4WK6A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
243
structure length
243
Chain Sequence
FMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVASVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae 12129(1)
molecule tags Oxidoreductase
total genus 88
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wk6A00
2ILTA 4PG5A 2P4QA 4ZHSA 1Y8QA 4Y6PA 3RFVA 2OORA 1P1HA 5U4QA 2C2YA 3ZWYA 4MP6A 3RVDA 5I9LA 2DAPA 4NBWA 4JBGA 4DC1A 3PIDA 4HFNA 1BXKA 2AW5A 1LRJA 3EAGA 4I9NA 4OMUA 4IS2A 3H5AA 3C8MA 4DMLA 2PK3A 3G17A 3D4NA 3F9IA 3K2EA 3TDKA 2Q2WA 4CMJA 2P9EA 4GLLA 4PLHA 4W82A 1R12A 1TXGA 4KDEA 4F6LA 3WJAA 8LDHA 2GCGA 4XDZA 3RUHA 5COBA 1P45A 3HQ4O 4TRJA 3NT2A 4GX5A 1UZNA 4PRLA 4B8WA 1AHHA 3D4OA 4YPOA 1I33A 1B3BA 2EV9A 3FPLA 4ONEA 2PLAA 3CH6A 1WW8A 2GNAA 1LX6A 3DFUA 1BXGA 1YONA 2NV6A 5G0SA 4R51A 3SBOA 1NFFA 4BNJA 3HSKA 1N8KA 5KOIA 4W99A 1I3NA 2VYNA 1OC2A 3GEDA 1Y9EA 1JWBB 3JD0A 3FR8A 3QSGA 1IL0A 1DDOA 3GLQA 4GKBA 1Y8QB 3PK0A 1VRWA 4I5DA 3A06A 3I4CA 4MVJP 3HDYA 3N7UA 5KTKA 4BO9A 1GTMA 3MWDB 2O2YA 3ZI0A 2YY7A 3V1TC 3EZLA 5DT9A 2JD1A 4FBGA 4AG3A 1DLIA 1V3VA 4ZD6A 4XJSA 3GG9A 3ZH2A 4PLGA 1AN9A 2D8AA 2CDBA 2C20A 1IOLA 4CMBA 1IZ9A 2Y1FA 4CM9D 1H6BA 3VTZA 1DRVA 2ZB3A 4HADA 2Z1MA 2J3IA 5K9ZA 3BHMA 1MP0A 2I3AA 4NDNE 4BO3A 5ER6A 2X0JA 3RUEA 4FB5A 1TLTA 1ZJZA 4I5FA 4DMMA 3PHIA 1GV0A 1YKFA 4LSWA 1PL8A 2YV2A 1DIBA 2W8ZA 4WK6A 4MO2A 4TSKA 1SOVA 1EBUA 1F8GA 3DTYA 2OBNA 5AQ1A 3HHPA 3JQGA 4E4YA 3DDNA 3ZHYA 4EJMA 3COSA 3RU7A 3C1TA 1KC1A 1YL7A 4UEKA 3UUWA 2ET6A 3UAGA 4BNMA 3P5SA 1IULA 3GY0A 2ZTLA 4LMPA 1F8FA 1QLJA 4J3FA 2C82A 1H6AA 2R2GA 1GY8A 1NX6A 3MTJA 3TPCA 5ILOA 3GF4A 2PD4A 1WXDA 1CQJA 5A4DA 2CZCA 3AUSA 3FTNA 2BFOA 4XR4A 1U7HA 3NDJA 4EJ0A 2Q4EA 3L6OO 3D5TA 4D3DA 3AUTA 2AQ8A 2O3RA 3QVWA 4PLVA 2GN8A 3FRJA 4IQ0A 1GR0A 4AJ1A 4KOAA 4Y98A 1YQXA 4O5OA 2AE1A 2HRBA 3SC4A 5LDHA 4YAEA 4PZCA 5ICMA 3Q2IA 4I5EA 4BQPA 4PG7A 3ZNOA 3I5MA 1CETA 1H2BA 4CLRA 1DOHA 4NG5A 2VRCA 1HE4A 1O6ZA 1HDRA 2BGKA 3NKLA 4JCOA 1H6CA 5IF3A 1XDWA 4RJTA 2P5YA 4M87A 4XYGA 4J4TA 2HMVA 3DHYA 4ZA2A 4AFNA 3UXYA 1Z75A 3V1YA 1W4ZA 2HLPA 3WMXA 3H9JA 3BMNB 1E5QA 4N54A 2RH4A 2PH3A 3ZWCA 3JQGB 4CV1A 3L6DA 1Q0LA 2D5AA 4EDFA 1C0KA 2Q50A 4CM1A 4DWVA 1N1EA 3PQDA 4TVBA 1E77A 4PG8A 2WWRA 4Y8VA 1Z45A 3PZRA 4ZGWA 4ZQGA 3U4HA 4IZHA 4BO7A 5KVSA 2DPGA 2WDZA 4D41A 4DPLA 4LRTB 3GR6A 4HY3A 4JROA 1XQ1A 4BNZA 5L4LA 2JFHA 1IZ0A 5EL0A 1UR5A 1C0LA 4BGVA 4BKPA 5IDXA 3GMDA 3TZKA 1JWAB 5A05A 4PCVA 2W2LD 4Z3DA 3V5NA 3UHAA 3GVHA 3GOHA 3TFQA 3NGXA 3EVTA 3M2TA 1N5DA 1PL7A 3WSWA 4CLRB 3VH4A 2VWGA 3I83A 3TZQA 3L07A 2DLDA 5A04A 1DJNA 3PEFA 3TJRA 2VUTA 1H9BA 3JQBA 1L1FA 4RPHA 1PQUA 2O48X 2NTVA 4KUEA 4R41A 2DU8A 5TIIA 3Q1LA 4BO5A 3WGHA 1ADFA 4ZICA 5I7VA 2OL4A 2V7PA 1LLCA 3VPSA 1A7AA 4RVDA 5G0UA 1TI7A 3KLMX 3S2GA 1PWZA 3W6UA 2OO5A 1JAYA 2G17A 3GT0A 3NV9A 2FZEA 1O95A 1LI4A 2ZB8A 4J2HA 1TVEA 1XQ6A 2Q1WA 4BVAA 4ZQEA 3ULKA 4Q3CA 1N7GA 2HUNA 4XGKA 1BW9A 4GWKA 2RAFA 5T8KC 1MGOA 1I01A 2ZCVA 1GFSA 4Z3KA 4JQCA 2AEMA 2A92A 1IB6A 4W7HA 3FWNA 2PZJA 4FFRA 1Y7TA 3CTMA 1Y1PA 4FS3A 1ZSVA 5A02A 1V9LA 1U7TA 2X0IA 2YJZA 3RC1A 3KSUA 1I8TA 1T25A 5F21A 1JA9A 3GUCA 5T64A 3F6YA 4AJNA 3ICCA 3B70A 1RYDA 4BHTA 4XGNA 2HJRA 3PVZA 1B3RA 1D8AA 3VKUA 1KVUA 1QV7A 2IZZA 1LSSA 2BI7A 4J7UA 4R4JA 4TKLA 1O8CA 5DDIP 1FDUA 4NJMA 2NVUA 3JYLA 3L9WA 2CF5A 4MDHA 4ZQHA 3V1UA 3H8VA 1LBEA 1LLUA 3GPIA 2PY6A 2JFGA 3Q11A 3JCZA 4TMFA 3DB2A 3DBLA 4XQGA 4XB1A 1EFLA 4URFA 1XG5A 4RZHA 1KEVA 4MVJM 2QZZA 3DHNA 1HF3A 4F46A 4TRNA 4Q39A 3OJOA 5DBGA 1K5HA 4W7IA 3C7AA 3W6ZA 4IIUA 1WMAA 1NVGA 3GAFA 2OBYA 3OIDA 3OECA 4HWKA 3E5MA 2JD0A 4YWJA 1QMGA 3L4BC 2Q2QA 3PQFA 3OHSX 2ZYAA 3F5QA 