70A 4NARA 4Q15A 2I5PO 1R8JA 3KM0A 4IRUB 3LPNA 1BQ3A 3FFXA 1JKFA 1JLLA 3ZNPA 3BHJA 4MV1A 1Y3CE 3L7IA 2OD2A 3MJTA 4EEZA 5FUQA 1PTJA 2B25A 3LPDA 3IMGA 2C00A 1UAGA 2QRLA 4MVXA 4ETMA 5BOSA 2QTRA 3AJ8A 2SECE 1PEKE 4UMDA 1UAAA 1EDOA 1EK1A 2JGLA 1ZNXA 1JT2A 3EC2A 3DT6A 2VJPA 1WXXA 3JU3A 1RAAA 3E1SA 4CVNA 4OX9B 4XW2A 2QOEA 3TZLA 3FRJA 1PJCA 4OV6B 1F0PA 4QQNA 5K45A 5KSWB 3RRYA 1QZTA 1ZWLA 2F00A 4K9DA 4IPTA 1JA1A 2NO0A 2E4VA 3QMWA 1W35A 4DABA 3ETLA 3FY4A 5I4IA 3AKEA 3H1GA 4MQ5A 4HRXA 2FPMA 3T41A 3I32A 5LQKA 4CWAA 5LJIA 2O2EA 1PR4A 5EOVA 1NVDA 3BD6A 1E2EA 4H59A 5JAHA 3LL4A 4Y1RB 3P0HA 3VU1A 3AUSA 4R6XA 1MT0A 3U7EB 1VPVA 1VZ3A 5CNMA 3URKA 1AK1A 1R4AA 2JAWA 5C46F 5EE5B 4JB2A 4OAQA 1ZW1A 2XQKA 4AJNA 4R41A 2ONKA 1P2GA 3ZCRA 1RTTA 4D2IA 2HSGA 2V65A 4EUEA 1XHFA 3EZFA 4F85A 3QELB 5BO5A 1XUOA 1JFSA 1PI3A 3F4BA 4GR4A 1P3Y1 4EVRA 1P1RA 4TV9B 3IILA 1PWZA 1XLUA 1KH3A 2LD4A 3P9SA 1O58A 3DYVA 4G0ZA 4D42A 4NRDA 2QRMA 4OJNA 5GGXA 4JLWA 1N1DA 1ZK0A 4MMZB 4PNPA 3GT3A 3BWDD 5AI9A 2BKVA 4ZIRA 1JLKA 2QRUA 3VR4D 1KJWA 4R1MA 3PJRA 2NZ8A 3GLRA 3H5OA 4GRIA 2IYNA 4NE9A 1RMQA 2AIRA 3DB2A 3OQOA 2CKMA 4OM8A 4IJQA 5AVSA 3RC1A 2ODWA 2VQ6A 1HPLA 2JS7A 4GYKA 4YCDA 3GK3A 4XB6B 5BW8A 2VQDA 2YXBA 5AI5A 2CXUA 3U48A 3WIOA 3WZMA 4UTVA 5CA1F 3ABZA 5AUNB 3UKJA 4IMJB 5D87A 3TOVA 4L3OA 3CSUA 1VLJA 1EAYA 5EQTA 2B8EA 4KGXA 1Y80A 5EFZA 4CG2A 1KVSA 4EHDA 4A4DA 5E6RB 1U28C 1YJXA 1KQGA 2P9QA 3HVUA 1XLVA 1YBHA 3LKDA 1UOPA 1A97A 5D1HA 5AW0A 2XUGA 3KE9A 1KVRA 2O8NA 3TG2A 5SZIA 1RHKA 1W47A 5DLYA 3R8CA 3TDMA 1NF8A 3CVYA 2H5LA 3AL2A 3HB5X 3D2BA 3H99A 1RM5A 5K0LA 4PTLA 1LZKA 1CZOA 3O83A 3H1AA 