4W9NA

Enoyl-acyl carrier protein-reductase domain from human fatty acid synthase complexed with triclosan
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
333
structure length
323
Chain Sequence
HAFVSTLTRGDLSSIRWVCSRHAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRSFEQHVLWHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLGMAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enoyl-[acyl-carrier-protein] reductase
publication title Crystal structure of the human Fatty Acid synthase enoyl-acyl carrier protein-reductase domain complexed with triclosan reveals allosteric protein-protein interface inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 97
structure length 323
sequence length 333
chains with identical sequence B, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w9nA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4w9nA01
2C7VA 4C7JA 2IODA 3NDJA 5TLSA 2Y0EA 4BO6A 1E5LA 2EF1A 1ZCJA 4MINA 4Y6SA 3FNFA 3AWDA 4BMSA 3GNTA 1PGQA 2Q4EA 5KJFA 3CMCO 1KY4A 2OXIA 1J6UA 4J9UE 7MDHA 1I3LA 4J7CA 4NJMB 2DU8A 4M87A 3V8BA 1QP8A 3HJAA 2VYND 1LXCA 2Y1GA 3I52A 4AICA 4DLLA 5JFOA 1XYGA 4A2CA 4JP3A 2XXBA 2JCYA 2E48A 4MVJE 5DULA 3IS3A 4LCJA 4YPOA 2J5RA 4WGGA 1VSUA 5FFFA 1GY8A 3BHMA 4AJ2A 2YHIA 3MJEA 4XD2A 5CPFA 2POQX 4BNJA 4E5MA 3H4VA 4LISA 5JCXA 2PKRA 4QSMA 2PTGA 1KEPA 1NASA 1TT5A 3H5NA 3WR5A 2FPPA 3TFOA 2OBYA 1A9YA 3AUAA 4IUYA 4Z0HO 5EIOA 1DFIA 4UULA 3RC7A 3UN1A 3GDFA 4J91A 4PRKA 1D1SA 4J9VA 1GCOA 3KB6A 4XGIA 4N5MA 4YT8A 2GRAA 5A5EA 3H2SA 2YFQA 3M1AA 5L4NA 3RFXA 3VZRA 4HFJA 3JQFC 5HWSA 2GN9A 3HZZA 1YDWA 4DPLA 1V8BA 2H63A 3AUUA 3DO5A 3S8MA 4FJ2A 4W82A 1DC6A 2NWQA 1GUYA 1V0JA 3STHA 5A04A 1MFPA 3ASVA 2VHWA 1C3VA 3D4OA 1MA0A 1E3SA 2GASA 1BG6A 3OJOA 3W1VA 2I9PA 2W90A 4LN1A 4QTZA 1MC5A 2OORA 3JQ8B 5IZCA 1PJQA 3ANNA 5DBGA 2PZLA 1EDOA 4LGVA 3HDQA 4BO5A 5K6AA 1E7WA 2RH8A 4RORA 5A9SA 5L9AA 1DLJA 3WBBA 4DPMA 2J3IA 1K6JA 1KOLA 2JJYA 3GOHA 3CSDA 3VPFA 1UAGA 5F1OA 3AUTA 4CQLA 2X5OA 3D0OA 5CEEA 1KC1A 1T26A 3ZDFA 4UEOA 4TVBA 4B4VA 3I9LA 4PLTA 3JQGB 1B15A 4MVJG 1EUDA 3IJRA 5H81A 4QQRA 4XYEA 2EG9A 3NV9A 3LVFO 1HYGA 3ZU4A 3UFXA 3LLVA 5JCJD 3M1LA 3LDHA 4IIVA 1PS0A 5I7SA 1HDCA 5F21A 2HDHA 1UZMA 1HRDA 1VI2A 2HMSA 1PR9A 4YJGA 3ANMA 3HFGA 4KTVE 3RIHA 1T4BA 1CETA 4MVJH 1Y8RA 3V1UA 2NUAA 4CMEA 5KVVA 1TA4A 4GLLA 2XPCA 4JBHA 2FR8A 3WOHA 3ZW9A 4BVAA 3U09A 3S1LA 4CQMD 2AQ8A 3KEOA 3V5NA 1C1DB 3RWBA 4JN6B 4L75A 3WICA 4PGFA 4RF4A 4EI2A 3WGYA 2BRUA 3LT4A 3DBHA 5A3JA 3EVTA 1GZ3A 4IJUA 3H9GA 3PQFA 4Q3BA 5ENDA 4LSWA 4PLHA 3LQFA 2BGMA 3L0DA 2ET6A 3KUXA 1I3MA 4CQLB 3E82A 3F1KA 4Q9NA 1QYCA 1FK8A 1WDKA 2G5CA 4BNWA 3HQ4O 3JQBC 1U3TA 1E6EA 2FHSA 3DAPA 3FR7A 1RM4A 3WYEA 5ILOA 4DYVA 3R0IA 4RF3A 2O3TA 1YO6A 1RYEA 1PGJA 1FMCA 3GMDA 1O5IA 2Y1CA 3CUKA 4NR0A 4HUJA 3WJAA 4XQCA 3SLKA 5JAZA 2HKIA 5C37A 3C7AA 4NK4A 1XR3A 2PA3A 2J3KA 4CMKA 1ADGA 2GLXA 1LRJA 1R6DA 4BNVA 4E5PA 4OGWA 3GN1A 4KWIA 2LDXA 4TRMA 4BQRA 1U28A 2HK9A 2YDYA 3AOEC 4ZA2A 3OIDA 1LRKA 2PLAA 2PH5A 4GQAA 2JL1A 3C3XA 1N92A 4M1QA 1LNQA 3BXXA 4D79A 1W73A 3JQ9A 5I7EA 1C1XB 2O7SA 2CFCA 4XEHA 2R6JA 4AJKA 3PHJA 2NLOA 2CDCA 2O3RA 5HBRA 4IDAA 4L73A 4GGOA 3LC7O 5T5QA 3E9MA 3PQDA 4TMFA 2ZJ1A 3I23A 1JKIA 1ZUD1 4U6SA 3TJRA 4NFHA 1EUZA 4XWYA 1VM6A 1CERA 2BFAA 3FBTA 4JX8A 5FYDA 4F46A 4WNIA 1A27A 1DAPA 3OICA 4GAEA 4WKGA 4OXKA 4YACA 2I3AA 3KZVA 3ROMA 3E03A 1VKOA 2FZEA 4Q3NA 3V1TC 5I7VA 3PTZA 1EK6A 3VVCA 5CG2A 1EVIA 4R1NA 1CQIA 4BO9A 1Y6JA 1DC3A 2DT5A 4RPGA 4W7IA 4BKPA 1X0XA 3I4FA 5BR7A 5TX7A 2FWMX 3ENNA 4IJKA 1WZEA 2J6IA 1ZEMA 1RM5A 1E3LA 4Q3EA 4CLEA 1YWGO 5J23A 4IMPA 5JAMA 1BSVA 1HDYA 3SLGA 4BIIA 1R4NB 3P19A 2FR0A 3OQ6A 5ER6A 5THQA 3VZQA 1UZNA 1DRWA 1V3VA 1P77A 1IPFA 1LDGA 2WD7B 4Y67A 2ZB3A 2VZ0A 1B26A 1KC3A 3GVCA 4G5HA 5BNIA 5HS4A 1X1EA 4AJOA 1E92A 5A4DA 3A1NA 3ADOA 4JGBA 3JQDA 2OBNA 2Q99A 3GEGA 1W8DA 4FR5A 1Y8QB 2NM0A 3HHPA 4DXHA 3MWEB 3GVPA 1JVBA 4J1QA 3AUSA 3FTPA 4HNGA 1UDAA 4NBUA 4WLEA 1AHHA 5EMHA 3TQHA 3WYCA 4BNZA 1U3WA 5CG1A 3ZWCA 1R37A 1VKNA 3D1LA 4R5HA 5ADHA 5GZ3A 1JN0A 4G65A 3EAGA 3LT2A 4J0EA 2F00A 1MGOA 2JAPA 3H5RA 3PHLA 1YH3A 1N8KA 4A5OA 2EW2A 2C29D 2H9IA 3QP9A 5U4QA 1LEHA 1YBAA 1Q7GA 4N7RA 1VJTA 2X0RA 2O23A 1HSOA 3HB5X 1A7KA 2D0IA 3M2TA 3P2OA 2NTJA 2GN8A 1HKUA 4BNFA 1M66A 1E1MA 3ZV6A 2X8LA 3ZV5A 4R1SA 4WOKA 4YT4A 5JC1A 2EV9A 1MLDA 2R00C 4BUCA 2Q3EA 4FW8A 3VKVA 8ADHA 3KXDA 5B37A 4BKQA 1V6AA 4GLOA 3JTMA 4I9UA 5G4KB 3BTOA 1UXGA 2XXJA 1EZ4A 3V2UA 2JKVA 2PGDA 4PFJA 4D42A 2Q50A 2HJSA 2JAHA 4I08A 2FRDA 4MVJF 4Z9YA 3KYCA 2PGJA 2NVUB 3L6OO 2X86A 4HBGA 2FOIA 2YHIB 1U5CA 4BB6A 3GG9A 4W9NA 4JNKA 4WOJA 3NDRA 1LLQA 3WGGA 2IZ1A 2FZWA 2E6UX 4GMGA 1B16A 1NM5A 2CUKA 4EJ6A 1R4NA 4D41A 1NFRA 3GK3A 3ICCA 4BMVA 5IF3A 4E31A 3G0OA 2QW8A 5MGBA 3NTRA 1XA0A 5JMWA 1XCBA 3FWZA 4IQ0A 1WMBA 2BKAA 3T4XA 1E1LA 3AY7A 1E7MA 3D7LA 3A9WA 4CM8B 3SC4A 3DC2A 2Y0CA 4LMPA 4CV0A 2EKLA 1Q0QA 1DC4A 3CTMA 3WGIA 3OJLA 1HE5A 3LF2A 3F9IA 3E6AA 4UUOA 1EQUA 1E7YA 4A10A 1XELA 4GX5A 1A72A 3KEQA 1XHLA 1OOEA 2I6TA 3GN2A 3O4RA 1CJCA 4DVJA 1VSVA 1X7DA 1E3JA 3B20A 4H15A 5G0SA 5DOZA 3ONFA 4DREA 4RQTA 1ZMOA 5JDIA 