2ZK7A 1GZ4A 3EYWA 1RKXA 3QWAA 1PTJA 4B7UA 1JKFA 4YEDA 1J5PA 2A9FA 1UZMA 1T2CA 3RC2A 2HQ1A 4BNKA 1A9YA 2B5WA 2P4HX 1JQBA 4KWIA 3U09A 1EUDA 1NFRA 1GZ6A 5I7SA 2X22A 3V2UA 1AXEA 3K2BA 4HNGA 5L9AA 1ISMA 2E4AA 3SVTA 1HZZA 1NQ5A 4AJKA 1NQOA 3AK4A 1D1TA 3UH1A 2IODA 3L9XA 4CQMD 2AA3A 4GPD1 1I36A 1GU7A 1B26A 1N9GA 3M6IA 4WLOA 3GAZA 4CV2A 1CEQA 4GX2A 4L73A 5TF4A 3E1KA 3MJEA 4QO8A 5HRUA 3RKUA 3O8QB 3PHGA 5HBRA 4CM4B 2CDCA 3IQDB 5K0ZA 4MVJI 3JQ7B 2Q1SA 4UVIA 5TX7A 4ALKA 2CF6A 1W8DA 4U0JA 5L7TA 2GN4A 5JCXA 4P4NA 3ZWMA 1AE1A 4CUZA 5IFLA 1EVZA 1WVGA 2D5CA 3DXFA 2D0IA 4A10A 4FW8A 4WOKA 3U4CA 1M67A 3HWRA 4FFLA 1R37A 1LQTA 4YJFB 4MKXA 3GEGA 4O59O 4WCDA 1T4DA 1U9JA 2QYTA 2QZ9A 4PVCA 1KS9A 5DN9A 2PKQO 3E5RA 3PRJA 4OO3A 3WFIA 3WR5A 1YL6A 3EUWA 4UVHA 1SMKA 2DBRA 4E12A 4EZBA 2WD7A 1FDVA 2BF7A 4IDFA 1LDMA 4K1LA 3TOZA 1VSUA 2EJVA 3H2SA 1VL0A 5TLSA 3U3XA 1NPYA 1ONPA 5T6BA 4DIOA 5TJ9A 5IZCA 5KIAA 4AJEA 1K89A 4AJOA 2BLLA 2FP4A 5ENDA 1J0XO 1UDCA 1ZNQO 4YRBA 1SAYA 5CDGA 2ZYGA 2I66A 4ESOA 2FRDA 3WS7A 4YAJA 4XIYA 4JP2A 1GAEO 5AXAA 2WE7A 1ADBA 1PS9A 4IJVA 1VE9A 3JQ7A 2JHGA 1TEHA 4ALMA 2C7GA 5CDSA 3OJFA 1WLYA 4R69A 1YQDA 5EINA 4R54A 1WDLA 4HV4A 5HWSA 1DIHA 4RDHA 1T1SA 1K6IA 1V3UA 3A28A 3BMQB 5A03A 1RM5A 4CQLB 4F6CA 3N58A 2GLXA 5HS6A 4J43A 2V65A 4YJGA 2P5UA 3DQPA 4YAIA 2CMDA 4LRSB 4L9RA 3ZWOA 3TL3A 2QRLA 3VH1A 1UP4A 1PR3A 4OH1A 1HXHA 3WTBA 2J3JA 3NEPX 4M54A 3ENNA 1VI2A 4BMNA 2HK8A 2EXXA 3KHUA 3ROKA 4JNKA 3QWFA 1UXGA 3BMCA 1BTOA 2W90A 1P33A 2V6FA 3A1NA 3QWHA 1DAOA 3GFGA 1HDXA 1QYXA 3RUAA 4YRAA 1GEGA 3KYCB 1A5ZA 3LT0A 1T2AA 4HBGA 4KQWA 5U1PA 3WSVA 5B4TA 3RBXA 4II3A 4RQUA 4K26A 3ZV6A 3QIVA 3FSRA 3Q9NA 3PGXA 1XLTA 3K31A 4J91A 5K6AC 1EK6A 2QIOA 3GVPA 1PJ2A 4J7CA 4JXKA 1YB4A 3DAPA 1UZLA 1C1DA 3AM3A 5KVVA 5DOVA 4FFMA 1VSVA 2AQKA 3CMCO 1VLLA 3NUGA 1NWCA 3BTSA 1YBMA 5KKCA 3WYEA 3H9QA 1Y8RB 4OM8A 1S7CA 1WP4A 5CG2A 3DOOA 1M6WA 2OGUA 3UCFA 4RPJA 3PFFA 4R9RA 5GZ1A 4R68A 4DYVA 4IJUA 3RC7A 1R16A 1Z7BA 1MV8A 2GSDA 4NBVA 4II2A 1KIFA 2D3TA 4RZIA 1DAPA 2PNFA 4O6VA 3O38A 4XGIA 4YB8A 3O03A 2X0NA 1IUKA 1DC5A 4IXWA 2SCUA 1R4NA 4LCEA 4QTZA 4R3NA 3SX2A 4ALNA 2BKAA 5TT0A 2VOEA 5BT9A 1ZFNA 3OFSA 2EERA 1WZEA 2DUWA 4BO6A 1MFPA 1MC4A 3ONFA 3E82A 3WXBA 4OHUA 2B69A 3BAZA 4DLBA 3MJTA 4KDFA 4P4GA 2X7HA 5GMOA 5JYDA 2OZPA 3NT4A 3GGPA 2E49A 2FSVA 2O4CA 5JC1A 3PQEA 1EDOA 5U9CA 4IM7A 1YRLA 4KTTE 4N7RA 1PR9A 2WMDA 3STHA 4XX0A 1M66A 4XD2A 4XQ9A 1ZIDA 4GVXA 4DGSA 2Y68A 1MXHA 4BGEA 3ZU3A 4E32A 3KO8A 3MWEB 5G4LA 4EJ6A 4HP8A 4J49A 2CNBA 4Q3DA 3FHLA 1Z7EA 3NX4A 3PIIA 3JYNA 5TGDA 1KEWA 3WOHA 3IJRA 5JYEA 1YB1A 3ITDA 1M6HA 4TZTA 4Z0TA 1HLDA 3VPHA 4U7WA 3QE3A 4YBZA 4E21A 3GMSA 4LCJA 2GYYA 5DBIA 3ADOA 4TWRA 4DQUA 4J4HA 4DYDA 4XQEA 3GH3A 3JQAA 2IEBA 1R4NB 2DC1A 3K8ZA 1CYDA 1PJQA 2DM6A 4IDCA 1E7RA 2P9GA 4NK4A 5COAA 1XU9A 1ZK2A 1Y5RA 1I0ZA 4KP7A 1VKNA 3OICA 3WQSB 4WCFC 2EW8A 3C24A 5I9NA 2AQIA 2ZQYA 4A5OA 5C7IO 3AW9A 1E1MA 1GQYA 5T67A 3I6IA 4L75A 4FD3A 4NHEA 1P1IA 3IDSA 1E7QA 5AXBA 1ISJA 1UDAA 1PQPA 2JCXA 4BNNA 4BNLA 4UUMA 1H94A 1I10A 2WEKA 3GNQA 3Q2KA 2Y1GA 5I9MA 1Q0HA 3WB9A 4FOSA 3T4EA 4A27A 4ALIA 1HDCA 1OAAA 3ZGYA 3AM5A 3ZN2A 1AUPA 4E13A 4WLEA 3UKOA 2D4AA 4UVEA 4DBZA 5F1PA 1LQUA 3UGKA 2DBVO 3WFJA 5DCWA 3DMYA 2UUOA 1SOWA 3ZU5A 4B4UA 2HO5A 4B7CA 2FWMX 3EC7A 1ZZEA 2FPPA 2PA3A 4BNHA 1DHRA 2TMGA 2HJSA 3VAZA 2XXJA 4ITUA 2VQ3A 4WLFA 3JQAB 2AG8A 3VOSA 5I7FA 3JQCA 2EJWA 2E48A 1SPXA 2JHFA 2Y66A 2HMSA 2VZ8A 2E37A 1Z6ZA 4Z9FA 4OSPA 1HYEA 3ONDA 2AQHA 4XYEA 1ADGA 3AY7A 1Y9AA 1PJLA 2YQ4A 1E7WA 3VVBA 5JO0A 2Q99A 2OP0A 3DZGA 1LEHA 2F1KA 4NJOA 2I3GA 2VYVA 5I8ZA 4WCFB 5C3MA 1KBZA 5ITWA 4TVOA 2WYUA 1Q2XA 4Z9XA 1GADO 2Q2VA 4IDGA 