1QHGA 3CWQA 5TC4A 5B3AA 3NWOA 2O3JA 2VJLA 4C7KA 4XGQA 2NNLD 3SYLA 5EZYB 2ZXEA 2WB2A 3C6MA 4PFKA 2ZYWX 4OYRA 2CFIA 4D6XA 1DTWA 1F6DA 3EE6A 1I80A 4I1RA 3WRWA 1FB5A 4PC6A 1K75A 4Y2GA 3DV0A 3DZIA 4XZ3A 3UGTA 1P8AA 5JQGB 1ENOA 1DTEA 2WTMA 2UZ4A 2JLVA 1RQ2A 3STHA 2DX7A 1YS7A 3VNAA 4QEDA 1KIFA 1UADA 1Z6ZA 2X8WA 3NP7A 4JHLA 3LYUA 4FFPA 5AW6A 3FGOA 4JJIA 4WJKB 1A0OA 1ZDMA 3AVOA 3M2PA 1T6ZA 3QF7A 4XJSA 1LW6E 1SD5A 2G1JA 3EPRA 4MQEA 4ZPJA 1YJCA 3IDZA 5IN5A 4EB8A 4OQLA 4FEGA 2V4UA 1D2RA 1UZLA 4UJ5A 8ABPA 4M6WA 2XPCA 1MO4A 3I2YX 4G1FA 3DVRX 3AW9A 3OEED 3B6EA 4FYYA 1XMOB 3K9NA 1CUEA 4EYSA 2F1KA 4BLTA 3EGOA 2GXSA 2WHEA 4QA9A 3T7EA 5AXCA 4FGZA 1BD3A 4BO7A 3LS2A 4LZWA 1Z62A 3E7FA 3WGGA 4RLQA 4OCZA 2E0IA 1R27A 3PI6A 5GWXA 1XT6A 3V1NA 4FCTA 4KN8A 3F97A 4BLPA 2AHOA 4MWZA 1I7SB 4N3BA 2EERA 4KRFA 2BMWA 2II6A 3GGOA 4NMLA 5JAPA 1EBBA 1XNHA 4AKHA 4PINA 2Q5LA 3IRUA 1V4BA 1GNPA 3CJRA 4I6EA 3TMKA 1ANKA 4ZZIA 4D0SA 2FRVA 3KQLA 5EJFA 3T52A 5LYJA 5JYCA 4B35A 1FP2A 3TTXA 1BWRA 1KYWA 3CX8A 2XAAA 1NW6A 2DR3A 4YJ3A 3OM9A 5DSXA 2E1RA 4H60A 4QOGA 3WHPA 1E0KA 2IHTA 4A5OA 1A8UA 1HORA 1OFUX 1JPUA 4YR9A 5JBIA 3V8PA 3UK6A 3AFGA 3PF8A 3WGJA 2AVDA 3CMMA 1YBAA 2H1LA 4WZAA 3EFHA 3LWDA 1VKRA 1KK2A 4C01A 1VYHA 4OK3A 4YMLA 4G65A 1U94A 4YH1A 4ON9A 2Q28A 1P44A 3UXHA 1MN6A 4D57A 4IP0A 3DSRA 3SE7A 4D8UA 1Z7GA 4G56A 4CQNA 1OIXA 4RM2A 2H00A 3ZXSA 3UXYA 1U2DC 5HF6A 1WZUA 2PGLA 5AVQA 1C9DB 4CYMA 1KPHA 2GN2A 2JGFA 2XOXA 2VF7A 5CEEA 2WWIA 5K09A 1GUFA 2W2TA 1Q0PA 4H7DA 1BW9A 4H17A 4HOYA 1BDBA 4ENQA 4D82A 1L8XA 2HA0A 5FRDA 1ZU4A 4RKFA 4TUYF 5FFMA 4BE4A 2XITA 4FBLA 5I7UA 2IJGX 1VJ1A 1V6SA 