1E6UA 1SCUA 4KWHA 2QYSA 4H16A 1M6WA 3DHNA 5FF9A 3HB4X 2D3TA 5A1TA 4BNLA 1GZ4A 4YT5A 4H7PA 4MP3A 4R9RA 1Y9EA 3DZKA 1NVTA 1SOVA 1CEQA 3W6UA 2WYVA 2HK7A 4DQUA 2P4HX 5LCXA 1SMKA 3ZU3A 1HEUA 4YRBA 1BXZA 1C1DA 4ND3A 1HDXA 3RFVA 2IE0A 3DBLB 1PEDA 4RDHA 3K6JA 3UUWA 2WJPA 3A28A 1A4UA 4ZRMA 1TB4A 4MOWA 2HRZA 4RGBA 5TNXA 3TZKA 3WWZA 3KLPX 1T4DA 2OOSA 2DAPA 3I1JA 2Y05A 4ZQEA 1OZAA 1LDYA 5JLAA 3FN4A 1O8CA 3IQDB 2NU8A 4E3ZA 2JFFA 3MWDB 3VTZA 2UYYA 4KMSA 2RBEA 4E2ZA 1I01A 3N58A 4K28A 3FF4A 2WMDA 4CODB 1D7OA 4NNJA 3PHGA 1VJ0A 4R01A 1HT0A 3X2FA 5JW6A 4XCVA 2PNFA 4EEXA 2X58A 1NAIA 2HK8A 1Q1NA 1U3VA 5C7LO 4OKIA 1PIWA 3EZLA 1N1EA 1F17A 9LDBA 1DFGA 1X7HA 4PLZA 1N7HA 4YTEA 3UW3A 2QZ9A 3GNSA 3FBGA 1NX6A 3BMNB 1RPNA 3IP3A 4J1TA 4CUZA 1NVGA 5CFZA 4Z0TA 4Q3DA 5A03A 4LVCA 4R4JA 1PS9A 3DMYA 5G2OA 1QMGA 1B3RA 3EDMA 2VYVA 4ZRNA 8LDHA 1K6XA 1OC4A 4YJFB 4IPTA 3TFQA 4HADA 3W4IA 5CDGA 1Z75A 2X5KO 3F6YA 3PDJA 4FS3A 4J90A 5BT9A 2VRCD 1EE9A 3H2ZA 3W8FA 2O3UA 2AG5A 1SB8A 2A9FA 5G4KA 3HUDA 3PWKA 2GUGA 2CSUA 4FC6A 1B8PA 3DBRA 4YJHB 1EQ2A 2Y0DA 4YRDA 3ETGA 3ZNPA 4BO1A 3DFZA 1R4MB 1ZMTA 3WBFA 4IGEA 1PZEA 3JQFA 1IHYA 4BV9A 2ZKLA 3S2GA 3I3OA 2ZB8A 1CIVA 2EIHA 2NSDA 3WQQA 3GPIA 3ABIA 1A7AA 3GGPA 4OJNA 4P22A 1JWAB 3SJUA 4P38A 1YOVA 1HLDA 3ZV3A 4CMIB 1NP3A 5BSEA 1UJMA 2CNBA 1VLLA 2BLLA 4J6FA 1FJHA 1KVTA 3MJVA 2VTDA 3ROKA 5A9RA 1DIBA 4RLSA 2EGHA 2PZJA 1BW9B 5JCJA 3GVHA 5TT1A 4P8RA 4GMFA 2VCYA 5BNFA 5IDXA 4KUHA 1WXDA 5THKA 4J1SA 1HE4A 3QWAA 3KRTA 3CH6A 5ITVA 2X0IA 5C5IA 1JA9A 2A94A 4WLFA 2SCUA 1B7GO 1A4IA 3MJCA 3HN2A 2RAFA 1GTMA 3RUAA 2JFHA 4UEKA 4DTIA 4X54A 2Q2VA 4EUEA 1GFSA 4NBTA 4FBGA 1YL6A 4WCFB 4GKBA 4XIYA 4CLHA 2VHYA 4L4XA 4YAKA 5K9ZA 3FR8A 4CUKA 2C59A 2Q2WA 1I0ZA 4CL8A 2W2KA 1P3DA 1Q2XA 1YRLA 4WLOA 5F1PA 1QXSA 3ORFA 1R12A 1OBFO 2VZ9A 5T8KC 5B4UA 3B1JA 3OMLA 1TEHA 4BNUA 5CEJA 4AJHA 1UAYA 2ZTUA 4HFRA 4RQUA 4Y98A 4D7AA 4NQZA 5TC4A 3RROA 2VRCA 1K0UA 1TT7A 3QVOA 3L07A 3KO8A 5IZCC 1DHRA 2D1YA 5LDHA 1TXGA 4FGWA 5L95A 1BWSA 2RH4A 1XDWA 1H6BA 2C07A 3UF0A 3U5TA 1TI7A 3PPIA 2PD6A 4FFRA 1FF9A 3Q2KA 1HDGO 1WMAA 2GNAA 3EC7A 3E18A 4RVFA 2X0NA 3FNEA 1LX6A 5IG2A 2EJWA 2PY6A 5L7WA 4CV3A 1E5QA 4PLFA 4BNKA 3PJEA 2VWPA 1YOVB 1DSSG 4IJVA 2QHXA 2V65A 4R69A 2HMUA 1GUZA 1D3AA 1M2WA 1UP6A 3RUDA 2VHZA 4EJMA 3WGTA 4DUPA 3OP4A 4MIYA 4UVEA 3JQ8A 3K96A 3JYNA 4R51A 1WAMA 3EY4A 4XQGA 1IZ9A 1GDHA 3MTGA 2HMWA 4WCFC 3IC5A 1Y7TA 2HQ1A 1LSJA 1PJTA 1E3EA 1U7HA 2WD7A 4CM7A 2QX7A 3O26A 4CQMB 5L45A 2IZZA 3U3XA 1X1TA 3KSUA 3PGJA 4BKUA 1Y8RB 3R3JA 3DZIA 3A4VA 4L4SA 4TVOA 3ZWAA 2PR2A 1LDNA 3E5RA 4BO8A 1DEHA 3H5AA 3PYMA 5DBIA 3GEMA 5JO0A 2ZYAA 3ASUA 2OGUA 4IIUA 3OQ1A 4OMUA 4MIOA 4PVDA 3U4IA 4IDBA 1KETA 1FXSA 1QR6A 4YQZA 4PVCA 1MP0A 2DTEA 4M54A 5JNLA 4MVJA 4EBFA 2WYUA 3JD3A 3JYPA 3KYCB 3FRJA 1KERA 2AEMA 3HWRA 1R0KA 2GF2A 3LT1A 2EHDA 4IDEA 4BO2A 3R3SA 5EESA 2X4GA 5IN4A 4FGSA 2CDAA 2AEFA 2Y68A 1ULUA 5BNTA 1PL8A 5KVQA 1I10A 3KETA 1R16A 5KJCA 2JHFA 1LUAA 4GPD1 1ZSYA 4HKTA 2PZKA 1P1HA 1I3NA 1ZO8A 3BHJA 3BMOA 3GFBA 2Y1OA 1SEVA 2DUUA 4R3WA 1DPGA 5A3VA 2FR1A 2HCTA 4NDNE 4GKVA 3QQPA 1UXIA 4PZCA 4XQ9A 4QFDA 3LYLA 1PJ2A 4XJTA 5KIAA 1GL3A 3CPSA 1PZGA 1PJSA 4DMLA 4ESOA 4ITUA 1GCUA 4BQPA 4EEZA 3IP1A 4IDFA 4OQZA 4P4GA 5DCYA 4AJ4A 1K6IA 4FFOA 3O38A 4XGKA 3VC7A 1FDVA 2C2XA 2ILTA 1AUPA 1WP4A 2B35A 5CDUA 4A73A 1DB3A 3TOXA 1SC6A 3RAJA 4KDEA 1C1XA 3TL2A 2JCVA 1JU9A 2X0JA 2LDBA 5CPBA 4FFPA 1HE3A 3AI1A 4KZPA 2VRBA 3JCZA 1IPEA 1NPTO 1R0LA 4OO3A 3I83A 1LSOA 2DUWA 2HO5A 3BMQA 2VN8A 4GX2A 4F6CA 4YAIA 1T2AA 2BF7A 2EJVA 2B4RO 4DA9A 3FSRA 4YDRA 1GQ2A 1KBZA 3EW7A 4GSKA 3BMCB 4GBJA 4ALMA 2GGSA 4DQVA 1IUKA 1LTHR 1H0KA 4GVLA 4K6FA 4W6ZA 3RI3A 2B83A 2GSDA 4B7CA 3AM3A 4L74A 4MP8A 4O1MA 1K89A 3NRCA 2IZ0A 1PGNA 3GC6A 3QVWA 5A02A 3JQAD 5LDGA 1O94A 1ONNA 3NTOA 1MG5A 1QYVA 2UV8A 4E33A 3ZHXA 4EGFA 4BNTA 4WK6A 4CLOB 1M6HA 1GV1A 4ZICA 3G17A 2HRBA 3FD8A 3KLMX 5L7YA 4NH4A 2IYOA 3VAZA 1I32A 1U9JA 1YL7A 3GEDA 3DR3A 1MC4A 4J43A 4JBIA 1R66A 5DT9A 3HDHA 2W98A 1HF3A 1MV8A 3GPDG 3K2BA 4AJEA 5JBIA 1HDZA 5FEUA 2FSSA 1GD1O 2VWHA 4KQXA 4M49A 4U0KA 3VDRA 1NWHA 3WLEA 3PVZA 2Q2QA 3T4EA 5U9CA 5I9NA 1Y8QA 2RCYA 3BMNA 1VRWA 1MXHA 3RUFA 1EDZA 3UCXA 3NX4A 2TMDA 1M67A 1U4OA 5HTOA 3EHEA 3DMTC 3W4KA 4EJ0A 1QV7A 4A03A 4EYEA 2YV3A 2HMVA 5CDTA 1HDRA 5JDCA 1GYRA 3GY0A 4QO7A 4I9HA 1JLLA 1DIAA 4XJSA 2DBQA 1NHGA 3Q9UA 1GYQA 4ND1A 4II2A 4PG6A 1VL6A 5ER9A 3VZSA 2IYPA 1SPXA 1ZKMA 3GVIA 4M86A 5TIIA 3VVBA 2AQKA 4FFNA 4R5MA 4TRNA 1NR7A 3IL2A 4E5NA 4XB2A 1QKIA 1LA2A 3RUIA 4AJ1A 4K26A 4NBVA 3H65A 4O6VA 1RM0A 3EGOA 3UCEA 1TLTA 3BYZA 3NKLA 5AYVA 4TZTA 3JD2A 4JJFA 3OIFA 4YJDA 2G17A 2FN7A 3DDNA 3RC2A 3KOUA 2YYYA 4PN3A 1MB4A 2OFPA 2CF5A 4I9NA 3GDOA 3JQ7B 5IXSA 3PQEA 3AY6A 1L7DA 5JDCC 3AM4A 5A9TA 2EXXA 3VPSA 4YYZA 3P5SA 3K30A 1NWCA 2NVUA 4N54A 5A06A 5T8KA 1PGOA 1PJ3A 1ONOA 2HAEA 4FQ8A 5ICMA 1QYWA 3D4NA 4TRJA 2BFMA 1T1SA 4F45A 3QWIA 4CM4A 4G81A 2CMDA 1HE2A 4JCOA 4GGPA 4RF2A 4ZQGA 4D0SA 3WWYA 2BHLA 2EP7A 1X0VA 3HDJA 1YXMA 3H7AA 4PLWA 3DEYX 1P1KA 1I5RA 4NFSA 2PD4A 1PSDA 2E49A 4Y6PA 3PWZA 7ADHA 3QV1A 3DOCA 4PZDA 1R15A 3IAHA 1SEPA 4ZVVA 2VT3A 3FTNA 