4NU6A 1I3LA 1A4UA 4DA9A 4QQRA 1ISHA 3I9OA 1JLLA 3S55A 5BNFA 2YFHA 1Q7CA 5F1KA 2Y0EA 1NPTO 1XCBA 5JSFA 5BSGA 3ZHXA 4I8XA 1VM6A 2ZQZA 3OIGA 2EKLA 5L4SA 5JDCA 3AU9A 4J90A 1D4FA 3GDFA 1P0CA 1DHTA 2J5RA 3DOCA 3HFSA 4BNFA 5IG2A 2EP7A 4ILKA 1HLPA 1LXCA 1ZH8A 3RFXA 4RVUA 4BUCA 4GI2A 4YTEA 3ZU4A 5JO9A 1ONOA 1FMCA 3NJ4A 4FDAA 3U5TA 2EF1A 3AOEA 4HFJA 3AI3A 2WD8A 1K0UA 3TF5A 1P1KA 5KKAA 1KC3A 4BL5A 3AFMA 3NJ8A 3WGZA 2WE8A 4BO1A 4HUJA 4CODB 3FBTA 1QYVA 4P22A 4Y6SA 1PGPA 5A1TA 2NQ8A 2X0RA 1XIVA 3RBVA 5JDIA 4YJDA 2PGJA 1ZKMA 2X23A 2J8ZA 3PGJA 1ORRA 1PZFA 4NZ9A 2AG5A 4A0SA 4B4WA 3WGOA 6LDHA 3AY3A 3H7AA 4Q9NA 4YDRA 1HYHA 3H2ZA 4M86A 1RM3A 4GAEA 3D3WB 3CEAA 1H93A 5FF9A 3MZ0A 3AOEC 2CY0A 3M1LA 4RF3A 5I8WA 3NGLA 4XR9A 3DR3A 2H9IA 2X6TA 5TS3A 2PD3A 2RH8A 1H6DA 1HE3A 3IC5A 1ENZA 5JNLA 3BA1A 3A9WA 3ORFA 2NTJA 4OQZA 2DTEA 1NVMB 2C54A 5EIOA 1KEUA 1PJCA 1DRUA 3OH8A 3NTRA 3PJDA 2Y1DA 4EITA 4ZQBA 4PLPA 3FPCA 1D1SA 4I5GA 1A7KA 5IZCC 1PGJA 3ABIA 3KUXA 4GWGA 2NU6A 1ISGA 3S2IA 1LDYA 3HE3A 1Q7GA 2GR9A 3OJLA 3U4IA 4LN1A 2O50A 5FI3A 4E0BA 3TZCA 1V6AA 2NQTA 2IXAA 4WKGA 4YJHB 1MC5A 1PJ4A 2Y0DA 1E3EA 1LC0A 4L76A 3M2PA 3O26A 4CR7A 3RC9A 1N1GA 3ST7A 2FMUA 2GN6A 4BNXA 3RU9A 2X5JO 5JY1A 2NU8A 5IDYA 3QVXA 3FD8A 1A71A 3GGOA 4IGEA 3F47A 3V2HA 3WLEA 5C7LO 2ZIZA 4FCCA 3FNHA 4DREA 3JYPA 3IIEA 3NRCA 1FJHA 1U8XX 3PJEA 3W8DA 5TQVA 2D1YA 4GKVA 3JQAD 4W9NA 5DOZA 2VZ0A 3SJ7A 4BOYA 2EEZA 1DSSG 4KWHA 1ISIA 2DVMA 2GF2A 1DLJA 3F3SA 2X5OA 2ZB7A 1E1KA 4E31A 4PLZA 1EZ4A 1Y6JA 2PZLA 3G1UA 2IEDA 5L4NA 2GERA 2VWPA 5AOVA 1X7HA 4CLEA 1YWGO 3HUDA 3DO5A 4I1IA 4FJ2A 3RASA 5THKA 3LF1A 3T7EA 1LDGA 1AGNA 2GZ3A 4A03A 4Q3EA 4AJJA 3ZDFA 4MVJA 1LSOA 4OSOA 4D44A 3OSUA 5ENVA 1HETA 4GGOA 4RDIA 4U0KA 1IPEA 3TZ6A 1GCOA 4B3HA 4OOEA 1U2DA 2VUSA 3ZW8A 4GBJA 4E5KA 2WJPA 1T1RA 3ZNNA 1FDWA 4D0RA 2VN8A 5A06A 5IAAA 3L4BA 4R1UA 4RF4A 2NVUB 4IMPA 1LC3A 1KETA 1BDBA 2XAAA 1TA4A 1RWBA 3B20A 2WSBA 3ZWBA 1V35A 1E1NA 1R66A 1PJ3A 3GZ4A 4IPTA 4MVJH 1P0FA 5JXWA 1BVUA 3DBHA 2Q1TA 3D5QA 4LSMA 4HNHA 4RF5A 3PHHA 1QRRA 2WYWA 3KXDA 2YV1A 5B1YA 2GGSA 1WPQA 4CV0A 4WEQA 3KTDA 3ZU2A 1ZSYA 4OKIA 1HRDA 2IDZA 4MKZA 3ANNA 3VZQA 4CM7A 5G0TA 2VT2A 5EN4A 1RJWA 4UEJA 1I3KA 1E3IA 1NBOA 1DIGA 3JYQA 4WJZA 3VH3A 1NR1A 2XOXA 5KJ6A 3RUDA 9LDTA 4ZU3A 4XKJA 4GGPA 2QRKA 5DF1A 4EEZA 1PWXA 4ZRNA 5F5NA 2EW2A 4OXYA 3WX0A 5JAMA 3ROPA 3TL2A 4RGBA 3MOGA 2YZ7A 4WLNA 4N5LA 3GHHA 3LT1A 1ZO8A 2NU7A 3P2OA 4RVHA 4RL6A 1VKOA 1N9GB 1HSOA 4WPGA 9LDBA 2O7QA 2Y93A 4YQYA 1PGNA 3UICA 3AFNA 3D1LA 2PV7A 1RYEA 2C0CA 3JQFA 3IUSA 2V6GA 1MB4A 2C2XA 3KSDO 1T2EA 3C7DB 3SJUA 3ANLA 3KB6A 4UAGA 2QRJA 3AI2A 4NFYA 4QUKA 2VHVA 4ID9A 3FWZA 5LC1A 1EVJA 3W4IA 1SNYA 3INRA 1P31A 1E5LA 2J5KA 2VYND 3KV3O 1EE2A 1RM4A 4XYBA 3DHEA 1QYDA 4INAA 2I6TA 4PZEA 1CDOA 3R3JA 1X7DA 4YJFA 1N7HA 4NI5A 1XELA 3LYLA 1P1FA 1JKIA 4I9HA 1VL8A 1ZBQA 1GYRA 1NXQA 3F1LA 5CG1A 3BTVA 3H65A 5CDUA 5GY7A 3VZSA 1NASA 1KVTA 3GN2A 1GCUA 4BB6A 4BV8A 3FF4A 1ZK1A 4PLWA 1ZCJA 3TWOA 2B36A 3DBRB 3DZHA 3K96A 3OJ0A 1OFGA 1NAIA 4P4LA 1PSDA 4J1NA 4E30A 3PPIA 3JYOA 3BHJA 2HU2A 2IE0A 4BQRA 2XPCA 2RCYA 4CV3A 4YT2A 2G5CA 3VHRA 3AUUA 1O5IA 2QYSA 4HX5A 1CJCA 3QVOA 3E18A 4KUGA 1MLDA 2QW8A 5ER9A 1QORA 5IXYA 1UAYA 2I5PO 2ZTUA 3RSHA 4B3IA 3G3EA 4QO7A 4J7XA 1PJTA 1GZ3A 3OF2A 4WLVA 4BMVA 3GZNB 1E6UA 1U5AA 4YJGB 4J1TA 3VVCA 2P2SA 1EVIA 1G6KA 4XRGA 3GRKA 1A4IA 1B2LA 3PXXA 4H3VA 1GV1A 1OZAA 3LZ6A 4PVDA 3NDRA 1V8BA 1QYCA 4E33A 1YDWA 2EKPA 3E03A 5LDGA 4CMEA 1QG6A 1M2WA 5A9RA 3U4DA 5HTOA 2AMFA 3OIFA 4DL9A 2Q4BA 3LC1O 2VOJA 3ITKA 3PDUA 3BZUA 3DBRA 3CMMA 2O3JA 1ARZA 4R01A 2ZKLA 1QXSA 3INTA 1K6JA 3KYCA 5AXCA 2HDHA 1ZEJA 1YOVA 2W4QA 1X7GA 3AOGA 5CEJA 