3KZ1E 3LT2A 3QFCA 4JT4A 1KDVA 3LOQA 2IV2X 2XOKA 2ZTHA 2ZTVA 4NBUA 5IC6A 1OIVA 4KWEA 5BV2P 3GFSA 3RIXA 1W0KA 4ZYWA 1CYEA 1AGNA 1KFKB 1TM4E 1UC9A 3PV0A 1OUMA 2FYTA 1TJ5A 3LDHA 1P6UA 1E1RA 2QVZX 4JEIA 1O95D 1TVMA 2XNDA 3IP5A 1KI8A 3C3EA 3FLMA 3PFCA 5LXTF 3CRMA 5HE8A 2OKCA 4D9JA 1GZVA 1NWCA 3T5AA 2XRFA 3AVTA 4YO8A 1FDRA 1VPLA 2EJTA 2NSJA 3CRQA 3N74A 5CIWA 4HEHA 3HKBA 1M66A 4OKNA 5K0CA 1YDWA 1SO8A 2VZEA 4C05A 3HB9A 3E61A 4XIJA 1CY6A 1JQAA 3K9HA 3ZBQA 1VL2A 2OBNA 1RTKA 1M8GA 1KQ3A 2LTAA 1WHSA 2PMWB 1I30A 1PJ3A 2H51A 4FUTA 1Q7BA 2ZRJA 4L27A 2C94A 5FHRA 4TMZA 2Q5IA 3OX3A 2ZT5A 3JSXA 1KO7A 3UMVA 3R6LA 3R2JA 4ZAWA 2NO4A 3MGKA 5B3KA 3EUEA 1DEAA 3C97A 4QDOA 1PDVA 2AWNA 3PHLA 4Y3UA 4EY8A 2FPUA 4CM7A 3ENKA 3FPLA 4QPDA 4TTRA 1ID1A 4C4TA 2UYCA 2O5EA 1IE3A 1MFPA 3P8ZA 3PNBA 4G5YA 3I1IA 2R7NA 3UFXA 2B4QA 2YFKA 4NH4A 5A0TA 5J58A 2J5QA 4INAA 2C2HA 2YVAA 1FMCA 3HY4A 1GNSA 3SQNA 1EK5A 3PDIA 2HHCA 4FOSA 1N2IA 5KYTA 3COVA 3TQRA 4KE9A 1ADGA 3T99A 1WXFA 2CHEA 2C77A 1T3TA 3ESCA 5SZJA 3SKVA 3U19A 3W34A 1JG6A 2ZETA 4MI3A 1JHXA 4GGMX 2PX0A 4X84A 2F1OA 3V7NA 3ETCA 3WYAA 3Q8KA 1C7RA 3H5IA 4HG2A 3R9WA 1A7UA 4Q01A 3DE7X 4XSGA 4ZD6A 3F78A 4X8LA 4YRSA 1UJ6A 3F2VA 3WNQA 4QDJA 3ZR4B 2JIMA 2GHTA 1QJ4A 1BN7A 1ZR2A 5BT8A 1M3SA 4BQFA 3TDKA 1X7DA 3DBHB 2QAGA 5IJAA 4KXFB 1W7AA 4B4UA 2ZUDA 3B12A 1UBRS 2QRGA 3C4VA 3HCAA 3QVJA 4JP5A 4WXYB 2YZNA 5B1HA 4NCBA 3KEGA 1QQAA 4MR9B 4HDAA 5HJ5A 2QPTA 2QV0A 2X0NA 1DEHA 4PANA 5M2QA 1OTYA 3WQHA 3A6HA 4J0GA 4LSMA 1NBMD 1WRBA 2P4UA 4OHRA 4RA9B 5B1IA 2VHUA 2B7BA 4HN4B 1JWLA 1IY8A 4M9RA 3RS2A 1YBFA 2YCBA 3SOPA 3SZMA 1WPQA 1XPRA 4AIRA 1U5BA 