4CUJA 4MKXA 4BNMA 5CAEA 3JQGA 4JJIA 4RZHA 2HU2A 3JD4A 1ISMA 2P5UA 5H82A 3ZV4A 1CYDA 2YDXA 3OJFA 1NPDA 1T2DA 2Z5LA 5A05A 4R1TA 2BFOA 2JD0A 3G1TA 1JAXA 3GLQA 1YB5A 5AOVA 1LC0A 4NHEA 5JYDA 4R68A 3RVDA 5MDHA 1SZJG 3AOGA 3UCFA 5JYEA 4J7UA 2V6FA 3U4DA 4CPDA 2E82A 1UZLA 2OUIA 3O8QB 3ZNQA 1E77A 5CDSA 5I9LA 4HX5A 1GEEA 3QW2A 1H94A 1C0LA 1LSSA 1XEAA 1EVZA 1DJNA 3GRPA 1RYDA 1AXEA 4CM8A 1BW9A 3Q3CA 5B1YA 1YB1A 3G79A 3P2YA 3KHUA 2DFDA 4J4TA 1H2HA 4OIMA 2PKQP 3CEAA 4RV9A 2WM3A 3Q2IA 1BGVA 1SNYA 4YAGA 1LQUA 4NJOA 3V2GA 4EUFA 3OH8A 1U5AA 2VYNA 2Q1UA 3K9QO 2BELA 4IGFA 2FY8A 1H9AA 3ZWNA 1HZJA 1E7QA 2ZATA 1UDBA 5DF1A 4D3DA 2GPTA 5BSGA 4FSHA 2NQTA 5KJEA 2P4QA 3H9JA 1GADO 3PHIA 3GQVA 1YKFA 2NU9A 3GUCA 4BGIA 3IOYA 2VYVD 2X22A 2QRJA 5K6AC 3RBXA 4QXMA 4WLVA 4FIZA 4ALLA 3NTQA 4KDFA 4U5QA 5JE8A 2X7HA 4R9SA 3INGA 2IEBA 2Q49A 1YQGA 1C0IA 3GNQA 4QO8A 4CLRB 3PJFA 4YA6A 3AOEA 2Y67A 2UUPA 3AFMA 1IYZA 3C24A 3ZWVA 4BKOA 3A06A 1ZJYA 1BHSA 1Q0LA 1DFHA 3TN7A 5EJ2A 5G0TA 3AM5A 4O63O 2A92A 3BZUA 2D8AA 1NNUA 2GZ2A 4RZIA 4E21A 5TQVA 5A9SB 5BQFA 1O0SA 1P1RA 2PZMA 4KOAA 1CRWG 2NU7A 1KIFA 1ZFNA 2EW8A 4ZU3A 2ZK7A 1FDUA 4DC1A 1ARZA 1P9LA 3A14A 3B1KA 3ITKA 4DMMA 1LBEA 1VC2A 1WW8A 3PHHA 4DL9A 3HDYA 2XAAA 3VKUA 4E2XA 2YQ5A 1YBMA 4A0SA 5FI5A 5B4TA 2W2LA 3PDUA 1O9BA 4DLAA 1YONA 3F5QA 2W2KB 3FHLA 4WASA 5A5FA 2P5YA 4NBRA 2EKPA 1R4MA 2PH3A 4YWJA 2NTVA 3BTUA 3NT4A 3CE6A 5DNAA 2CD9A 4MVJM 5CEFA 3OETA 4E5YA 1DXYA 4OSPA 2A4KA 4M89A 1JKFA 1LI4A 3QWHA 3GMSA 4GWGA 3PZBA 1UP7A 4KUEA 4URFA 3RC9A 3S2FA 3I4CA 3QLJA 4D3SA 4NIMA 4XDZA 3T7CA 3DB2A 2DBRA 3IKVA 3ZWWA 5BSFA 1I24A 1DIRA 3S2IA 1NQTA 4NMHA 4DWVA 1ID1A 4ZQHA 4ALJA 1I30A 1QYDA 1Q7BA 2YV1A 1EBFA 5L53A 1D8AA 3TF5A 2BFPA 2NVWA 3MTJA 3OBBA 3ZH2A 2ZYDA 1N9GB 3P7MA 4R3NA 3SC6A 3NDIA 2JFGA 1HDOA 3I6QA 3GR6A 4E0BA 2OL4A 1ISFA 2VHXA 3ZNOA 3ETEA 4WNCA 1P45A 1IB6A 1NVMB 4O59O 4O5OA 4ALKA 2V7PA 3SBOA 5T57A 3TSCA 4KUGA 1N9GA 3F1LA 3QA9A 4OHUA 3TDKA 2I5PO 1MG0A 3UOGA 1T24A 2C54A 2EWMA 3L4BC 3GF4A 2IXBA 1WVGA 2G82A 2EP5A 3OSUA 3Q11A 4ALNA 1VJ1A 4CM5A 3COSA 1A9ZA 1P33A 4IDCA 4MVJD 4I1IA 1SBYA 1FDTA 4GX1A 1B3BA 5JO9A 1B0AA 1Z6ZA 1N2SA 1NTOA 4YAEA 2CY0A 3RKRA 2ZCUA 4NFYA 2O4CA 3GFGA 1HWYA 3AI2A 3OA2A 4WECA 4FN4A 3TWOA 4CM4B 5JY6A 1Z73A 1E7RA 3M2PA 5G0WA 5CHEA 1LRLA 1L7EA 3UKOA 5EERA 3SJ7A 3I9KA 3QVTA 1W4ZA 2AW5A 2J3HA 2VQ3A 2WE7A 2B4TO 1TT5B 1ENZA 2OP1A 4BGUA 4A27A 1O89A 3S2EA 4BGEA 3DZHA 3ONEA 2O3SA 2D59A 3KYDB 1MFZA 4ILKA 2Q1TA 1BXKA 5JC8A 2V6GA 4L0QA 1YS4A 4NG5A 4DIBA 5LC1A 5KVCA 1NHWA 4N5NA 3PXXA 3W4JA 1AXGA 1U7TA 4AJJA 2QG4A 4BB5A 3MOIA 4J16A 3EK2A 3SX2A 4U6QA 3PI7A 3E48A 1I36A 3RUHA 1C0PA 4AVYA 5ES3A 4E12A 3QHAA 1CF2O 1L1FA 4DPKA 1TVEA 2NU6A 4QECA 2QRKA 4WE3A 4BV8A 1ZIDA 3DBHB 1NR1A 3VH4A 3JQAB 4H3VA 3TZ6A 1GU7A 2I67A 2ZYGA 4UEJA 2TMGA 3H9QA 2AE2A 5COBA 3PYXA 3TZHA 1E3WB 2DFVA 3LT0A 2ZQYA 2OHXA 4LRSB 3VTFA 5C7IO 3M6IA 1XU9A 4YAJA 3ROPA 2DPHA 2IDZA 3MJSA 3FWNA 5T6BA 4K6CA 4RJTA 4Z9FA 4LSMA 3H3FA 2YW9A 3Q9NA 5AXBA 3BMQB 5KTKA 2GYYA 1HETA 1T2FA 1E7SA 2YQ4A 1E1KA 4LRTB 1JW9B 1Z82A 3R6DA 5DP2A 4CQMA 1ZH8A 2AEJA 1PQWA 1UXHA 3IUPA 4GX0A 3RUEA 4XZ3A 1EEHA 3QE3A 3WGOA 4I5EA 2J5KA 2ZTMA 3LU1A 4I5DA 4OOEA 1JAYA 3PK0A 3PIDA 1GV0A 1BDMA 4HFNA 2NQ8A 2Q4BA 4U8GA 2GZ1A 4LCEA 4FOOA 2B37A 4L4RA 3TL3A 3ZZNA 3ZNNA 4II3A 4Y8VA 2X23A 4OKNA 1QYXA 5COQA 5DP1A 5TJ9A 3HG7A 2GO1A 3L9WA 3LC2O 4W4TA 2B4QA 3DTYA 4XYBA 1ZK2A 2VWQA 3L6EA 3UHAA 3PP8A 4IZHA 1UR5A 2WD8A 3RBVA 2A35A 4CR6A 1T25A 2R00A 1HYEA 3H9EO 4LK3A 1KVRA 1PU2A 2DBZA 3JSAA 4ZD6A 2G1UA 1P1FA 5K0ZA 4MIEA 1R0SA 2J3JA 3UICA 1HZZA 4BMNA 9LDTA 3WB9A 3Q6IA 3ZI0A 4WJZA 2PV7A 1LLCA 5IDYA 3MCVA 2WWRA 3EVNA 1DO8A 4IINA 4O0LA 4XQEA 3ZHYA 4B4UA 4S1VA 4XX0A 3BIOA 4CMCA 1MXFA 2VNAA 4L76A 1BVUA 4EW6A 1JVSA 3NUGA 5C3MA 3I9JA 3DFUA 4J3FA 4BO3A 2RIRA 1PX0A 2ZQZA 3GT0A 2DTXA 1PJCA 4EDFA 1ORRA 1ZVMA 4WCDA 1NPYA 3PJGA 4XR9A 4Y9DA 4CM1A 1LSUA 4YR9A 1ENPA 3WGHA 1ADBA 4GL4A 3NT5A 4TROA 6LDHA 3SXPA 3ITDA 3MEQA 3GA0A 1LJ8A 4B4OA 2EERA 3GUYA 4PRLA 1ZK1A 5DZSA 5L4LA 3MZ0A 4CV1A 1I2ZA 1WNTA 2H1SA 4K9DA 4E6PA 1HTBA 2QZZA 5EN4A 4WLUA 1JWBB 1BVRA 2O50A 4FCCA 4RDIA 3FCOA 5TGDA 1X13A 3BHIA 3RCBA 3WTBA 3MOGA 4RVUA 3OIGA 1J4AA 1KVUA 3PEFA 1KYQA 2IRWA 3L4SO 3OHSX 3B1FA 3U62A 5IXYA 3JQ7A 2DTDA 3TZCA 5BSHA 5KKAA 4J4BA 4TSKA 4WEOA 3EMKA 1GQYA 3TPCA 1GR0A 1PQUA 2WE8A 4YRAA 4ZN6A 1E3IA 1D1TA 2JD1A 3JD1A 3UVEA 5L40A 2DLDA 5HA5A 1RKXA 1V9LA 4W9NC 1IY8A 3O8QA 4LVUA 3AU8A 4S3MA 4BNHA 4B8ZA 2YV2A 4B8WA 2AE1A 3ANLA 4Q3CA 4UUNA 4XA8A 1PL6A 3VOSA 4UAGA 4PZEA 3FNHA 2R2GA 3Q1LA 1F8FA 2FMUA 4A7PA 1YL5A 4BNGA 1G0NA 4FD3A 3RBZA 1JQBA 3RJ9A 4GSLA 5GZ6A 1XLTA 4B3JA 5TRTA 4R41A 4YXFA 2BGLA 4OXYA 4JQCA 4MJLA 1BDBA 3W6ZA 2CVOA 2GZ3A 5H83A 5JXWA 1GEGA 1X7GA 2C5AA 4OL9A 2ZTLA 1KEUA 1U4SA 2OP0A 2BI8A 4FPXA 3PYLA 2GR9A 4Z9XA 5JPIA 3VZPA 4YCAA 2X5JO 4CL3A 4D3FA 4FFMA 1ISGA 3JQ9C 4OYRA 3K92A 3W8DA 4E32A 3JYLA 3GGOA 3DBVO 1GYPA 3LF1A 2O4UX 1K2WA 4AFNA 3FI9A 5GY7A 4EITA 1CWUA 2O48X 3NYWA 3ZCXA 4E2YA 2IXAA 1GPJA 1DLIA 3WMWA 3RUCA 1PWZA 2H6EA 2PWZA 1PR3A 3I9OA 4M55A 2GDZA 4QX6A 3VH2A 4DIOA 1W0CA 1ISIA 4WEQA 3JYQA 4IZIA 2G0TA 2G76A 