4MP3A 3LQFA 2VNAA 1YB5A 2O3TA 3QP9A 5EESA 1U5CA 2IZ1A 4ND1A 5KJEA 3QLJA 4U6QA 2VHWA 2DBZA 1DBVO 2O3SA 5H81A 4XWYA 1B16A 3DMTA 2EHDA 5MGBA 4AJ2A 1ZW1A 5FI5A 1U3WA 5H83A 1B0AA 5AVOA 4BNWA 1C1DB 2PZKA 1PZHA 4FGWA 1T2FA 4BV9A 1FF9A 2DKNA 4NBTA 4K28A 4WNCA 2BGLA 3AWDA 5JCJA 3GVXA 1ZK0A 5G2OA 3LU1A 3JQBC 3ETEA 3VPXA 2HRZA 4BNGA 5KJFA 4J1SA 5L45A 2VHZA 1DC6A 4WUVA 2IXBA 1DFGA 2Q46A 5L95A 1AHIA 2Y99A 1UXHA 4J9UE 1QKIA 2PTGA 1DO8A 3ZV4A 1YBAA 4HXYA 1XHLA 5DP1A 3GPDG 3K92A 3ROQA 2C5EA 2HCTA 2QQ5A 3MJCA 4XA8A 4E2WA 3GGGA 4MVJE 3BHIA 4BKOA 3UFXA 4PLTA 3LDHA 2BELA 3S2FA 2VUUA 4DC0A 3CUKA 2AEFA 4CR6A 5JE8A 4EUFA 4G5HA 4XRRA 1ZMOA 2J5QA 1OI7A 5EMHA 3N74A 3K30A 3WQQA 4KQXA 2RBEA 4I08A 4HFMA 5A5EA 3ZZNA 2B4QA 2O2SA 4E5NA 4CM3A 1I2CA 4IMRA 4LK3A 5F1OA 5FFFA 2ZJ0A 3RJ5A 1O0SA 3NT5A 2YYYA 3H4VA 3G79A 3UF0A 5B4UA 1SZJG 2C07A 1LNQA 4BKQA 3EDMA 2Z1NA 3HZZA 3V2GA 2QX7A 6ADHA 3VTFA 5I7EA 1DC3A 3QV1A 2Z95A 1Q1NA 1XA0A 4MIOA 3DZKA 4L4SA 4FR5A 5L51A 4OIMA 2B4TO 1HE2A 3JD4A 3L77A 3PI7A 4PG6A 4BNTA 1T26A 2P91A 1BDMA 1F06A 2W98A 2JFFA 2H5LA 1NTOA 1B15A 5ITVA 3UW3A 2C5AA 3BTUA 1U2GA 5DZSA 3V8BA 3GA0A 1IE3A 1NAHA 4BS9A 3ADPA 4OKNA 1T24A 4YT8A 1LLQA 1HDGO 2HAEA 2NU9A 4GMFA 3KEOA 1F17A 4HKTA 5DP2A 4B4OA 2YHUA 4YA6A 2EP5A 4TRMA 4QX6A 3OEYA 1H0KA 3IKVA 1OOEA 3WLFA 2IZ0A 1UDBA 3EK2A 3RUIA 5L53A 4CM8A 3QWIA 3ASUA 2PD6A 3T7CA 2Y67A 2CDAA 3ICPA 4UVGA 4MOWA 3PWZA 2NWQA 4MP8A 4DLLA 4LMRA 5B12A 4RLSA 3TOXA 1HDOA 4XJTA 4JIGA 5L7WA 1KERA 3K6JA 5B37A 3K5PA 1IY8A 2AXQA 7MDHA 3NTQA 1DXYA 2GD1O 1K2WA 5G4KA 4RQTA 3WBBA 3IAHA 2HSDA 3HB5X 4XQCA 2X8LA 2J3KA 5CDTA 3ZV3A 3LSYA 5JLAA 3I4FA 4AJHA 4O63O 1UH5A 5FWNA 5LCXA 3VC7A 1X13A 4ZRMA 3IOYA 2BFAA 3WIDA 3E8XA 1F0YA 5EJ2A 2W2LA 3SC6A 4DXHA 4RLHA 4L4XA 4CM9A 5JC8A 1E3WB 3PJGA 2UAGA 1SEVA 4ROSA 4U6SA 1NQAO 2CVZA 5DCUA 2H1SA 3ZWVA 4EBFA 2FY8A 3GK3A 1OMOA 5IN5A 1HDZA 2DTDA 1X1EA 4ZQFA 4H7PA 1NVTA 1QSGA 1UP6A 3EMKA 3WIEA 1P1JA 4CM8B 3G1TA 5A9TA 3WGIA 2OMEA 4WCFA 3C85A 3AU8A 3OMLA 2X9VA 3VZPA 3WICA 3WWYA 1BWSA 1X1TA 3OM9A 4JBIA 4IDAA 4DBVO 5EERA 3UOGA 1C1XA 1CWUA 3NAQA 4ALLA 2FR8A 3LC2O 1PJSA 1GUYA 5A9SA 1GDHA 3LF2A 3TSCA 1Y81A 4PIVA 1LRKA 4CMEC 3QRWA 1FXSA 3HDQA 2O3QA 1MUUA 3I6QA 1BRMA 1MA0A 1UP7A 4BNVA 4B79A 4TQGA 1J6UA 1UXIA 3WJ7A 1V0JA 1E92A 3CXRA 3M1AA 4JP3A 1DEHA 2CVOA 3JQ8B 1ZSNA 4FFNA 4BO8A 5A5FA 3PDJA 4GMGA 4P38A 4Q3AA 4CMKA 2F00A 2POQX 4CUJA 3VDQA 5EQFA 1Y5MA 2A94A 4D3SA 4H15A 3H9UA 4ALJA 2GO1A 1U3UA 4BO2A 1MX3A 1SBYA 1CQIA 3JTMA 1QV6A 3CZMA 3I1JA 5ADHA 4K6CA 3PLRA 4AICA 2Z5LA 3DTTA 3ZW9A 1HSZA 3U62A 3E9NA 1C1XB 5CDYA 3QQPA 1I2ZA 2X1HA 1NWHA 2ZJ1A 3PYXA 1XKQA 4PG4A 4XZ3A 1KOLA 4DPMA 2HMWA 4YCAA 3OP4A 4IQ8A 3DWFA 1CRWG 2NNLD 2EIHA 3D3WA 5F3RA 4NU5A 5T8KA 2VYVD 4MIYA 3ZHBA 2EWMA 5H82A 2A4KA 5KVQA 1ID1A 4K6FA 1M76A 1Z73A 4PRKA 1X0VA 4LVCA 1PU2A 1P3DA 3L4SO 1FDTA 1HDYA 1R0KA 2FZWA 5CPFA 3PJFA 2YDYA 2D59A 4Q3NA 3OA0A 1DC4A 5HA5A 3RKRA 1YE3A 4CL3A 1AXGA 1XEAA 4YACA 1I2BA 4BKUA 1BVRA 3H5RA 2PKRA 1PL6A 3WGGA 4A26A 3ROMA 1YQGA 2XF8A 4GX1A 2NACA 2X4GA 5KCZA 3QVTA 1DIAA 1GPDG 1YS4A 2UUPA 2VWQA 5JDCC 5JMPA 4XYLA 4YJHA 3OA2A 3AM4A 5TNXA 3HN2A 1U8FO 2I99A 3WNVA 4J1QA 4LISA 1WAMA 4IJKA 2BI8A 2E6UX 4M49A 4ZN6A 3A14A 1EQ2A 4PZDA 1VJ0A 3SLKA 2GUGA 4G81A 1ZXLA 4J9VA 2VWHA 3C1OA 3GFBA 3L6EA 3ZWNA 3RJ9A 5BNTA 1R4MA 2O3UA 2Q1UA 2PWZA 1I5RA 3D3EA 3B1JA 3I9KA 4M1QA 5F5LA 1PS0A 5BSHA 4IUYA 4I9UA 2GN9A 5DULA 3KBOA 4CQMA 3ANMA 4RVFA 1MXFA 4TKMA 1EQUA 4UUOA 1EUCA 3CE6A 7ADHA 1A9ZA 3EW7A 1GL3A 3LT4A 1XGKA 4NK5A 3TN7A 3OQ1A 4XYMA 3BIOA 3CINA 5EQDA 4JLWA 3WDSA 1XR3A 4QECA 4R1NA 2V6MA 3RCBA 2Y0CA 5L7YA 1GUFA 3E9MA 3UCXA 3GNSA 3KLPX 1HT0A 5L3ZA 2DFVA 4DRYA 