4B74A 2EZ9A 2XW6A 2X23A 1JDSA 1PR3A 2NADA 3JQBC 3FNEA 3PGVA 4JROA 4WWHA 2PBRA 3N7AA 3X1YA 8GPBA 2JFNA 4FWIB 3U4GA 1VHJA 5E4FA 4BGEA 2PS3A 2Z2XA 5CPFA 2HT1A 1UIMA 3ZD9A 1JALA 1DMSA 4O1IA 2BKEA 1BEEA 3ROMA 5IH3A 1NJ2A 3EW9A 4QG3A 1OF1A 2EX1A 2MU1A 5C1OA 5TLSA 3PRYA 3OLYA 5LNK1 4O2AA 1X9IA 3B13B 3IAHA 5CA0A 1TU4A 3FZYA 3OT1A 5L8VA 4NV0A 3B51X 4EA7A 2WKRA 4ARZB 1NY5A 3CUKA 4ZTBA 2HDHA 5HJ2A 4WOCA 3ZNNA 3KXDA 4INZA 4MQFB 1C7FA 3UA4A 4XDHA 5B1EA 2I91A 3NASA 3VFDA 2CLDX 1V39A 2AJCA 2LWIA 2H4XA 1O94C 4RYDA 5K20A 5AW8A 1SBCA 4B4OA 3CF4G 1CUVA 4ZVNA 1WXQA 4E1BA 3P19A 5EIEA 4PG4A 5K3DA 2JIZD 3AJEA 2HDWA 2VHEA 3CU5A 2D0DA 3COSA 3D8SA 4QTZA 4XAQA 3RTAA 2P0AA 4HD8A 2V1XA 2WU1A 4NXNB 1ND5A 3K8YA 3LQQA 3L8HA 1TCUA 2GKOA 4KMMA 4Z8XA 5FFNA 3QUBA 1L4KA 1SIUA 1V1JA 1CFZA 2VG8A 3L7JA 1NXTA 3ND5A 1U7OA 5BMVA 2G9QA 1OOEA 1U8TA 2RIRA 3QWHA 3ORFA 4DAOA 5LUBA 1MEEA 1YASA 4CN9A 2AOTA 2GJSA 2P4QA 3IBCA 2VYQA 3OEEA 4GOLD 3U1TA 1XZKA 2YQ5A 5FBKA 4QHSA 5AVRA 4OUKX 2ID8A 4NOLA 2IYQA 4ENWA 1UCFA 2CLLB 3RH0A 3Q3HA 5G1NA 4UUAA 4D7AA 3MRXA 3O1HB 1ZEJA 4FGSA 1AIPA 5JVDB 3G6KA 2XDQB 5IXSA 1VKOA 5IC5A 5EJ2A 2WWXA 3F46A 1C9JA 2SNIE 5C80A 4OXRA 1G5HA 2NPFA 3BFXA 2YS7A 4QFDA 3BREA 2C4UA 2IYTA 1J0XO 1H66A 2YHUA 1EBFA 4YC7A 5F4BA 1FUEA 1YVUA 2JK1A 3IE2A 2I6QA 2JJQA 4PZAA 4KC0A 2L2QA 1Z34A 3BFJA 2BT4A 3OTWA 3KKLA 5AM3A 2RHMA 2VDNB 3B82A 3FKSA 3G1WA 4L16A 4OTZA 5GV7A 4DARA 3BJRA 4EGFA 3I05A 1R0YA 2XWJI 3K0CC 2AQ8A 4A15A 1EMDA 4FHDA 1L5KA 1CVRA 1NUSA 3Q3VA 2J4CA 1FDOA 1NL3A 2FQQA 3VAYA 1UJMA 4IL5A 1KXJA 1DAKA 4O4IA 3V3TA 5JCPA 5FWXA 1VE6A 4E51A 5HF8A 2BMJA 1XTJA 4FWBA 3ZOZA 