2WSBA 3U4HA 3UGKA 4CMBA 3U9LA 3K73O 3L9XA 4TQGA 1B8VA 2NADA 1GAEO 1I2BA 3G3EA 2DC1A 3WIDA 3ULKA 1UDCA 3PLRA 2VOJA 1BRMA 4B4WA 1CQJA 3C7CB 1F12A 3N74A 1WWKA 1NBOA 4BNNA 3HE3A 1EUCA 2O3JA 2X9GA 4ZGWA 4EZBA 4DIFA 3ZWMA 1ZK4A 4IQ8A 3PFWO 4MVJI 1OFGA 2NACA 3UH1A 1U1IA 3ZWBA 2NNLD 4TRRA 1NQAO 3C7DB 5DCUA 5JSFA 4ND4A 4NZ9A 3B6ZA 3DOJA 2OZPA 4PG4A 1T1RA 5KJ6A 3QY9A 5F1KA 1YB4A 3K5PA 5GZ1A 1CDOA 1E6WA 5CP8A 1QRRA 1PTJA 4Z3DA 4Z0PA 3KYDA 2J5QA 5L3ZA 4QUKA 1B8UA 2QRLA 3VH3A 4WCFA 3KSDO 5I9MA 2PKQO 2NTNA 3QWBA 3IMFA 3VDQA 4B3IA 3G49A 1U2GA 4CMAA 3KV3O 1AHIA 4DYDA 1OMOA 3D4PA 1Y9AA 5AXDA 3JD0A 1ZSVA 2VOEA 1U2DA 3DZBA 1LLDA 2QIOA 4IBOA 4K1LA 4AJPA 4FJ0A 2DKNA 1AE1A 4MO2A 1PJBA 5K1SA 3BAZA 4IDDA 3ZW8A 3WQRA 1ZXBA 2QYTA 2YY7A 1G6KA 4DGSA 1UXKA 3RSHA 5EQDA 5AQ1A 2HMTA 1EFLA 4UUMA 1U3UA 1ZZEA 4MVJP 3PRJA 3K2EA 2C82A 3AI3A 2C7GA 3ICPA 1RM3A 1D4FA 1G1AA 3HN7A 3F4LA 3C1TA 3AK4A 3DAGA 1IULA 4PLVA 1O95A 3QJ5A 2UAGA 2HJRA 1ONPA 1UH5A 3I5MA 3QVXA 3IDSA 2X9VA 4PG7A 5KKCA 3LK7A 1SOWA 1Y1PA 2X1HA 2E4AA 1P44A 1QV6A 2Z1MA 4TKLA 1LU9A 2Y66A 1ENYA 3K31A 3NEPX 1Z7EA 4YQYA 4MKZA 4B79A 2EGGA 4YBZA 1EK5A 2AA3A 3G1UA 2FPIA 1HLPA 2AXQA 4XYLA 5DBFA 1I33A 1Z7BA 3WNQA 5AXAA 1H6AA 2ZCVA 1YJ8A 1FDWA 5IJZA 1KY5A 1PZFA 3DQPA 1XU7A 4B7XA 3AW9A 5F5LA 1NFFA 3CIFA 5JMPA 2JCXA 4TKMA 2C0CA 1E3WA 5TT0A 3K8ZA 5AVOA 1H9BA 1QORA 3RU7A 1OC2A 4AJIA 4BS9A 5B4VA 4PCVA 1G0OA 4P4NA 4WLNA 3ZHZA 1DIGA 3JV7A 3ONDA 2Y1DA 4I8XA 1YBVA 4D46A 4TWRA 4RL6A 2B5VA 2ZIZA 4NU6A 2WDZA 1YGYA 2JHGA 4BO4A 4AG3A 1PS8A 4IQGA 2YJZA 4YJHA 4QT0A 3TOZA 1ZJZA 4FOSA 4J2OA 3ZN2A 4UVDA 1W6UA 1IE3A 1S6YA 4J49A 3HADA 2X9NA 3KM0A 3PGXA 3VPHA 4CM6A 4JK3A 3KTDA 4BL5A 4INAA 1LQTA 3C1OA 4B3HA 1EVYA 4J4HA 3WYBA 3ST7A 3LSYA 1QLHA 1NFQA 4RO0A 1DC5A 5I8ZA 5KOIA 2DM6A 2Y1EA 2D5AA 3ZU2A 2E37A 1V3TA 4YEDA 4FDAA 4J7XA 3OQBA 3D3EA 3GAZA 4E13A 4ZQFA 4YT2A 2VUSA 4ZJUA 3ZU5A 3JQCA 3VHRA 4PLCA 3TZQA 3QWFA 3ZHBA 1VL0A 4OQYA 3NGXA 5EQFA 1YVEI 4IS2A 4OXNA 4IXWA 4YJGB 3VPXA 5ITWA 2GD1O 2O2YA 3X2EA 1Y5RA 4XRRA 2CVZA 4ZQBA 1AN9A 5GMOA 3KBOA 1GPDG 3D3WB 1WLYA 2H5LA 1J49A 2I3GA 3H9UA 2V6MA 5JAQA 1ADCA 3D64A 3FPLA 1WDLA 2EKQA 3OEYA 3E1KA 1ZXLA 4ROSA 4OSOA 1VPDA 4NU5A 5EL0A 2AQHA 2CF6A 3GAFA 1F06A 1XG5A 1BXGB 1Q0HA 1QG6A 3TNLA 4FJ1A 4ND2A 3WFIA 1P0FA 3GHYA 4UUPA 4CM9A 1OI7A 4CJXA 2C5EA 3F3SA 4EUHA 5KNLA 1ENOA 4TZKA 4XGNA 1NAHA 3KYBA 3INRA 2O2SA 4HY3A 4JXKA 4BOYA 2WYWA 2HLPA 3DWFA 2YUTA 3S55A 4RPLA 1FDSA 4W99A 4OM8A 4UVGA 3E9NA 5CDYA 3MJTA 2Z95A 2VT2A 5TJHA 2OMEA 4UVHA 3HSKA 2B36A 1HSZA 3OM9A 4QFCA 1HXHA 4CR7A 4U0JA 4ZHSA 4L8VA 2GCGA 1V3UA 4Q39A 3T7EA 3WS7A 4RCVA 1AGNA 5EINA 1ML3A 3GHHA 3GRKA 2B69A 4CMIA 2Q45A 3E5MA 4MKRA 2XOXA 4HWKA 3DONA 2P91A 1H6CA 1VE9A 1BMDA 1M75A 3PFFA 1P74A 3WXBA 4E2WA 4RVDA 4E4YA 3GZNB 1WZIA 2NVBA 3BTSA 2FPGA 1X14A 4JP2A 3CINA 3OEWA 5F3RA 2VHVA 4JROA 3RU9A 2BD0A 3N7UA 5DCWA 1EE2A 2I99A 3D5TA 4L9RA 3ZGYA 1I8TA 4Y6RA 3ZWYA 1PJLA 4HNHA 4CLDA 4FC7A 3DZJA 4W7HA 3HNPA 5KJ1A 1Z45A 3L6DA 3AFNA 5JDIC 4OH1A 3WLFA 1WPQA 3OF2A 4YJFA 4BGVA 1JTVA 3D3WA 3OJEA 5T64A 5C7OO 4I5FA 1EFKA 4IDGA 3BA1A 4D43A 1J0XO 4PG8A 5DN9A 1SO8A 4BNYA 3RASA 3Q0EA 3IJPA 2D4AA 3DOOA 3NAQA 3U49A 1IL0A 5IDQA 1PJ4A 4YVFA 1GQQA 1DRVA 4QEDA 4XRGA 4PLYA 3FPCA 1QSGA 3OJ0A 4GI2A 4DBVO 3IKTA 5ENVA 3WSWA 1IOLA 2AHRA 1B2LA 3ZWXA 4RPJA 1WDMA 2GN6A 1P0CA 2JD2A 3ENKA 1ZK0A 4I5GA 3WQSB 4HP8A 2WEKA 4U7WA 1BTOA 4Q3AA 3WFJA 3CXRA 5IFLA 5AXCA 4MP6A 3BMOB 3ZWPA 1B14A 3WIEA 3WTCA 5L7TA 4DLBA 4GH5A 3OFSA 4NBWA 2VUTA 1XGKA 3WG9A 4IM7A 5JAIA 3ROQA 1KVSA 2UDPA 2P2SA 2Q1WA 3LC1O 4D44A 1C14A 2VUUA 5U1PA 3GZ4A 4J1NA 3RQSA 3O9ZA 1IZ0A 1LDBA 3SVTA 3NT2A 5FWNA 2RHRA 3GDGA 4PLPA 1DDOA 3VPGA 1ZW1A 1KVQA 1LLUA 2ZB7A 3DMTA 3H8VA 5G4LA 4XB1A 4BKRA 4FB5A 5HS6A 3H6KA 2O3QA 1XKQA 4E30A 4RVGA 4D0RA 4CM9D 1DJQA 3V2HA 3IUSA 4PIVA 4JJGA 1S7CA 3ADPA 2CVQA 3CMMA 4JIGA 3R1IA 3NJ8A 1Y81A 1NQOA 4RF5A 4HV4A 1MUUA 1PWXA 1EBUA 3E8XA 1LDEA 3GZNA 3JQAA 1NQ5A 4G2NA 4NPCA 5L4SA 4CV2A 3GVXA 1EVJA 4IY1A 3H3JA 1H93A 5G0VA 5TSDA 1T2EA 4DRYA 4ALIA 5IAAA 3EUWA 2NV6A 2ZJ0A 3JQBA 4AJLA 3BMCA 3LZ6A 3NJ4A 3B70A 3L77A 3RJ5A 4F6LA 2D2IA 1N7GA 5HRUA 3KVOA 5DOVA 3TRIA 4GWKA 2DVMA 2AMFA 2GN4A 1E1NA 4LW8A 5ICSA 4UREA 2ZB4A 2VWGA 3WGQA 1F14A 4MPDA 3RD5A 1U8XX 4J2HA 1ZEJA 3F5SA 2Q46A 2W4QA 3ETDA 2O7QA 1F8GA 3DHEA 4XKJA 4IJWA 4R1UA 2P9GA 5TF4A 3C8MA 1VL8A 5KWEA 3JYOA 1EMDA 3PLNA 3QSGA 4XYMA 4AL4A 5TS3A 2BH9A 4GVXA 4J0FA 3BTVA 1MX3A 4CR8A 3EZYA 3MJ4A 4ID9A 3GH3A 2W2LD 2P9EA 1PZHA 1KEWA 4RPKA 4F3YA 4Z6KA 2FP4A 4A26A 3U4CA 5IDWA 5KVSA 4ONEA 4E5KA 1HL3A 3QIVA 2XF8A 2OO5A 5ILGA 4KP7A 2QQ5A 3PWSA 5EPOA 1H6DA 4PG5A 2F1KA 1OAAA 3PJDA 3I6IA 2PGLA 2RHCA 4HFMA 4LMRA 2BMAA 2AQIA 1YJQA 1DRUA 3LLSA 2X6TA 2BGKA 1P1JA 1Z74A 1HYHA 1E0DA 4M8SA 3L4BA 4HXYA 4IS3A 2DBVO 1ZBQA 3I9NA 3OA0A 3V1YA 2ZTVA 3PIIA 4BO0A 4XIJA 5HM8A 4PLGA 2UUOA 3INTA 4BHTA 2IEDA 4C7KA 1NYTA 2I76A 4WUVA 1H2BA 1RJWA 3OECA 1LC3A 3NGLA 4P4LA 1XQ1A 1XWFA 2D5CA 4XYGA 4KQWA 4YB8A 2WTBA 1YQDA 2V6BA 4IMRA 2P9CA 3IIEA 5T67A 4N5LA 4JBGA 4CM3A 2UVDA 2C20A 2CZCA 2P68A 4CMGA 1JKJA 4JLWA 4OOFA 3DBRB 4KTTE 3WNVA 4IXTA 1I2CA 1BXGA 1XQ6A 