1ZK4A 4EEXA 1R0LA 4J4BA 2B37A 1H5QA 3G49A 4W9NC 3ZWXA 3IL2A 3EVNA 1MFZA 4D79A 3WGQA 4AVYA 4RORA 3K73O 4JJFA 5JDIC 2BD0A 1PX0A 3LLSA 3I9NA 4OQYA 2PR2A 3KEQA 4OXKA 4RCVA 4RF2A 3RBZA 3LC7O 5TRTA 4AJPA 4UUPA 3WWZA 4FC7A 1V3TA 4L4RA 2GPTA 5TJHA 2PH5A 1PZEA 3DBHB 2VZ9A 2UVDA 4R1SA 1E3LA 3KRTA 3D4PA 4CMIA 2X86A 2YDXA 3GVIA 3TRIA 1O94A 4RVGA 3PLNA 3T4XA 4AJLA 1O89A 1YO6A 1CF2O 1EFKA 1PGOA 3ASVA 4D3FA 4OL9A 4AJ4A 5ILGA 4XCVA 1U28A 4JJIA 3E48A 5IDQA 1DIRA 2Y05A 2PGLA 2X58A 3QW2A 4EUEA 3ONEA 2GDZA 3WNQA 1NNUA 1HE5A 4UEOA 3ZV5A 3I9LA 1C3VA 3FI9A 3GEMA 3W8FA 2YV3A 2HMTA 1O9BA 4GVLA 4DTIA 3FTPA 3RAJA 3I9MA 2X9GA 4GLOA 2DQ4A 5K6AA 1DB3A 4E2XA 5A3JA 1W6UA 3HFGA 3MOIA 1VL6A 1E7YA 2P68A 4NFSA 1HYGA 2B4RO 4F45A 4YAGA 1YBVA 2GZ2A 4JBHA 4J0EA 1NYTA 1E7SA 4FFOA 3IP1A 4DQVA 4J0FA 2Q3EA 3LK7A 3MTGA 4IXTA 4DIFA 1NP3A 2ZATA 5AXDA 3RFTA 3CKYA 1VC2A 4BMSA 4BGIA 4CMIB 1EVYA 1QP8A 2DUUA 2C7VA 2NVWA 4N5NA 1DFIA 4ND2A 1F12A 4DPKA 1GYQA 2GRAA 1VJTA 4B7XA 4PLCA 2FOIA 5BQFA 2OHXA 3MJ4A 1T4BA 1K3TA 4XEHA 1JVSA 1E7MA 1BXGB 3DL2A 3JQ6A 2FHSA 1VPDA 3BYZA 5JPIA 1QLHA 2CUKA 1B7GO 3E9QA 1QYWA 3ZHZA 1UAGA 1A72A 3F4LA 2H63A 4GSKA 3FR7A 4MJLA 2NSDA 2EGHA 4XIJA 1HZJA 4IJWA 3KZVA 1J49A 1W73A 3RIHA 4ZVVA 2O23A 3DEYX 4YR9A 4C7JA 3JD3A 3ZWAA 1SCUA 5CEEA 1S6YA 1RPNA 2BRUA 1MG5A 3ENKA 4KMSA 1G0NA 2NLOA 3R3SA 4IGFA 4QXMA 5KWEA 3U49A 2ZB4A 4R3WA 1QR6A 4DQXA 5KNLA 4TRRA 4XB2A 4R5MA 3VPFA 3PHLA 5DCYA 2PFGA 2DTXA 4E5MA 3Q6IA 1Z82A 4J16A 2BFPA 1R0SA 2OXIA 3H9GA 4BNUA 4TZKA 1P1RA 1ZEMA 5JMWA 3P7MA 1ULUA 5G0WA 3HJAA 2FN7A 3ETDA 3ZWWA 3KSZO 1I3MA 4IZIA 1GPJA 5C7OO 3AY6A 1ZUD1 4O1MA 1WZIA 2FSSA 4MKRA 1GYPA 2A35A 1JDJA 3OETA 3H9EO 3GZNA 3PP8A 1WDKA 4YXFA 3EY4A 1YJQA 1XYGA 3RQSA 4GQAA 1P77A 5IZ4A 4C7KA 3HNPA 4GX0A 3TNLA 1ULSA 1WDMA 2YFQA 1KY4A 4CMCA 3SXPA 1LUAA 1E0DA 1U3TA 3D0OA 3DC2A 4D0SA 3DAGA 2HKIA 3LT2A 3VDRA 4DUPA 1E6WA 2PGDA 4UULA 5JBIA 4O0LA 4Z6KA 5BSFA 1H9AA 5JAQA 2LDXA 1YOVB 1UUFA 1BXZA 3RI3A 1YVEI 4QFCA 4D46A 5HM8A 2VTEA 1ZK3A 1EE9A 1NQTA 4L0QA 2V6BA 3PFWO 3WGTA 3WYBA 4U8GA 4PLYA 4E2ZA 1GQQA 1K6XA 5IXSA 4G2NA 3BMOB 3ZNQA 4ND5A 3SLGA 5MDHA 2PZMA 4FIZA 4IINA 4BNIA 3PWSA 3S1LA 2OOSA 4CUKA 3GG2A 2JJYA 2O7SA 4ND4A 1UJMA 2ZTVA 1ENYA 2VT3A 1GEEA 2EG9A 2GZ1A 2WYVA 1NR7A 4B8ZA 4FN4A 1Q0QA 1YH3A 3BMNA 4CLXA 4IIVA 4KZPA 3F1KA 4BGUA 4BKRA 3DZJA 3WTCA 5CFZA 3QHAA 4ND3A 4EYEA 4JK3A 4YT4A 3QJ5A 3Q3CA 3ETGA 3PZBA 2VRBA 1L7DA 2ZCUA 5AYVA 2NUAA 3HADA 4J2OA 3HN7A 3ZWPA 2VRCD 4NBRA 3C3XA 1HKUA 2B83A 1XWFA 2DPHA 3KYDB 3OBBA 3DZIA 4YQZA 1F14A 4HFRA 1PZGA 4G65A 1E1LA 4OAQA 4LVUA 1PS8A 3FN4A 1B8UA 2FPIA 1IHYA 4JGBA 3MJVA 3MCVA 3JSAA 2UDPA 2DT5A 4RO0A 2X9NA 1T2DA 3BMOA 1ENPA 4CMAA 3I23A 4JJGA 3HDJA 3X2EA 1U1IA 1I24A 5G0VA 4FC6A 1LU9A 1LDNA 4TROA 3KOUA 2B35A 2C29D 4CR8A 4D43A 2YW9A 1LRLA 3S8MA 1H2HA 5CEFA 4FSHA 4UREA 1NM5A 3B1FA 4X54A 3GC6A 3O9ZA 1P74A 5IN4A 1YGYA 3HDHA 5JAZA 2B5VA 2JD2A 4B3JA 3MEQA 1ENOA 4CM5A 1DJQA 4EI2A 3CZRA 1BG6A 1HTBA 1J4AA 3I9JA 3QWBA 4NBUA 4WEOA 3C1AA 5TC4A 3B6ZA 5DNAA 5JW6A 2NVBA 4WLUA 4MVJF 2Y1OA 1TT5A 1NHGA 2OP1A 1UXKA 5JY6A 4NNJA 4YVFA 4NR0A 2PKQP 1L7EA 3W4JA 3QA9A 1ZXBA 1ML3A 3FBGA 3DZFA 3QVSA 3KYDA 5A3VA 4E6PA 1VJ1A 1BW9B 2YQ5A 2AHRA 1R6DA 4PLFA 4RPGA 3FCOA 1PEDA 1HWYA 2O4UX 2B0JA 4WASA 4M55A 4Q3BA 3VKVA 4NQZA 3R0IA 4JX8A 4PFJA 3AUAA 3ZNPA 3UCEA 2BHLA 2ZTMA 1NPDA 2GASA 3Q9UA 1HEUA 1JU9A 4IDBA 3F4BA 5EPOA 4LW8A 4YRDA 3O4RA 2QG4A 1B8PA 1C0PA 4DLAA 1KEPA 1EEHA 1LDBA 1P44A 2OUIA 3JD2A 1ADCA 4OJNA 4IBOA 5T57A 4A7PA 3KETA 1U4OA 3I3OA 4D42A 1OC4A 1WNTA 4NJMB 5G4KB 3S2EA 4EGFA 1XSEA 1GD1O 4BB5A 1YXMA 4BO4A 1TT5B 3DBLB 1LA2A 4D7AA 1ZMTA 1TB4A 3HG7A 4CLOB 4NIMA 4B4VA 1D3AA 3IMFA 