3GDGA 1LRJA 1RRCA 1Z83A 1SOMA 5EEHA 4HVLA 1C0EA 1E66A 5DLPA 1VSBA 2D3WA 2OAGA 5AKKA 5BR1A 3WA7A 3ZLUA 2VYFA 2QRPA 3H6GA 2G9VA 3HZHA 1KPGA 1M72A 4R8MA 1L7RA 4LXIA 1T4DA 5CCEA 1AS3A 3W5VA 4O4LB 3V4OA 3ZV7A 4GC9A 4X44A 3WJ1A 3H5LA 1V5FA 1GPMA 3LVRE 3FXAA 2AQKA 4CTNA 1GG9A 4D5EA 4OP1A 1JXMA 3PA6A 5C4GB 1G18A 4M0UA 5DTJA 2O9JA 4OHZA 3G9TA 1I6MA 1I0LA 3FUWA 4MRAA 2OFOA 4TXMA 2VJAA 2BIFA 3ZD8A 4R71A 2HI0A 4HUTA 2KE5A 1WBDA 3NMUF 3GFOA 2NO1A 1U9CA 3JATB 1OZ0A 2PKCA 3W1WA 1YS4A 2Q5QA 3EAFA 3SJUA 4B4WA 4XGRA 1I5RA 3U49A 3LLSA 3IAEA 2P2YA 4BNUA 5C34B 4X6UA 1WQ3A 1W94A 5JAMA 2VTDA 6GPBA 4TKUB 3LY8A 3M1AA 3ERCA 2Z8YM 3ZE0B 4W7IA 3P26A 4QXRA 3WB9A 2BH2A 1SCKA 4OQ4A 3D9QX 4NI5A 1YI0A 2P77A 2WDZA 1UT6A 1KH2A 1Z25A 2PUBA 3OY2A 3ZCTA 3EA5A 2CXPA 1KYTA 1KDZA 1F48A 3M3PA 4G8JA 4Z1MD 1IN1A 2NXWA 2CLIB 5TV2A 2PMKA 3OJWA 5K8LA 3Q88A 3BEDA 5FQNA 2EX0A 1U90A 2K7ZA 3PDIB 4JC5A 4FNGA 4QQRA 1JE0A 4XJXA 3QOXA 4CQLB 4EMTA 4EG5A 2VNJA 2H2FA 3CUVA 3DNPA 2G7MC 2VNKA 3K2IA 4Z9XA 1QQ7A 3RF6A 3ZHRA 2BRUA 4C2AA 3PNPA 4ILEA 2MWMA 1OLSA 1HQCA 2NTEA 4OH7A 3DZFA 1V4NA 3EQZA 1NFQA 1T34A 3AR9A 4QEZA 3S5UA 1J7JA 5IZ4A 1LPPA 2C2KA 2LKCA 1AH2A 1QFMA 2X5JO 4KQ9A 1NN5A 3CNHA 1QAOA 3A05A 3VM6A 1Z2NX 2QMYA 4XD7A 4DY6A 3L6RA 1SQ6A 3I5UA 5AJTA 2CD7A 3N6RA 1ADFA 2REBA 1OBVA 4PG7A 5KU1A 3AY7A 4NDNE 1P2UA 5KYYA 3JQ9A 4IDNA 4GYYA 5E38A 1GL7A 2XHZA 4JCCA 5D6OA 3FTNA 3S1LA 4E4TA 2H1FA 1JB1A 2Y1LA 2YXDA 2VBFA 2A5GA 2BELA 3IMCA 5HKKD 3K53A 1M9NA 4N8DA 5JSKA 2DSTA 4KYIB 2VXBA 3QK7A 4AJPA 1FXSA 1FYEA 1PJSA 4M1ZA 1IY2A 4CM1A 5CFZA 5TDHA 4B3XA 1EM6A 2H2HA 4XOUA 4P4TA 5LQSA 1C8VB 4E70A 