4R16A 4CMJA 1T2CA 4RLHA 2CDBA 5FI3A 3QRWA 1DBVO 2C2YA 1ISHA 4BNIA 3WX0A 3RFTA 5B12A 3WJ7A 2PK3A 1RWBA 2GERA 1KEVA 3VH1A 3DHYA 4CLXA 1I3KA 5DDIP 1NXQA 4NI5A 3DXFA 3DZFA 1Y5MA 4N18A 1DIHA 2Y1FA 3WSVA 1XIVA 1N5DA 3F47A 1O6ZA 2BI7A 1JDJA 2J8ZA 3UAGA 1U8FO 2YHUA 1SB9A 2HUNA 1PL7A 2Q1SA 1A5ZA 4BO7A 4RPHA 1M76A 2PFGA 3EYWA 3SEFA 1N1GA 1K5HA 1ZNQO 4RVSA 1Q7CA 1YE3A 5I7FA 4CLOA 3ON5A 3WDSA 2I66A 3WGZA 1C0KA 1F0YA 2Y99A 5I8WA 1QLJA 1J5PA 2B0JA 2EEZA 3D5QA 3O03A 4XDYA 4C4OA 1PGPA 4BNXA 4WPGA 5IZ4A 3HFSA 5G0UA 3F4BA 3W8EA 2PD3A 2YZ7A 1P31A 4CMEC 1LDMA 4Z3KA 3QVSA 1ZK3A 1DAOA 1ISJA 1UUFA 4CLRA 2Y93A 1UP4A 1XSEA 4D45A 2B5WA 3DZGA 3KSZO 1PQPA 2HSDA 3GGGA 1ADFA 5JY1A 3DAFA 1KS9A 1YDEA 4DC0A 1A71A 3C1AA 3CZRA 4DBZA 1X15A 5COAA 1GUFA 1YQXA 2VZ8A 4B7UA 3AJRA 3GG2A 1SAYA 3PZRA 3ZWOA 3AY3A 4XR4A 1H5QA 1K3TA 1ULSA 1V35A 4RVHA 3WMXA 2VTEA 3DBLA 5KCZA 6ADHA 3CKYA 4OAQA 1DOHA 3I9MA 1UXJA 3U0BA 3AU9A 2DQ4A 1P1IA 3DL2A 2AG8A 3RC1A 4MDHA 4FFLA 5F5NA 2VNSA 5IN5A 3JQEA 4ND5A 3RKUA 3C85A 5JS6A 3CZMA 5L51A 4NK5A 2Z1NA 3F46A 2W8ZA 1IHXA 1ZSNA 1GZ6A 2FSVA 3UXYA 3DTTA 4UVIA 4DQXA 3FNGA 2YFHA 4AJNA 2I65A 3JQ6A 3E9QA 4NJMA 2DPGA 1DHTA 4R54A 4CMHA
chains in the Genus database with same CATH superfamily
3TUZC 1UMBB 4ZVPA 2C7VA 2EKZA 2Q5LA 4C7JA 4FU0A 4Q12A 1KK1A 2BT4A 4AXXA 1Z2CA 1Z4JA 1EXDA 2XB8A 3ZVNA 2CL6X 9MHTA 2EF1A 2V4UA 1OV6A 1ZCJA 5AI6A 2QGFA 2XOEA 3AWDA 4K6OA 3GNTA 3VYUB 4DVGA 3C8DA 1OXUA 4WZ6A 4J9UE 4TQAA 4Y2QA 4DLTA 2WIFA 4IIFA 4ZJZA 2X9QA 1ACMA 2DU8A 4M87A 5CB4A 2XYGA 1XVUA 4C4AA 1BX3A 3V8BA 3Q8WA 3W2IA 1LXCA 4DLLA 3EN0A 2C5GA 1XYGA 2CK3A 3K35A 3S7ZA 2JCYA 1T8WA 2YWRA 3OLWA 2E48A 2QRNA 4JA2A 2P40A 2P35A 3EZ9A 3IS3A 5D5QA 4EHHA 3KELA 4GOKA 3NQ41 4FYPA 4WGGA 3WOVA 1QLWA 1SBCA 4MUEA 1GY8A 5FL7A 4AJ2A 2YHIA 5BWNA 2FTKE 1RYNA 3KTAB 4XCXA 4AROA 4EYQA 4LISA 4KQIA 3UT6A 3THRA 3B9BA 3EF0A 4QSMA 3UK0A 1UIRA 1JSZA 1CR1A 3EXFA 3LO8A 4ARIA 4G4GA 3WR5A 3K9LA 4C04A 1XLVA 2FMFA 5EFZA 5T6MA 2A5GA 4CHTA 4RTNA 3OQNA 4QPPA 1TECE 1E2UA 3C3DA 4JMPA 2ID4A 1A8PA 5EJIA 5A3RA 2Y6VA 4UBMA 4KQKA 4ND7A 1IOWA 1D1SA 4NU0A 5MN5A 4DY6A 5E4YA 4N5MA 5A5EA 4F8YA 5HYVA 5KMGB 3M1AA 4G5FA 4LKOA 5AMXA 4V38A 5JS2A 2GAAA 2KMLA 4HFJA 4JNCA 1YRWA 3FTQA 5T3YA 4AN0A 1Z6XA 3CZ5A 1YDWA 1RI3A 1YE8A 2D1QA 3AUUA 1HLGA 3DDHA 3S8MA 1RABA 1Y4AE 4LFAB 3NBYC 3TW8A 4BRSA 1L4GA 5ANRB 3DUFA 3WK7A 4EI9A 4R8MA 2BFEA 3ESAA 3R77A 5FRDA 2FF7A 1TQ4A 1V0JA 1LK5A 2NWQA 3GARA 1U3GA 1JDTA 3IAUA 1MFPA 2GSWA 3MG9A 3NIDB 2VHWA 4RD3A 4OLHA 1MA0A 3AUKA 5GM1A 2ZB2A 3O83A 5KSPA 3LG2A 4LN1A 1XPUA 4UPDA 1DBPA 3S2SA 3JQ8B 2ONJA 1PJQA 4MI6A 2P67A 5DBGA 3VVLA 4YRSA 2QLTA 2PZLA 4LGVA 4BO5A 5LA6F 4UQOA 5E0KB 2NPOA 3TTXA 1YQ9A 3A6FA 4JDPA 4JHLA 2VPPA 5A9SA 5L9AA 4EM6A 1THTA 1E3DA 3GA7A 1NW8A 2A4MA 1JZSA 2BMEA 3WBBA 4A0FA 5KQPA 1K6JA 4YGXB 1TRHA 1P9RA 1CJKC 1JG2A 1Q14A 1R6TA 1ZH2A 3K0BA 3O3MB 3QG1A 4GQIA 4RJJA 3VPFA 1UT5A 3B8HA 4DZRA 3TXYA 5I7HA 3JALA 2O8FA 3FPGA 2AZTA 4HDMA 4PFKA 1C8VB 4KR9A 4DZZA 5CEEA 1HT3A 3M4ZA 2ZFUA 3HFJA 4HEHA 3ASYA 3PRHA 3DF7A 4QXPA 1G6Q1 5DRYA 4ZXFA 1EESA 3X1JA 2OD2A 4TVBA 4PLTA 2YZ2A 3E3OA 3U7FB 4HD8A 5BWOA 1HFEL 1CPYA 1MQSA 1Q15A 3PC8C 5H81A 2W6NA 4GM4A 2ZEJA 4H17A 4J2TA 2RHMA 2EG9A 2DHCA 1NE7A 1ML4A 3ZU6A 3KQKA 3N8HA 4XJVA 1BXRA 2CNKA 1LS6A 3IT3A 3BXEA 1U90A 3LLVA 1GUBA 4EPYA 5BWMA 3O2QB 5LXTB 2XYQA 2YOFA 3U39A 4X3PA 5I7SA 4FYIA 1WW3A 4Q21A 5DNUA 3KQPA 1VI2A 2HMSA 4MV0A 1PR9A 4NTZA 4QUBA 2XMPA 4U02A 4YJGA 4MVWA 3ROEA 3TBFA 1ACJA 1G9TA 4NL4H 1CETA 3HA2A 2VK4A 5CFQA 3QOWA 3WOHA 1QO0A 4BVAA 1K4YA 4FNAA 2V3CC 1ELOA 1QS0A 1KOFA 3PGLA 1IEQA 3IMGA 4EG4A 1C1DB 3RWBA 4PONA 3W5VA 1YJCA 4L75A 2HOQA 4MW4A 2IQ5A 4PGFA 3WGYA 2BRUA 2ZTHA 3K20A 4XIFA 4HNAB 2UU9B 3DBHA 3CT6A 2EOAA 4NX2A 4O4LF 3IIKA 5JSZA 1GZ3A 1Z88A 4WXPA 4OJMX 5LYJB 5FA5A 4F4UA 5JCOC 2IZOA 2NU6B 4OPMA 1P7PA 3RM3A 5ECYA 4INZA 3FJ1A 3DOEA 1S2DA 3EJ6A 3BWBA 2Z6UA 3OCZA 2VDWB 2JCGA 2EX0A 3BJMA 4Q9NA 3VAAA 1TQHA 4PZYA 1FK8A 2RGXA 1I6WA 4HJXA 4DJFC 1M8KA 3LPAA 4FILA 4HRAA 4JU8A 5L3QA 3HQ4O 1AF4A 2DWQA 3JQBC 1U3TA 1V1RA 2FFRA 2FEMA 1XP5A 2CXXA 2JFUA 3KJNA 4H60A 4OQEA 3Q9SA 3VR4H 1P7VA 3U19A 2W2OA 3K9NA 3ILXA 4Q15A 2CXHA 3PNSA 3R0IA 4YRNA 1W34A 1FMCA 4BU0A 5HZKA 2Y1CA 1JQDA 3JZDA 3GLFA 3PS9A 5ALOA 2RGYA 4XH9B 5IAGA 5ETJA 1R5BA 3E3LA 4QGBA 2HKIA 2JIZA 4WXMA 4I4LA 3SLKA 4ZPXA 1EHIA 1CUJA 3CY6A 2PA3A 4RETA 4XX1A 2C9DA 4ZI7A 4EJ2A 4M1EA 1AQJA 2ZYSA 3BERA 1KP3A 2ZREA 3WMGA 1AS3A 1RBMA 2OFOA 4E94A 4OGWA 1JQAA 1Z13A 2OAGA 4W5QA 1E3QA 4YCLA 5CLFA 2HNBA 4I5IA 2JLCA 4G0ZA 4TRMA 1U28A 2HK9A 1ECFA 4QXQA 3NVMB 1LRKA 4KE8A 1GNQA 3QLVA 4ZI2A 2A9VA 4M9UA 2PU5A 3E2IA 3ETCA 1NV9A 4EGJA 1N92A 1QPBA 1Z39A 3CX4A 3M9LA 3HB9A 4M98A 4OYHA 2FZVA 3MUOA 5FB3A 4HH4A 1R74A 1W73A 2A59A 4I4TF 1DV1A 1G9XA 1TQ6A 2VG8A 2ZOSA 2O7SA 3GWGA 4PPNA 5I7EA 1JQ3A 1KFEB 5FX2A 2WWWA 3GFFA 4JWTA 3SF8B 4NZZA 2TYSB 3A4IA 2R6JA 4HX9A 3PHJA 4AJKA 2O3RA 4RKQA 4IDAA 2BEKA 3AQ4A 3CWCA 3SFZA 4I6GA 4TMFA 2HEGA 3PICA 5PNTA 4U6SA 1VJDA 2XEXA 4BQNA 1YZVA 5CH3A 2HBQA 3UKDA 1JNXX 5E4TA 1QCZA 5E7QA 1VM6A 1CERA 1NOJA 2P9QA 2V96A 2F6RA 1DAPA 3OICA 2AH5A 3TLAA 2AN4A 4WKGA 