3GVCA 4W4TA 1JAXA 2G82A 2IRWA 3DZBA 3TQHA 4CLHA 3SEFA 3IJPA 5JCJD 2I9PA 4YYZA 1E3WA 2CFCA 4UVDA 3I52A 2Y1CA 4IS3A 3L0DA 2RHRA 1SB9A 4NFHA 3GNTA 4NPCA 5BNIA 2UV8A 2DBQA 1R15A 3G0OA 3W1VA 1JW9B 3UVEA 2BH9A 1OBFO 3GHYA 4AL4A 4CJXA 1LSJA 4J6FA 3DMTC 2TMDA 3H3JA 1ZVMA 1SEPA 4AJIA 5A9SB 1A27A 1SC6A 1C0IA 3GDOA 4E2YA 1NFQA 3GRPA 3IS3A 3OQBA 5COQA 4RPLA 3VH2A 1SO8A 4W6ZA 2VTDA 4IDEA 1JKJA 3R6DA 1LTHR 1M75A 5L40A 3KYBA 1B8VA 2HMUA 2UYYA 1I32A 1JTVA 1PJBA 2JAPA 2FPGA 4YT5A 5ES3A 4U5QA 3IP3A 1X15A 2BMAA 4QT0A 3WMWA 4A73A 5TT1A 1PIWA 4CLOA 3O8QA 1DFHA 3JQ8A 4CPDA 1IPFA 2J3HA 4CM4A 3TZHA 1YDEA 2LDBA 3AI1A 4RV9A 3GUYA 1MG0A 2AEJA 3A4VA 4YAKA 3GN1A 4R16A 5GZ6A 3W4KA 4E5YA 4R9SA 2RIRA 3RD5A 1I30A 4E5PA 4D45A 3FNFA 2BFMA 5CP8A 4CMHA 4OXNA 4WOJA 4WGGA 5KJCA 4A2CA 4MPDA 1TT7A 3DBVO 3C7CB 4EUHA 1BGVA 2X5KO 3CIFA 3ON5A 4MIEA 1IHXA 2R6JA 2CD9A 3D64A 4L8VA 2JAHA 2JCYA 3WG9A 3FNGA 1NHWA 2WD7B 1WWKA 4S3MA 1E3SA 4Y9DA 2VHYA 5TSDA 4Z0PA 4FPXA 3OJEA 3DFZA 3KM0A 4MINA 1X0XA 1B14A 3MJSA 4DVJA 1BHSA 2CSUA 5J23A 1U4SA 1GQ2A 3RWBA 4FFPA 1IYZA 2P9CA 3NDIA 5KVCA 3X2FA 2NTNA 4OYRA 5BSEA 3UN1A 1G0OA 4N5MA 2VNSA 3U0BA 1FDSA 1KVSA 2EKQA 3INGA 1C14A 5JFOA 2RHCA 3JQEA 1YJ8A 2C59A 8ADHA 2Q49A 3WGYA 1SB8A 4NMHA 1E3JA 2HK9A 3TFOA 2QHXA 1DPGA 3BMQA 3IUPA 1E6EA 3F46A 4MVJG 3ZCXA 4CMGA 1ISFA 4WECA 3Q0EA 4CQLA 3P2YA 4NH4A 2YUTA 3WBFA 2DFDA 4N18A 4JN6B 1N2SA 2E82A 4FOOA 5IJZA 4OOFA 2YHIB 2W2KB 1EBFA 2HK7A 2VHXA 2Y1EA 3BXXA 4BNYA 3B1KA 1LLDA 3RUFA 3BTOA 2H6EA 1GUZA 3EHEA 4OGWA 1HL3A 3AJRA 3QY9A 4BIIA 3KVOA 4KTVE 3CSDA 1ZJYA 5CPBA 4Z0HO 2WM3A 3JD1A 5BR7A 3BMCB 2G76A 5HS4A 4RPKA 3U9LA 5DBFA 4F3YA 3IKTA 1LJ8A 4EW6A 4P8RA 1JVBA 4H16A 5IDWA 4FJ1A 1BSVA 3P19A 3GQVA 4CL8A 1R4MB 4M89A 4IDDA 1Q7BA 4IQGA 2IYPA 5B4VA 3E6AA 5C5IA 4PGFA 3VPGA 2JKVA 3LVFO 3H3FA 1YL5A 2CVQA 1U3VA 4GL4A 4CQMB 5CAEA 1KVRA 1P9LA 1EDZA 5CHEA 4MVJD 2VCYA 3OEWA 5C37A 2XXBA 4K9DA 4S1VA 4Y6RA 3W8EA 3CPSA 3JQ9C 5FEUA 3NTOA 3NYWA 3HB4X 4QEDA 3WQRA 4DIBA 4LGVA 5JAIA 5T5QA 4IY1A 2AE2A 4M8SA 1CIVA 4CLDA 2FR0A 2JCVA 4UUNA 5GZ3A 1G1AA 3K9QO 4R5HA 4PN3A 1Y8RA 2YHIA 2EGGA 2W2KA 1WMBA 3EZYA 3DONA 3DOJA 1KY5A 2NM0A 3RUCA 3PHJA 4FQ8A 2I67A 2R00A 1EK5A 3JQDA 2JL1A 1KVQA 4CM6A 2NADA 2ZYDA 2BGMA 2G1UA 3PWKA 1BMDA 3PTZA 1ONNA 4FJ0A 4R1TA 4QFDA 1FK8A 3JQ9A 2IYOA 3PYMA 4GSLA 3H6KA 4QSMA 3RROA 1N92A 4WE3A 3JV7A 1KYQA 3PYLA 3R1IA 4FGSA 1D7OA 1EMDA 4C4OA 2OFPA 1LDEA 2Q45A 4WNIA 1PGQA 4L74A 4E3ZA 2J6IA 2WTBA 3JQFC 5FYDA 1LSUA 2I65A 2R00C 4XDYA 1Z74A 3WYCA 4GH5A 1XU7A 1PQWA 5THQA 1UXJA 4Y67A 5ICSA 2D2IA 3EGOA 3FNEA 3DAFA 4ZJUA 1DRWA 1CERA 1W0CA 2G0TA 1EUZA 3GDGA 3LLVA 3F5SA 1JN0A 3OQ6A 4KUHA 4BO0A 5JS6A 4Z9YA 1X14A 3H5NA 3VZRA 2I76A 3D7LA 5KJ1A 2FR1A 1RM0A 4RVSA
chains in the Genus database with same CATH superfamily
4PG5A 5ALPA 2IHKA 10MHA 1NW8A 3E2PA 2UVPA 3RFVA 3PKZA 4PIPA 1L5GB 1W0KD 2I6UA 4OFXA 1UBJS 2XUZA 1H8EA 2C2YA 3ZWYA 1SVOA 4I7EA 5AUPB 1U0RA 4FYHA 5FP0A 5I9LA 3FHTA 3BWDD 1XRMA 4UARA 4DIMA 3BGIA 1QH0A 4DC1A 3CVXA 1AQJA 3NQ41 3EAGA 1RYFA 2ZJ6A 3LY9A 4IS2A 4OMUA 3FCCA 3MJHA 3C8MA 1C7IA 1Z5ZA 3L0YA 4L2IA 2JLVA 1IXRC 1W1IA 2PK3A 3G17A 1KR2A 3D4NA 3MLBA 4GYKA 1BE8A 5KSPA 3F9IA 3FKSD 4RY8A 1ZJJA 2Q2WA 2QSUA 3TDKA 4M8NE 2P9EA 2WKWA 4PLHA 4AF6A 3MFQA 4W82A 1THMA 1R12A 3MGBA 3QM1A 1PFWA 1TXGA 5F4BA 3EJ6A 3WDLA 4V1CA 1GSAA 5CB4F 2IPNA 3HBJA 1EJ0A 2R1TB 3RUHA 1KI9A 4ESHA 4GQBA 4AZTA 4BZPA 3Q5GA 4TRJA 3NT2A 1PKEA 5C1DA 1W49A 2AOTB 3REFA 2IYTA 4ONEA 2AFIB 3KUDA 1WW8A 2GNAA 3N3BC 3FMFA 3QXHA 4M9RA 2B0CA 1G21A 1ZYUA 1L1EA 2ETXA 1FS4A 3SBOA 3DMDA 3HSKA 4BNJA 3CRQA 1ND5A 221PA 4EB0A 2BKVA 3DVLA 3GEDA 3KAPA 4FYIA 2D62A 1Y9EA 1I4LD 1YAHA 