4TRJA 2J67A 1J2JA 3L7LA 1E1KA 3V2GA 5K8UA 5HZKA 4U7PB 2CYAA 1FTNA 2CE2X 2P2ZA 5DPMA 3U5TA 3D31A 3GQVA 4LZPA 2ZSHA 4CQMB 1FLNA 1MXHA 1XL0A 3LQ2A 5TE9A 2QUHA 3BHMA 4BO4A 4JQCA 3DV0B 5LC1A 2CVHA 3TZEA 4MUXA 2FSUA 3E23A 3GMDA 1WTCA 1BE8A 1E2HA 1N2SA 4PQYA 1I14A 3FSGA 4V24A 1IZ7A 3UN1A 2GF0A 2RHGB 3GLVA 4UFNA 3UZUA 1XMIA 1GGMA 4B7UA 2WWVD 4PYKA 3KV3O 4BO8A 1YD7A 4G5QA 4IJMA 1N4AA 3K6JA 4O63O 1Y9DA 4POAA 2FW9A 3PCRB 5CBPB 1R6TA 1X80B 4G36A 3W3ZB 2FHPA 1MC5A 5AICA 1GNVA 3QXXA 4Q1DA 4UDNA 4BO1A 3RE1A 4W5NA 5JNUA 4FWTA 1DQYA 2F9LA 2Z2IA 4MKZA 4EG7A 3C87A 3AP3A 3PQ4A 2V6JA 2B92A 2PH3A 2C3PA 3C5WP 4HQLA 5EJGA 4JUAA 3IIKA 4JMLA 5IKXA 2JBWA 1E1MA 2P68A 2DHQA 4WMLA 5CT9A 5A9TA 2QROA 3V6MA 1P0CA 5CLGA 1HE8B 3DMHA 1EE9A 5EPOA 3WWZA 4RFSA 2AC4A 3OTQA 3LUFA 3PPXA 4P53A 5AJUA 2I3BA 1L5GB 4BB5A 3DVQX 2ERXA 1X7WA 4O0MA 2AZXA 1J24A 1RYNA 1Y42X 2DB3A 3P52A 4G5XA 3FR7A 3A58B 1DLJA 3PHGA 4I9UA 4I5IA 4NR0A 1EDDA 2XDYA 2EW1A 5FOVA 4PSCA 3IR6A 1XZLA 4QGBA 3CLRC 1JBEA 4EHKA 2Z6QA 1E9VA 1TAQA 1TMOA 3B1KA 4ZQHA 2G08A 4ITRC 2KMLA 2QWXA 3L92A 4CMHA 3GBVA 3WG9A 1QHIA 4WESA 4AROA 4PHTA 1ODFA 1M6VB 2H1SA 3USCS 3J81k 2Z8YA 4HNAB 2J9FB 3VDRA 1A04A 3M6IA 2OVBA 3G2HA 1PLJA 2AFVA 1V7ZA 2I55A 2I67A 5FI5A 2G09A 3WGQA 4C22A 3ZJVA 3IV9A 3ZBTA 2YC2C 3LRTA 1FW6A 4AZ0B 1R16A 4TMWA 2IWHA 5EJMA 3HA3A 2EZ8A 1VSQA 3D3WB 3Q8LA 3R4VA 3UJ9A 3H8SA 1PJZA 3KLBA 5A4IS 2HRBA 4RH1A 1ZMXA 2REOA 1Z0FA 2YMQA 3CN7A 4K6KA 2QIPA 4UJ3A 4ZVOA 4ZCPA 1B1AA 3HU5A 4FYMA 2QMHA 1YU9A 1N2BA 1D2EA 3JASA 3RPEA 3PX2A 1GL3A 3T7RA 3AZPA 2ZYTX 4YRMA 5JYDA 1GDTA 2P75A 1J6UA 3QWIA 4CF6A 2Y1OA 2PQ0A 4P38A 5LL6P 