4IW3B 4UCXA 3MBOA 5KMGA 2A9PA 1EG7A 4PO9A 1VKOA 2AMVA 3AP2A 2BDUA 2QP9X 4CDGA 4C7OB 2W00A 3ZIAD 1EK6A 1ZUHA 3FYCA 5IHXA 5CG2A 2FFBA 2VDRB 2ZULA 3VNSA 4ETMA 4ZAYA 1R8XA 4UFNA 4BO9A 4RPGA 5EHIA 2NUTA 7GPBA 1X0XA 1YE5A 3P45A 1X38A 5BR7A 2J5BA 4Q4HA 5TX7A 4ENQA 4DV5B 4IJKA 2R6ZA 2YR0A 2DPYA 1DQPA 1NLYA 2YHSA 1ZEMA 3N9IA 5K2OA 4QHSA 1O5TA 2ZSFA 3E15A 4M22A 1FPQA 4ZKEA 4Q3EA 1BEUB 4AKSA 5CFMA 4X62B 5JAMA 1HDYA 1L8QA 4I8IA 4GPZA 4BIIA 4M1OA 1ITZA 2A9OA 3OCXA 1QANA 3SSAA 1UZNA 2Z2JA 1P77A 3OZGA 1SKYB 4TWBA 1AKRA 3QI7A 5K3FA 2ZSHA 4G5HA 3H1BA 5FUWA 1E92A 4KU4A 3G9UA 3MTDA 4B45A 3D31A 3JS5A 3EGDB 3ADOA 5FBHA 4ZIRB 3GEGA 4RBNA 1W8DA 4YJ3A 1LI5A 3A1TA 4UU7A 4F5WA 2NM0A 3J80A 3PXEA 1Q92A 1JVBA 2F64A 3GVPA 3QU7A 4MV7A 4RKWA 2C88A 3FCYA 3IT2A 1NOIA 4KRXA 4HNGA 3LP8A 4I4TB 1TK3A 3PNQA 4WLEA 3TQHA 3WYCA 2P77A 1UEJA 4EUNA 4D9MA 2RGAA 5CJ2A 3PB3A 3ZWCA 2G71A 4YECA 1VKNA 3CW2A 1PJAA 2WJ6A 1PDOA 3A4YA 1QPGA 2G04A 3B7WA 2ORVA 3LT2A 4E4RA 1YR7A 3PNYA 4TTAA 3Q6MA 1FUUA 1RQ2A 1T5DX 2B1QA 1FSZA 3H5RA 4OHWA 4R1LA 2G1AA 3TI9A 4E1VA 1WDWB 1FRFS 4HG2A 4ZQCB 4QD3A 4UC0A 4A5OA 1TU0A 4UBIA 1LEHA 1T8RA 1E99A 2ZKIA 4LHVA 1NF8A 2ZU0C 5JJLA 4B85A 3TJZA 2X0RA 3IUEA 3U1TA 4TSFA 2R84A 3HB5X 5HJ2A 2A3NA 1A7KA 2D0IA 3FOCA 4RXTA 3P2OA 4PAQA 1KMMA 2NTJA 2C4KA 3DVRX 3N8GA 4GPBA 2XCQA 1S3SA 1EA5A 1RADA 2V98A 2FRDC 3ZV5A 3UJAA 4WOKA 2WKPA 4YT4A 3GJ5A 5SY9A 3C14C 4FW8A 2GTIA 1XAGA 3HYLA 4QPZA 1IMJA 5B37A 2IV2X 5BR1A 4GLOA 3LX6A 2R7AA 5HSGA 3ZEAA 1WCIB 1EZ4A 4Y30A 4DG9A 4I4TA 1TM4E 3V2UA 4FI3F 2JKVA 4KE6A 3NCTA 4C4PA 4EKDA 5BXQC 1I9CA 2F43B 2Q1XA 1VYHA 3CRMA 1RJFA 4I08A 1N0HA 5F4BA 5HJ7A 1FZTA 1VP9A 1UADA 4MVJF 2PGOA 3KYCA 4BZPA 4G0UA 3P9XA 2W8BB 4HBGA 4B83A 4KGXA 3RV4A 1Z17A 4W63A 3VR3D 4W5RA 1LBQA 1QQAA 3IVAA 3ORRA 1PT9A 3AO0B 4JNKA 3NDRA 3CH4B 2P6PA 1K98A 2DMRA 2IZ1A 4UBOA 3KXKA 2E6UX 2OORC 3WGGA 1XD2B 2CUKA 1NFRA 4BMVA 3L41A 3ZVMA 3BGOS 1ZD4A 2QW8A 4TPKA 1VJGA 5C4GB 4AZSA 4RZSA 4DLZA 2Q5IA 1M1UA 1XA0A 2C03A 2I6QA 4HGOA 3FWZA 4IQ0A 4K87A 4WQMA 1ZBDA 2AX4A 2V8BA 2RE8A 3AY7A 3D7LA 1KAGA 4X1KA 1PJRA 2O05A 2Y0CA 4CV0A 4DR2B 2RK3A 3KUCA 4YV0A 2O5EA 1PI3A 5ERYA 5K0NA 3K0HA 3OJLA 3LF2A 4O25A 4ND8B 4QA9A 4BQFA 2XA1A 1EQUA 4DIUA 1Y37A 1WHSB 5FV7A 4C4SA 2ACKA 3F8SA 4C0AC 3I6ZA 5HF6A 4KPUA 4RIGA 1OIWA 1QVRA 3RJZA 1WSDA 1E3JA 3B20A 3CNNA 3H2GA 4LYYA 4R98A 1CZKA 4RA9A 4H15A 4RGVA 3LMKA 5G0SA 5BSTA 3UB3A 3ZWKA 1ZMOA 4OQMA 4BWFB 1U0LA 2FN3A 4B84A 1CS0B 3F73A 1T4CA 4RM2A 3DHNA 5KOYA 5FBZA 5JXGA 2AN5A 2D3TA 3EGDA 4ZCQA 3DL4A 4ZIRA 4A0GA 2J32A 4BNLA 3I6BA 1FUIA 1I2MA 2JGEA 1Z2DA 3BJIC 4H7PA 1U80A 4MP3A 4UAUA 1CUUA 1CEQA 3GO4A 1PUJA 2WYVA 3JWPA 2RKOA 5KYYA 4WN9A 4DR4B 1ZN7A 2Z56A 1XO1A 4TT3A 4DLXA 5FFMA 2OZLA 1W8IA 4GNKA 2QLLA 1HDXA 3B5JA 3DVAB 3JQRA 3UUWA 4R0VA 1QHGA 2WJPA 2H52A 4R9NA 5CLIA 5E9QA 2R6GA 1ZVQA 2QIPA 3FGPA 4D4HA 3RHFA 2O0LA 4J0CA 1RQ7A 4L0MA 3G1WA 3D2AA 3B1ZA 1JPUA 3E4DA 3K09A 3PDIA 4FYJA 4K7JA 4DFDA 5KQMA 5J2UF 4WXHA 3TZKA 1PJ8A 1T4DA 4GI5A 2DAPA 2NYUA 1OZAA 4G41A 5JLAA 1L4HA 2QUBA 3SYKA 1O8CA 3DKRA 4D8WA 3R9XB 2X77A 4O4HF 2QLMA 1N7IA 2JFFA 2J0SA 3P32A 4LXTA 1OPXA 2YC4C 4PAWA 1FNBA 1TGYA 1VFNA 2WOJA 2YNMA 5FWYB 5HFJA 1H4QA 4KQJA 4G86A 3N58A 2PGAA 3T9AA 2IP2A 3DPIA 4M21A 5DTQA 2OV3A 4HDSA 1T3ZA 2I2BA 4ZO6A 1HQYE 3PHGA 1RI1A 2X58A 2BTQB 2P8JA 1Q1NA 2V8OA 1NJSA 4OKIA 2PT5A 4ADSG 4OI0A 3LK6A 3GFSA 5A7GA 2JIZD 1LX7A 1DFGA 2AYYA 2H7VA 1C7FA 1ISRA 1EI9A 2DR0A 4EQ6B 5K03A 3QELB 1I9GA 4Y1FA 4Q9LA 3CUYA 3RARA 1SUAA 3VYRB 2ZIVB 2QM7A 3GNSA 3NM5A 3S2ZA 1V9CA 1RPNA 4V3CA 1NVGA 2ANBA 3IHTA 1Z0FA 2QMEA 2Q41A 3WLOA 5C53B 1PS9A 5IT5A 1M2HA 3KQOA 3S29A 1QMGA 4AMBA 3HSYA 5DKFA 1INLA 4K9RA 4RESA 4IWXA 2XNDA 4HYEA 2AOUB 4IPTA 3W4IA 1FNNA 1C4WA 1E96A 1YQWA 5F4ZA 1DADA 3SQMA 1FRVA 4AWBA 5BYKA 2VRCD 1ZIXA 1NVBA 3H2ZA 4JFRA 3W8FA 2PRJA 2CVHA 5DGHA 2AG5A 1SB8A 2ZRLA 4LX8A 2P41A 3PWKA 4OGFA 1O6BA 3EXFB 4LBZA 4NH0A 5F7OA 2CSUA 5HZHA 1FFGA 4FC6A 4KO3S 2F1OA 2Y0DA 4YMLA 1VHDA 1QV9A 2WU1A 2X8AA 2ZROA 4GI7A 5P21A 3UWPA 5KNDH 3NMUF 2QKYA 2I6GA 3LNCA 3P0IA 4JL6A 3T7RA 1AUXA 1L4KA 2G5PA 1H2YA 1M6NA 3RIMA 1QIIA 3PUJA 3S2GA 5LUAA 2EIHA 4CEJB 4BBPA 2QAGB 1DO2A 1RLTA 4CG2A 1ZJWA 4OJNA 4PSCA 3ITNA 5TMEA 1JWAB 3SJUA 3T3MB 1YOVA 1UT6A 3ZV3A 4B3BA 4LI3X 3A4TA 4L3VA 5A9RA 2ODAA 1NRWA 3Q7SA 4UHDA 3G2JA 1VMEA 2MMCA 1C80A 5BSRA 4OGKA 4EPVA 3GVHA 5CFNA 1N6OA 3O3OB 4BQOA 5K4HA 1BQ3A 1FTSA 1YQTA 3KFXA 4GMFA 5CFRA 1KZ6A 4NMWA 1Z5WA 2Q0SA 1W4BA 4Q1BA 3C3JA 3R0QA 3CH6A 3NEAA 5G53C 5ITVA 1G38A 4MWSA 2IOQA 2SCUA 3U81A 4QSHA 2F2TA 3FZGA 1QIEA 1TCAA 1V2GA 3MJCA 3IIJA 2IF2A 2RAFA 1GTMA 3N53A 5DNEA 3RUAA 3EWSA 3KQMA 1JDNA 1O5OA 4CIVA 4DTIA 2X1MA 2ZJ4A 1N32B 3KQHA 1KBOA 3UHJA 1L7VC 2ZJBA 2QVCA 3R20A 2ZSDA 1VMAA 5REQA 4OQPA 4QU5A 4MPTA 1SKQA 1FSFA 2WJWA 3K3PA 3OI7A 5I6DA 1A76A 2RAPA 1JFLA 2WB2A 1RWNA 1C1HA 1NVUQ 2RKWA 1RCUA 3PBKA 2QVZX 4WLOA 2I7VA 3E3AA 3HCBA 1QXSA 3CLTD 5F1PA 4A2PA 3HKEA 5FOSA 2M6LA 4DJAA 2XOKA 3S44A 3AR9A 3D6JA 3DLTA 1XQXA 2RHBA 3UAVA 3C87A 3V34A 2DKOA 4JLUA 5B4UA 4GD3Q 1O54A 1TEHA 4MS1A 1KH2A 1DPFA 3CLHA 1PZMA 2GJ9A 5EOVA 3KJXA 1AF7A 3ZDYB 4RHEA 3RUPA 4D97A 1TYBE 