3B7PA 3FHJA 1NRWA 3CGGA 1RQXA 2ERCA 5ESWA 3FR8A 5HCNA 3LHDA 2OXRA 3QI2A 1DDOA 1H8HA 1T4CB 1Y8QB 3E7PA 4CN8A 1OB5A 1LK7A 2FW1A 4MS3A 4HR7A 4JR0A 1RQGA 5B64A 3D7MA 1TAGA 1T0IA 2R60A 2Y1LA 3WRXC 2CL0X 4A6PA 1Y8ZA 3LSTA 5IC5A 4D26A 1RXVA 4WBNF 1LX7A 2KHZA 3HFJA 3ZI0A 3GLIE 3V1TC 4UHJA 2OESA 3HZOA 5DT9A 2AYZA 2JD1A 2LKDA 4ZD6A 4OM7A 5TY0A 2XWBF 2QRHA 2OG1A 3OEHD 2RDMA 4Q24A 1X2EA 1XJQA 3JWIA 4G89A 4PLGA 3SJBA 2CDBA 4N47A 4CM9D 5JATA 1IZ9A 5L6MB 4MUBA 1AVTA 3VTZA 4HADA 3PPVA 4QUBA 3ET5A 5KPJA 3WLAA 1NOJA 3HA5A 4V3CA 2DPMA 4M8LA 4P5DA 4YUVA 1N0HA 1RI4A 2I3AA 2YHBA 4RJ2A 1SVMA 2HA0A 3NG1A 5J4VA 3S28A 3X3HA 1AO3A 1NVUQ 1ZJZA 4I5FA 3X1MA 2AFIA 4I6JA 1E96A 4DMMA 3PHIA 4PYIA 3C70A 4P3NA 2BDUA 2CK3A 2O1WA 2O0HA 2QJWA 2WKQA 4KRGA 2AKAB 3NALA 4HQKA 4PX5A 2B2CA 4L95C 4TL8A 3OFVA 1DMRA 4MO2A 5CH8A 1J1ZA 4YGXB 5J5AA 1KRXA 2D5LA 1F8GA 2NQ2C 3DTYA 2YCBA 2AR9A 1FX0A 3SGLA 4GDMA 3MSCA 3DDNA 1CFJA 4N8EA 2W2MA 1FVHA 5KPDA 4MLCA 4GM4A 1KC1A 3RHFA 3UUWA 1KEKA 1YZVA 2ET6A 4CKYA 1U11A 1IQUA 1F8FA 4KKXB 4J3FA 5KWIA 1XF1A 2C0QA 5CLJA 2R2GA 4XVRA 3VOBA 1NX6A 3TPCA 5KNCD 3G2MA 1LBTA 3ILXA 2VJAA 3AUSA 4EJ0A 2AZDA 3Q7RA 2G1PA 3NDJA 2PL1A 1ORIA 2PANA 3FVQA 4MRAA 1R5NA 1UT8A 2H2IA 4PLVA 1FP7A 4R8RA 1KK0A 5EKUA 3UH0A 2FUCA 1WQ4A 4RFSB 1K0FA 1UEIA 1DQPA 3H9BA 2XGJA 3PTAA 4KOAA 1DTWA 1YQXA 3KLBA 1Q3KA 3SC4A 3WQBA 2O0LA 3K1TA 4YAEA 4DV4B 3WO1A 2EZ4A 1V8PA 2VPYA 3W7AA 2XCOA 4EGAA 4HEA1 1KAHA 1IN7A 1CETA 2WRZA 2ZYRA 1H2BA 3A4LA 4ZDWA 1HE4A 4ZYVA 1TYDE 1HDRA 2YIJA 3TQIA 4QVKA 4UTVA 4MI1A 3HWWA 2P5YA 5K2MA 5C5CA 4M87A 2FWIA 1XEFA 2HRQA 2JFBA 3I2JA 1KQ3A 4J4TA 4ZA2A 3GUUA 3N0XA 1D04A 4HEQA 5EHGA 4IL5A 2E9SA 1SXJD 2P77A 2NPIA 4LHEA 3RH0A 4UHHA 3H9JA 3BMNB 4NE2A 1DUVG 4N54A 3HXOA 4DADA 2RH4A 4BMZA 3JPWA 2PH3A 3ZWCA 3JQGB 4U7GA 3L6DA 8ATCA 1Q0LA 5JAUA 4YRTA 2Q5JA 1PFVA 4E1BA 5JS8A 1C0KA 4CG2A 5CNJA 3SHFA 4RK6A 2QN1A 2FCAA 4ODIA 5JPCA 2XVXA 2BSAA 1CPYA 2X8JA 5IJAA 1HOTA 2ZGVA 1M1XB 1Z45A 3K1ZA 1NSTA 3PZRA 4QBGB 3A9UA 4R7ZA 5IJ0A 2AVNA 2FEXA 4IZHA 1DC7A 1U81A 4BO7A 4OBEA 5KVSA 4XFKA 4DPLA 3IKJA 4J0IA 3WY9A 4JROA 1P29A 1W5EA 3CR7A 3SZLA 4BNZA 5L4LA 2JFHA 1IZ0A 1YFZA 3DZCA 3TMYA 1UR5A 3FPFA 4IHAA 2C2WA 4LC0A 5BYJA 1C0LA 1RCFA 3N59A 1WUKS 2XAUA 4OJMX 1K7YA 3NRBA 3T9AA 1DBSA 2R8YA 4PCVA 2O20A 3AP2A 1WBJB 3KJNA 3UHAA 2P8SA 3GOHA 3I8XA 3KXLA 3S7ZA 1R0RE 1QNLA 5EMJA 5FR1A 3VH4A 4E09A 3OP1A 2GEFA 3TZQA 4ARSA 2DLDA 2JLQA 3OX3A 3FSJX 1H9BA 1LK0A 3JQBA 4F60A 4TN5A 1P3Y1 3AHEA 1WXWA 2O48X 2ZBRA 3ASZA 2NTVA 3G5UA 5BV0A 4EFLA 3DKVA 1UBEA 4ZICA 2CJPA 2IEAA 2OL4A 1A9QA 1TI7A 4HEHA 4KI7A 4YONB 2XB8A 1PWZA 1PEYA 2ZWVA 1E18A 1RWOA 2JAXA 1IEVA 4ZI7F 2QDKA 4BQOA 4J2HA 1G7SA 1TVEA 1XQ6A 2ONZA 4O8CA 5CM8B 5IVDA 4QUEA 2V1UA 3FGNA 4URWR 1CEEA 4DB2A 1GNQA 2FN4A 2Q1WA 1I3CA 3UUEA 1S2MA 2JI4A 1VG8A 3VC2A 3ZDCA 2RBGA 5A5DA 3T9FA 4IVNA 1I7PA 3RGGA 3IAM1 4UCXA 4GWKA 2RAFA 4QJ5A 4MULA 1I01A 3O9VA 3OT1B 1AD2A 4YRIA 2CHQA 3CZ9A 4Z3KA 4JQCA 1P62B 2AEMA 1T5TA 1E61A 5JXGA 1UBHS 4W7HA 4FFRA 4YN3A 1D03A 1ZONA 1Y1PA 3CTMA 3U13A 2BGUA 3H7IA 3KXKA 4FS3A 3ZPXA 1V9LA 1OIWA 1U7TA 2X0IA 1JB1A 4QRIA 4TTSA 5EHNA 3TK1A 2ZDHA 2AKYA 4MRRA 3OCCA 4LZJA 3WLLA 2V7GA 4RSGA 4MNTA 1T25A 5F21A 4FLMA 1JA9A 2IYQA 1AF7A 3ICCA 3LQKA 3B70A 1RYDA 3KFXA 4OHMA 1OT3A 1HDEA 1P4JA 3NXKA 1UFVA 1YZ3A 4G0QA 3VKUA 1W36B 1QV7A 2IZZA 1LSSA 3H2KA 2BI7A 3I76A 3R8XA 2JFXA 3P9NA 4R4JA 2JARA 4V38A 2H1OA 1KRHA 2CXNA 3U7FB 4P5EA 3RG2A 2YWHA 3A10A 1GRVA 4WXRA 3HMKA 1U90A 3PC8A 3FCYA 1E9DA 1IOWA 5FLKA 4CL2A 4BJ1A 2WUWE 3W2TA 2VA8A 3H8VA 2AR7A 3GPIA 4QUJA 1AT1A 4TMFA 3JCZA 1SUIA 3DB2A 1SU6A 3ELUA 3DBLA 3TOSA 3H1TA 2F1RA 3WK5A 1SHKA 1ZUHA 3DS8A 2QZZA 1QKKA 