1R18A 3FRIA 2G9UA 2ENWA 3EEBA 2A0UA 3KQUA 4IIXA 3TTUA 3KJZA 5DEOA 2JZNA 1P0MA 1QIGA 3BSSA 3L79A 5KI6A 2GZMA 3PXBA 4JI1B 1VIDA 2I7DA 1GTVA 3JWGA 1Q0QA 1XVLA 3RS7A 1Z8NA 4FFMA 3REOA 3ZY3A 4WNIA 4DQXA 3EY4A 1T8TA 4GXTA 3GAZA 2YMPA 3L8GA 1F51E 5KSOA 1ZU5A 1BG6A 4M1SA 1N2GA 1G6KA 2I33A 2VBIA 4GOJA 4ITVA 4JJAA 4QDUA 3IDQA 5ECWA 5HE9A 2RAFA 1MIOB 4EVIA 3HDQA 4OHMA 5CDFA 5AVXA 2QVCA 3ITDA 1H65A 4DT1A 2YVKA 1W2WB 3FM9A 2EKPA 2A9VA 3L4EA 4NZPA 1FFDA 5TVKA 3W6UA 2BEUA 3FLEA 5DLDA 5JC8A 4M3NA 4OL9A 3SC2A 3WQBA 1E9RA 2FPSA 4LOKA 4E1VA 2AEEA 3DL7A 2XMQA 1LSSA 3WLKX 2P9GA 2GM9A 5DWVA 3A2LA 2FQXA 2YYAA 4XPIA 3FYHA 3SYTA 1RLMA 3DBIA 3GGDA 1MJFA 3ZU6A 4A73A 4B09A 4KR2A 2VI5A 3AXSA 4CF4A 4GOXA 2CNDA 3TOXA 3PUJA 3R0JA 1QHFA 5AKHA 3DEFA 3HFRA 3HEAA 3UYLA 4MDEA 1E99A 1WOMA 3M6VA 1NOKA 1O7JA 4UHFA 1JEYB 2GEVA 3U3RA 5FTLA 5JR3A 1H0RA 3H84A 4JK3A 1VIMA 1CB7A 4U00A 1TLTA 4UMVA 5KYXB 2ZWAA 4XSHA 4OI1A 1TC1A 2X9LA 2XE7A 5KJ1A 4MUEA 3SBOA 5KINB 3LOUA 4OHCA 1CDZA 2GJ4A 1AO0A 3KHUA 1SUWA 4P3XA 3Q7IA 1GPLA 3SZGA 1WXDA 1Y0BA 4KYVA 2N1MA 1NVTA 1CUBA 3E22A 2OO5C 5FL3A 3QWFA 3A9SA 1OAOA 2ZS8A 5KYKA 6NULA 5GIOE 2QT9A 3K0AA 2P3OA 2FHSA 3QVKA 5KTKA 4XR9A 4M7PA 2C5SA 2AEMA 3CWZA 5FBWB 3OE1A 3A14A 4JDPA 3WGOA 2CY0A 1GQ2A 3EQ6A 4MS1A 2FLVA 2FSHA 4JYAB 2VFAA 3D0KA 4W5TA 2LDBA 2ZM6B 1IZ0A 1R6AA 1FJ2A 2DR0A 2VA8A 2HSDA 3BKXA 3AR5A 3C4QA 4BRZA 1M1YA 2HJWA 4CI0B 4HPWA 3RT9A 4Y7DA 5JCOC 2CHUA 1UBNA 3EX7C 1GY8A 2P35A 4U3JA 1KETA 2DYKA 1ILWA 1JAZA 2YWCA 3CTMA 3I0NA 3WKCA 4I50F 4BZQA 4G0VA 2BTEA 5KHLB 2VBGA 2VN8A 1L7NA 3BK7A 4K8OA 5JRZA 2XRMA 2KBFA 2AZTA 5EKDA 1XVUA 5LVAA 4DR1B 