2PLRA 4HFRA 4I2VA 1TC1A 4HPXB 5GJBA 1VG9B 5BO5A 2WLSA 4BLVA 2OCPA 5CXUA 2X40A 5SZJA 1JXOA 3RROA 1K0UA 2JDIA 1KJIA 3NI2A 3T3OA 3ROFA 3VKFA 4CIYA 5LQRA 5JAHA 4AY2A 2ECPA 3IULA 1DHRA 3HCEA 5CNMA 5LDHA 2H9AA 1TXGA 4KAAA 3SU8A 2VRNA 1CY2A 3VOBA 1H9CA 5DXFA 2UZ1A 3PPIA 1CQXA 3VR2D 4B0OA 5D3QA 1B42A 4KH1A 4PTZA 4K86A 1OLOA 2OQ2A 2ZJOA 4G2TA 5JWHA 2X0NA 3B1WA 5CM9C 1ZS9A 2VP6A 4AQYB 3NNSA 4CV3A 4IRXA 3MWKA 4D9NA 3SYMA 3PJEA 5ALPA 3TW0A 3NU1A 5AK5A 3KAPA 5DIZA 3ZK9A 4DLSA 4I1VA 4KXVA 3E8MA 5AQ1A 4EJMA 5AK4A 4B2PA 2O8EB 1EKXA 1PWEA 3WGTA 4DUPA 3HJCA 3A2KA 3QJGA 1BD3A 3JYNA 1Y9ZA 4R51A 5EJEA 1IZ9A 3C8UA 4NYIQ 4IJMA 4WCFC 2G6BA 1I7DA 4G85A 1Y7TA 2HQ1A 1LPMA 2WD7A 3LS2A 1U7HA 2BCGY 2VK1A 4AO7A 2QX7A 4TL8A 4IR7A 5GIOE 4L9WA 3AERB 1SC9A 3GJ3A 4GU5A 2IZZA 4U1RA 1ZNYA 3CCCA 1KEEA 1I7LA 3F4KA 4EKYA 2P7HA 4N4AA 4XSVA 4L4SA 4PYMA 5JNRA 4PYKA 1J9EA 2PR2A 3E5RA 2IGBA 1T0HB 4FM9A 4RY9A 1FP4A 2PUFA 4NOMA 2BMDA 1UBMS 5AHKA 4A5SA 1JIXA 5JO0A 1CUYA 3TL6A 1E4OA 2ZYAA 3ASUA 4EG7A 2BM0A 4LX0A 1WIWA 4OMUA 3PX7A 3HCFA 1JALA 1CR6A 3ESRA 4KVGA 4JR1A 4O1IA 3UXEA 2FA9A 1QE3A 5HR5A 2FRVA 5EI5A 3COWA 2MSNA 3FRJA 4M0CA 1OX6A 4K3VA 3LT1A 4QU0A 1R0KA 5EVJA 3OPMA 1WMFA 1MDBA 3W9BA 4DSNA 4BO2A 5EESA 3DPSA 6GPBA 4FMDF 5IN4A 4FGSA 1NLMA 1FYDA 3VR4D 2IX3A 1NMQA 4LDRA 3DM5A 2FWNA 2VUHB 1PL8A 2J5XA 5K3EA 1UMDB 4ENPA 4JV5B 2C92A 1ZUIA 4X1YB 1Z6YA 4QU9A 3KHSA 1YZLA 5KJCA 1P7CA 1LUAA 2DSTA 1ZSYA 3MCWA 4IILA 2C5BA 1ZO8A 2H2WA 3C0KA 3HJHA 1HZZC 1SEVA 1UBCA 2Y1OA 1QH9A 2IVFA 3KB8A 5JZOA 3VDNB 4O4LA 5KYGA 5E6SB 4ASUD 3LVQE 3TYXA 4PZCA 5KIAA 2V7TA 3BG5A 2QTBA 1Z6TA 4ITUA 3FPBA 1EHYA 1GCUA 2BDEA 2YCBA 4ZOBA 2LE0A 4BQPA 4EEZA 1P5ZB 1WDTA 4RK1A 4OQZA 1GDDA 2BR5A 1ZOOA 5DCYA 1K6IA 3LGAA 3O38A 3EGXB 3LA6A 1FDVA 2EIXA 3HACA 5JRDS 3Q3JB 1YJAA 1AUPA 3ZBTA 1JIJA 1Q83A 2B35A 2B82A 5CDUA 4NQRA 1QUEA 3UKJA 2A8YA 3PNPA 1YS7A 3MWGA 5LDDC 1E94E 1JU9A 3N0TA 2WPDD 1T29A 4YMWA 1E59A 3RVQA 4WBSA 3NWBA 3T54A 2B21A 3DMGA 3EA4A 5CPBA 4QYMA 4D6PA 2JLUA 4QDKA 2NP6A 4MLPA 3K09C 4EKGA 4ZI7F 1L6IA 2X41A 3C6MA 4FSDA 1IPEA 4WDRA 5LVAA 3TECE 3BDVA 1Q0PA 1JDBB 3BMQA 2VN8A 3OIUA 3FWKA 1QVVA 1CUVA 1L4MA 4BLQA 3OIWA 4JP8A 4F6CA 1T2AA 3BKXA 2EJVA 1M6YA 2B4RO 5K3DA 1TIPA 3FSRA 2YNMD 1NKSA 4JLMA 1CDEA 4JLNA 3R7AA 3H97A 3L1UA 1HY3A 1TUIA 5D5PA 1KQ3A 2VJCA 1QAMA 3OQHA 2IHTA 4ALMA 1OH5A 1DAKA 1IUKA 1OI3A 1W5FA 3UJCA 2G28A 2PRYA 4CEHA 1RQRA 3H04A 4K6FA 4MQ4A 2GSDA 1W36C 2R6HA 4N6GA 4B7CA 2QTCA 3AM3A 3DO8A 4L74A 4H1TA 4WFQA 4DIDA 4MP8A 1WM1A 3UJBA 1OBOA 3LL7A 1RSZA 2FQYA 2DPLA 3FPFA 1N5MA 1JJ7A 1IRIA 2KWIA 3GC6A 3I0ZA 5LDGA 4DLPA 5A02A 3IV7A 5JAZA 2UV8A 1YACA 1QDUA 3AV0B 4CLOB 1E62A 5J9FA 2YCLA 1ZU5A 3KT6A 3G17A 5DTJA 4ZICA 1JLSA 1ECCA 1N3BA 1XX6A 2D0DA 3FD8A 3KLMX 2P3LA 4NH4A 3OD1A 3DGFC 4K40A 1I32A 1YL7A 5G1NA 4YCBA 1JXAA 2R2AA 4PZZA 4D8VA 5JJCA 2VDLB 3QF4A 2ZT6A 4J43A 1R66A 5DT9A 4OHKA 2XV1A 2Y92A 2Q21A 5JHHB 5E6UA 3GPDG 5JBIA 5K0BA 3NNNA 3IO5A 2C1ZA 4E11A 5AM2A 2GN2A 1H69A 2WU4A 3KHKA 3H19A 4H1VA 1NULA 3CT4A 1E1CB 2BDTA 2FN8A 1B43A 4F2GA 3GFQA 3T4EA 4NCIA 1FVOA 3P26A 3UMCA 4TL6A 4YO8A 2XI4A 3OKPA 3RAGA 5DM70 2POCA 4BECA 1TFUA 1IU9A 3RUFA 3E23A 4TYWA 1SK8A 4DUYB 2Q28A 5AR1A 3WLRA 3HYRA 4BFUA 3A70A 2TMDA 1M67A 1U4OA 5HTOA 3EHEA 3DMTC 1CS0A 3W4KA 2PUAA 2GCOA 1XRJA 1BIFA 4QASA 3RTBA 4A03A 3ZGVA 4MZXA 5J4HA 5CDTA 3TR5A 1RFLA 2AKYA 4KN8A 5KSYA 5FEMA 4UM8B 1QHFA 2PT6A 5EKXA 1DUIA 3BFJA 1GYQA 2CCJA 1IN8A 4KK4A 4II2A 4HDOB 3K0CA 2UZ3A 3B12A 4GEGA 2DFNA 2BEJA 4OBWA 3GVIA 3S1SA 3LCUA 3TIGA 4KYIB 2JLZA 2BFNA 2I3BA 4G8DA 2RKBA 4QUGA 3PEUA 4FFNA 1GG9A 2MSDB 4XVCA 2CKMA 1Z8FA 1AB6A 1VCMA 4AJ1A 4X7RA 4Z1MA 5SYAA 5IVPA 3H65A 1JDPA 1RM0A 4MV9A 3U3OA 1S4MA 3JD2A 4JJFA 2AYZA 3S8EA 5EJ7A 2FN7A 3DDNA 4PQGA 1AKQA 3CX3A 3BWEA 4PN3A 5JISA 2HWWA 3JARB 5FOXA 3G2LA 1M1XB 3CNBA 1SZCA 1XTZA 2CBXA 5JDCC 1L7DA 2ZIWB 1GOTA 1LBIA 3BCSA 1Q0UA 1N75A 2I6XA 4TTPA 5A9TA 3CLVA 3VPSA 3E8SA 4EYGA 3HXQA 4KN6A 2GWRA 4XJXA 4W5JA 3MMXA 4IIXA 5T8KA 3ZEIA 2X9LA 5KYYB 3VZCA 3QLVC 4FFBA 1QYWA 3FJYA 2F43A 4TRJA 4BGDA 4IWYA 1KK2A 1UJ2A 5HKAA 3VC1A 4JYCA 4NXNB 1SBTA 1QWOA 2CMDA 2R8EA 4ZQGA 4M8KA 5B7PA 3G0HA 3WWYA 5DLYA 1V25A 4XVHA 1O94D 4WMLA 5CB8A 1DEOA 1ZM7A 5B2ZA 4HNVA 1JQEA 3G8CA 3L6CA 2Z4SA 1P1KA 3N2GB 1AB5A 4NFSA 1REQB 4Y6PA 1D8TA 3PWZA 4WH0A 7ADHA 5K3AA 1MENA 2HBYA 2ZR9A 3IUMA 4ZVVA 5KTTA 2H5EA 3EYAA 2QMOA 4UOZA 2OILA 3PPXA 3IQZA 3TDMA 4BNMA 4LOKA 4YV2A 1P81A 1YKGA 3ER6A 4JJIA 2OZKA 1JTFA 4Q3KA 1ISMA 3ZV4A 4U6NA 1CYDA 1U8EA 4IVRA 3X43A 3TNLA 1NPDA 1ODTC 4BB9A 2HQRA 5A0TA 2WK1A 5A05A 4P9NA 1A9TA 1TM7E 2EZ8A 4A36A 4Z7JA 5AOVA 3KQNA 4YJ2F 3HXTA 2VXBA 5HKLA 3PA6A 2DWUA 4R68A 1R0RE 2MYNA 2XHZA 4JR2A 4GUAA 4RW0A 2ZYHA 5GJVC 1C7EA 1EFHA 4PHFA 3H5OA 1R0YA 5JYEA 5B1DA 2V6FA 2X3UA 3CZPA 5DX8A 3U4DA 3UH0A 4ZDKA 5K05A 1UZLA 2NUPB 1P72A 2RBGA 3M4NA 2UYGA 4WT7A 4TV9B 3LYAA 4K9LA 3KSAC 3FDJA 4B2LA 1N2ZA 4OH7A 4HLUC 1H94A 2R47A 3AETB 4CIBA 3GIDA 3CM0A 2FEWB 1WKCA 3Q41A 1DJNA 1OT5A 1J2RA 1OLXA 1U7WA 2N47A 3GRPA 3HBNA 4N9WA 5CVCA 2HT6A 5ELMA 3FSGA 3ZHQA 1EK0A 4I55A 1GKLA 4O4JA 1BW9A 3Q3CA 3DUWA 4AZWA 2AR0A 3K94A 1NBIA 2A5LA 1GVHA 2GXUA 2QUJA 3WWPA 1ZUNB 3A4LA 1RZ3A 2PKQP 5EJFA 1H2ZA 4AAYA 3Q2IA 2H0RA 1BGVA 1FUKA 4ENSA 1C3OB 2PMEA 4EUFA 1E2HA 5ALJA 5AKGA 3EVDA 3VNRA 1M1YE 1ZR4A 1NG9A 1SCKA 1UL1X 2FZCA 5D01A 4DMHA 1JEYA 2ZBRA 5J63A 2XBUA 3SF8A 1H9AA 3CF2A 3D6HA 4KHZA 5EE9A 3CVXA 1UDBA 3AQIA 1CKEA 2GPTA 1Z4LA 3GFRA 4FSHA 4GDMA 4TV9F 4EHDA 1XPRA 1CQPA 4DMCA 4AS1A 1IXZA 2FEXA 2P4QA 1DARA 3D6NB 3FLAA 3H9JA 4G8BA 5LL6P 1AK2A 4X1IA 1GADO 1ZN2A 1LZKA 1TEXA 1IQUA 1GPNA 1X7ZA 3BDAA 3JVIA 3PHIA 4K9SA 2WHRA 4BGIA 2ZRKA 3IOYA 2VYVD 4L8YA 3ABSB 3EARA 3KPYA 1I7SB 2ERXA 5IUJC 1QKKA 5DHAA 1DJLA 4FIZA 4LOLA 221PA 1IN6A 4KIJA 2X7HA 1EUDB 3OT1A 3SK0A 1GZUA 1P7YA 1ZNXA 2R5FA 2Z08A 1FOEB 1PHPA 2GK7A 1W47A 4I9FA 1PEKE 2O8DB 2QJRA 4JCCA 2G0AA 3PJFA 4MQEB 5CFPA 3DPUA 3QEKA 1JIUA 1WOYA 2GO7A 3B38A 4YA6A 5ARDA 5IWCA 2GH1A 3ZWVA 1UK6A 4BKOA 4BN0A 3DZCA 4EL0A 1RI2A 3HYCA 1XZ8A 1DFHA 4R0NA 3S5JA 3FFTA 3G6WA 3TN7A 3ZIDA 5G0TA 3AM5A 2HGSA 3NASA 1PK8A 1UWKA 1GGJA 2RGDA 4KSBA 4Q1VA 1G3MA 5TQVA 4CR6A 2DBYA 3CG0A 5EG5A 3GRYA 5AO9A 1CRWG 4DDWA 1KIFA 1ZFNA 1ZMBA 2EW8A 4ZU3A 1FDUA 4NEHB 2MSCB 2O1EA 2XOKD 3W9YA 2QL6A 4UMDA 4DMMA 1WW8A 3PHHA 1Z5GA 2YQ5A 2WNIA 2HHAA 3OZDA 4FOLA 5IABA 5KHOC 4OB6A 2XQVA 5B4TA 4JYAB 3PDUA 3WB2A 1DTEA 2YJ5A 1CS4C 1T4MA 2W2KB 3D6UA 3LD9A 3PD7A 4KJZA 4QPNA 4D3ZA 1DCFA 4MW9A 4HB4A 3L18A 1Z4IA 2CC2A 3KQUA 1WCXA 4F7WA 3UJNA 2FN4A 3M4JA 4MEBA 5DNAA 4CE6A 3OT1B 2C2GA 4U7GA 4F4DA 3W9SA 1DMSA 2Q5JA 3UMSA 1DXYA 1T6YA 4NESA 4W9RA 1NI4A 2C7QA 1B76A 4KB5A 4OSPA 3NHPA 5CCBA 3EDCA 3TGWA 1VBNA 2Q0QA 3NLLA 2O7NA 1X1BA 4I8DA 3D6TB 2BV3A 3GDHA 3QZUA 4RS4A 3VR2A 2ZUWA 4KUEA 3R09A 3RC9A 3S2FA 2FLKA 2EW1A 2WDPA 3I4CA 1EK2A 1T8TA 3QHPA 3K05A 3KLBA 3QLJA 4TTVA 2C2KA 4CFZA 1Y6FA 3DB2A 3I2KA 4Q7KA 4D81A 1I24A 2OK8A 4MUXA 3PEWA 5DEIA 2SICE 3G5MA 2HDNB 4DWVA 4BYGA 4DIEA 3HZHA 1GQOA 4ZQHA 4ESHA 4TLAA 1RJEA 1EBFA 5L53A 1D8AA 1E2PA 2ZRNA 2Z98A 2NVWA 2QUKA 3GYGA 3MTJA 2N75A 2XVAA 3KVNA 3IXQA 4MRPA 4S2UA 4HTFB 2HV9A 2WV7A 3P7MA 3T06B 4F3NA 2PSSA 3NDIA 2JFGA 1HDOA 1TM1E 2Z2IA 3INYA 1KTIA 1YHNA 1EFVB 1OX4B 3P2MA 4LVOA 4P5EA 4REQA 2WI8A 2YJ6A 1H23A 1QE0A 3DMRA 3I1YA 3KPWA 4QUIA 3U37A 2KW5A 1H2FA 1UK7A 2VXOA 4O5AA 5JBNA 3TG8A 4CG3A 1IB6A 2B1JA 1NVMB 3TKYA 3ZY5A 4UTNA 4KN9S 4O5OA 5KU1A 3SBOA 1EPUA 4P53A 4ZMSA 3SEAA 4KXXA 1BDJA 5T57A 4PIPA 5H68A 1NVAA 3A9SA 2RJOA 5EKSA 2JGJA 4O0MA 1MG0A 1P2VA 1VSTA 1T24A 1JJVA 2C54A 2C95A 3GEEA 4HB2A 4KO4S 5EHNA 2EWMA 1KAQA 5BV2P 5TPWB 1HG0A 1TCUA 1IK4A 1WVGA 5GVRA 2PO5A 2ZQ5A 3Q11A 1J06A 2FU5C 2QRVA 4GT1A 4QOIA 2HIMA 1US8B 1W1IA 3GZJA 4IDCA 5KDOA 4YAFA 4X91A 4I1IA 1PYGA 1SBYA 4V0OA 4S05A 2HV8A 3O92A 2XNHA 4BQIA 5JO9A 4CKXA 3VTKA 1N2SA 3L1HA 3KEMA 1KPHA 2Y9PB 1G19A 4M9XA 3RKRA 1IIRA 5ITZB 2ATXA 3CSUA 4D0LB 2O4CA 4XD7D 3VO9A 3AI2A 3OA2A 2XT9A 4E5VA 5JNWA 2RGWA 5BNWA 3QTBA 1K3FA 1Z73A 3BSYA 3RVLA 8ABPA 1OWPA 3HUFA 2ZPUA 4IEFB 4DEYA 1LLFA 4UTXA 4GM1A 4RAOA 5GPBA 1U2GC 4ODIA 1RWOA 3DA8A 3ICVA 3A27A 3HCDA 1C1YA 2ZS8A 2WE7A 5F23A 10MHA 4X92A 2QR3A 1T0PA 1UKVY 2CLIB 2GETA 1XEXA 1C9MA 2RHDA 3L7OA 4YIKA 3S2EA 2D0OB 3HKEB 4EO4A 3MPOA 4TKVA 4M7RA 1EE1A 4W9MC 2HI0A 5JC8A 1C7IA 4UASA 3H87A 2Y4NA 2JH9A 5NLLA 2PUEA 3WWEA 4Z4GA 3A4MA 1Z6AA 2O2ZA 3Q3GE 2WIGA 3L7AA 1TIBA 4N5NA 2GVNA 2OB2A 1AXGA 1U1DA 4FMDB 3T0FA 4AJJA 5MDHA 4R2LA 2IHVA 1QZZA 1A69A 2QG4A 4LXIA 4ZREA 3EK2A 3IV9A 1KKUA 2R1TB 2A0KA 3E48A 3RUHA 3VC3A 3OO1A 5A0VA 1MMFB 5ALKA 5JRZA 4BQSA 1D6SA 5KOJB 2EHJA 3QXGA 1JEEA 1MQ9A 1TVMA 5C3UA 2JARA 3VX4A 1WY7A 1Z47A 3ET5A 3IXMA 4JOBA 2QMZA 5DFAA 2Y1LA 3SJBA 3V8RA 4L2IA 2PX4A 3ZQ4A 1HQDA 2QRKA 5JJ5A 4YUVA 4WE3A 3WK8A 4IF4A 1IZ7A 4F92B 2HN9A 3DBHB 2J7KA 3HCCA 4UW9A 5LXTA 2QUIA 1IOVA 5H9VA 4DF3A 3STWA 4BVLA 5KX5F 1L5HA 2R68A 4IJQA 5JSYA 3V7WA 3GJ0A 1JL3A 1KMQA 1HGXA 2PT9A 3PYXA 5COBA 5IK2D 4H7KA 4C87A 5JJKA 2VATA 2QD2A 1OROA 3VTFA 3TRFA 3P9KA 1AUVA 1KHHA 3SIRA 1XU9A 3VKWA 2GXSA 2VH5R 4G8JA 3ND8A 1NBMD 4EG0A 3I8XA 1K88A 4BBAA 5T6BA 3EFHA 2PH1A 2EU8A 3FY4A 3LTEA 4LSMA 2YW9A 4N3AA 3SFVA 3SPXA 4CTJA 5A5GA 3AP3A 3RAFC 2L17A 3OIYA 5HX7A 2YQ4A 1JW9B 3B7PA 3R6DA 1MOQA 1ZH8A 2AEJA 4CQMA 2AVDA 1UXHA 2R79A 2LR0A 2O9JA 2ZANA 4JJEA 3RUEA 4QGSA 2D7JA 1T15A 2YJGA 3QE3A 3WGOA 4MYCA 3ER9A 2GF9A 3OTQA 1JAYA 1CY0A 4UTPA 3SZ3A 1NU8A 2LBPA 2VR1A 2WFLA 1GV0A 1BDMA 2YICA 1E18A 3B6EA 2Q4BA 3H1PA 3PU6A 4NEQA 4FOPA 1JB1A 5E1BA 3ZZNA 3LWZA 2B37A 4FOOA 4L4RA 4PX5A 4EGQA 4II3A 1KXJA 1QYXA 1T1EA 4DQDA 3LC2O 4N65A 2MDTA 2QJWA 3HGTA 3UATA 2B4QA 4HDNA 5CHYA 4AMZA 4HS4A 3BHNA 2VWQA 2HSGA 1NE2A 2BP7A 3NR2A 4NCHA 4ARBA 1QE5A 4Q3LA 3DW1X 3AV3A 1R7RA 3V46A 5CDFE 3VNVA 4URHA 4R0MA 1GZSA 2OO5C 2EARA 3RGWS 2PZGA 1NBHA 2QDKA 1ACLA 2FQQA 4UQPA 3GH1A 3RBVA 3W7AA 5I5GA 2W2PA 4C0LA 4BX9A 1XTRA 5J4YA 5JVDF 4MHTA 1L3CA 1W30A 1KVRA 3JSAA 3B3FA 1P1FA 1TZKA 1VSQA 2LTAA 3G5UA 1NBAA 1P4GA 2VJMA 3ZH9B 5BVGB 3GCDA 3ZKWB 3GCXA 3GWZA 2I62A 2P3QA 3AF2A 4DEXA 2YW2A 3PC6A 4B6SA 2J3MA 3Q0IA 1CNEA 1W19A 4LHYA 1WBBA 4MAFA 3BJEA 4WJZA 1LLCA 2IUTA 1V3QE 2OBBA 2WWRA 1RLMA 5FI1B 4TUYA 1C30B 4IRMA 2JKZA 3FAZA 1IY9A 3SC2B 4CKWB 2QNIA 2PR7A 5FULA 2GBLC 4WESB 3K9FC 1BVUA 3OC0A 4Y2RA 3NUGA 3C3WA 1NUHA