3HA7A 4E15A 4DYHA 2F3QA 2BGNA 1UH5A 2P6PA 1LV8A 5CEFA 5K3SA 1DJQA 5IPFA 4CR6A 1U7PA 3PXEA 2O8EA 3A11A 2OFFA 5K05A 3TIXB 2VAPA 3ELDA 1V47A 1W96A 3EXIB 2X9VA 3JZIA 4Y0NA 3U0BA 4CE6A 1CDEA 3I45A 4ZHQA 3LXUX 1GOTA 5T7BA 4QIHA 2GCNA 4EI7A 3LF2A 4MUFA 1CRQA 1JXQA 2ICAA 4P81A 1X7XA 2C7VA 2PKEA 3EVEA 5I7OA 4W8GA 4N5NA 4G63A 2FFAA 4IUDS 3ENVA 1BEUB 1BHQ1 5ALOA 1GD1O 2EF1A 1SVKA 4IHJF 2ZBGA 5B6IA 4QBFA 1TLFA 5T6MA 2UXDB 2XB2A 5BQXA 3V7UA 2A0FA 3ADKA 4JFRA 5BMOA 4H3HB 3PJFA 2PSDA 4J0IA 1PEAA 2AG1A 3E0QA 5ES3A 5H83A 4ZCLA 5C3UA 4EATA 1GM5A 2FE4A 2ROQA 2QPOA 5ICGA 3SQLA 4RTOA 3KVRA 4QO8A 3ADCA 1FFCA 2QZ4A 1YRBA 2AV6A 3KT3A 1XG5A 5BNZA 3PKIA 4M1YA 3GUYA 3K0CA 4IMPA 1MJ5A 1I4LD 2F48A 4I1UA 5DE3A 4C29A 5AJVB 2VJMB 2CL6X 1NRIA 2WUVA 3BCUA 3JQ7B 3LCJA 3OZFA 1OB5A 2DM6A 1I2MA 3TGPA 5KO2A 4MI9A 5FAKA 1E5LA 2ZAOA 3ISTA 1E1CA 1E96A 3RVMA 1PR0A 4N6GA 3L7BA 5J47A 1PWHA 3EFOA 3ILYA 4L8WB 1TZMA 1KZ4A 2AL7A 3WYDA 4IV5A 2VHQA 3TOCA 1FDSA 1RJFA 1CD5A 3MQFA 4P80A 4JFAA 4W9RA 3RFXA 2EV9A 4UTPA 3W2HA 2PUVA 5HVNA 5HIAA 5DGXA 4LJSA 3FW1A 4UE3S 1WMEA 1BYUA 2YWHA 2QE6A 3EVFA 3ADPA 3U7GA 3ESAA 4B82A 2XGJA 3VNUA 1SEPA 2GT1A 4M9QA 3B36A 1DIAA 2W6MA 1H1LA 3ZH2A 1C8LA 3DBHA 2BZSA 1FFXB 2IZZA 2J9RA 2R6CA 2QUJA 2ZAGA 3N0WA 1QAMA 1Y3HA 2J33A 1US8A 1VYVA 4YONB 3EEQA 3GJ0A 3TIGA 4DILA 3TNLA 3EQ8A 1P8JA 1OAAA 1IXSB 1RHUA 2Y4NA 1C3OB 1FSGA 1Z0ZA 3HI4A 4KPUA 4Q24A 1R5BA 1FJGB 2GRUA 3RUHA 3ZGLA 5KDOA 4RA9A 1KI3A 3GLIE 3BF7A 1GP2A 4V2IA 4Y6SA 1PGPA 1K4YA 2IPAB 3CA8A 3K4HA 2WUWE 5AH0A 3SSOA 3B7PA 2MYNA 1VDZA 3LDFA 4IYRA 5AK6A 3TPZA 5I48A 1SBYA 3EXFB 4HV4A 4UOZA 3P2KA 4B5KA 3LXRA