1B0ZA 4D25A 1OBCA 1N2IA 3MT8A 3W3AH 3ZHOA 4F46A 1P4GA 4TRNA 3IL2A 2X8WA 4Q39A 4UAUA 2H00A 3FCSB 1H1TA 3K0FB 5C1OA 3VYUB 3C7AA 5LR6A 4I1PA 2HHJA 1WMAA 1E2QA 1G8YA 2OEPA 2WF9A 3ETHA 3GAFA 3OECA 4HWKA 3EIOA 4Y1FA 1Z07A 4DLTA 1JJAA 1HNNA 1PE0A 3CEJA 2PKEA 2Q2QA 4KHZA 5JHHB 4FEYA 1DQRA 2BH2A 3DBIA 3EYWA 3QWAA 4HAOA 2H2DA 1JKFA 3R23A 2RJ3A 3GZJA 1IRIA 1RJ9A 1G42A 1UZMA 4YR7A 3RC2A 1T36A 1YRBA 3H1BA 4RNDB 4BNKA 1A9YA 1KGSA 2W22A 4BQQA 3PEWA 2B5WA 2P4HX 3PE4A 4D8WA 5TMBA 4DJEC 1XMQB 1NFRA 1I1QB 2QVZX 1IBSA 2F3PA 3A26A 4Y2QA 3SDSA 1F4LA 2PMBA 1X9GA 1KO4A 1ISMA 1EFCA 4Z99A 2JA1A 4P4SB 2X0EA 1QZXA 2HLNA 3ZGNA 1NQ5A 4Q4HA 1NQOA 4QUIA 2HN9A 2A1TS 2J6HA 3TTSA 2HL6A 1Z7GA 3IV7A 1C2YA 1EFRA 1W5BA 4FT4A 4M1OA 5K3EA 4CQMD 2H9AA 1OX6A 1N2CE 4MGHA 3CCBA 4EO7A 2IHYA 5A7HA 4BEJA 5TF4A 3SCZA 4EP1A 3A4IA 3E1KA 3R5KA 3ICEA 5HRUA 3CYFA 1GG2A 4N0PA 2FP3A 1QF9A 3BD7A 3L0ZA 1UC5B 3GGCA 3PHGA 3RKUA 3VR6D 4AQDA 1PVOA 4CM4B 3D7SA 1F0PA 3D6MA 4MVJI 5D84A 4OHZA 4PPFA 1NXSA 4L1KA 3IAS1 4GXQA 3A4YA 5EGSA 3W5SA 4DGQA 4HVLA 2JC3A 2GN4A 1M6NA 2PBRA 3DL0A 5JCXA 5KTNA 1XNQB 1O9GA 3ZWMA 1NF2A 2WG0A 3IBCA 1Z18A 5LN1A 2X77A 1GXSA 5F23A 4UU8A 2O0MA 3QE9Y 2I4TA 2O0JA 1WVIA 2NG1A 1EVKA 1GARA 2D0IA 2QD3A 1NATA 4GOMD 4TMTA 3GLIA 4RGQA 2QTVB 4NMMA 1QWSA 4WOKA 4LV6A 3TH5A 3GOQA 2E4UA 3HWRA 1LQTA 2HQRA 4IDQA 4BLOA 3GEGA 1WHTA 4O59O 1T4DA 4WCDA 3OUUA 2R6HA 2QVYX 1EK2A 3S0JA 4DLUA 4O3FA 3IXMA 3SU8A 5DN9A 4OO3A 4ZT2A 3WFIA 3N0RA 3K9FC 3MMNA 1MRZA 1MDBA 4E12A 4IDFA 3HUUA 4EZBA 4K1LA 1U8UA 3O31A 5K09A 4O4JA 2D74A 1WM1A 2PPLA 5GONB 1NTRA 1ONPA 4DIOA 5E3JA 4X60A 5KIAA 3KE8A 1XEXA 3ASYA 4CCSA 3DGFC 4AJEA 1J2YA 2Q6IA 5ENDA 5KHLB 4IXDA 4C43A 4CDNA 3USZA 5CDGA 3OMWA 3H0KA 4PYMA 2I66A 4PPGA 1QBKC 4BU1A 2C57A 1IOVA 4U2DA 4YAJA 2G7MC 2ZBEA 3EWSA 3VR6H 5D1NA 4C29A 1DWPA 4TM7A 5AKGA 4DAEA 1VE9A 2HBYA 4F1JA 3IVMA 1UOPA 5CDSA 5CM2Z 4R69A 1HZZC 2YWRA 5HWSA 1DIHA 1JHMA 1GG9A 1Q1GA 4RDHA 3A28A 3K71B 5ALVA 2I8CA 2RGUA 3AV3A 4I6GA 1L5YA 4I2VA 4BBZA 1PTKA 2IXTA 4C3OB 4CQLB 2F67A 1Y4SA 2ID8A 4F6CA 2OZLA 3VC1A 3GFFA 1SCDA 3PBKA 4YMUA 2P5UA 4L6AA 1DTSA 4EI8A 3I09A 4YAIA 1MTOA 2GBFA 5CX1B 3E0QA 5E6RB 2R8RA 1U0FA 2KI5A 2VDRB 3NEPX 4M54A 3U9TA 2GEJA 2H4WA 3BKXA 1GN9A 4YLGA 4C87A 4BMNA 1VIAA 2EXXA 1NXTA 2VK4A 3F3KA 1DAMA 1L5SA 1UXGA 3QWFA 4JNKA 2OO5C 5LZ5A 1N5LA 1HDXA 1Y33E 3RUAA 1SVSA 4OXIA 3QY0A 1XEXB 3I4LA 4QU9A 4Q1VA 1U3FA 2WT4A 4KQWA 4V03A 4RH1A 1WSDA 5DIFA 2OCYC 1JSXA 5EMMA 3WSVA 4IZ6A 4K26A 4PBTA 3ZV6A 1I5EA 2QLJA 1JFVA 2ADFA 1N2EA 5LNK1 3DDWA 4HWTA 5TGTA 3FJ1A 3PG5A 4PC6A 4C7VA 4FHCA 3DM9B 1XD2A 1XVVA 4L50A 2REBA 3U48A 4YUWA 5K6AC 2QIOA 2Z08A 3GVPA 4K9MA 3TSAA 4IF6A 3IEUA 1KRWA 2GN1A 3WO0A 1SRRA 4OIFA 2VH2A 4ZODA 5KYXB 1YB4A 4A91A 1G66A 1TKRA 3CU5A 1OF1A 1TUIA 3CA8A 4MGIR 3R9XA 3NIDB 5KS2A 1QHEA 3E9YA 3ORHA 5FOSA 3BTSA 1YBMA 1XZLA 3BFKA 3CPEA 4PYOA 5ALJA 3E9RA 5AKYA 5KKCA 4J7AA 1S7CA 3KZKA 5CG2A 2BEWB 3DOOA 3W5VA 4B3TB 2VEDA 1CZNA 3TB4A 4R6WA 2Q5HA 3O8RA 4HGNA 3L49A 3UCFA 4G01B 5FUXA 2YWJA 4F2PA 4WZAA 3VKWA 4HNAB 1FMJA 2AOWA 4R9RA 1FA9A 1GNRA 2C9MA 2RC6A 3NJRA 1RRKA 1JPJA 4Q9DA 5DGXA 1PAUA 3C5CA 4IJUA 1T8SA 1THGA 2R6FA 1R16A 1Z7BA 2EKBA 1QGYA 2GSDA 3SFTA 1KFJB 1KIFA 4L5BA 4WVLA 2Y9PB 4MW2A 3W06A 1EGHA 1HYBA 3FPGA 1N57A 1PQYA 1QFYA 5KTSA 3SOPA 4O4LB 3H5WA 3TAXA 1Z6XA 3LRTA 4QG3A 1AZTA 5C9ZA 4IXWA 4PZ9A 3K70D 3C8DA 3FUUA 4R3NA 3SX2A 3THXB 1ZVVA 2BKAA 3U81A 3UAZA 1CD5A 4N6NA 2VOEA 5D5PA 5TT0A 2R5WA 2CEKA 1JXOA 2VDQB 4KCGA 3OFSA 1ZMBA 3R09A 1FPMA 2DUWA 1N0IA 4BO6A 4BJHB 4OREX 3ONFA 3E82A 2TSYB 3SQXA 4I81A 4IFBA 3B5JA 4OHUA 4C0HA 2HUPA 2QDXA 5FADA 3GLGA 1S3SA 4NU8X 1O96A 1PT6A 2P67A 4K0KB 5AKIA 2ZJBA 4TQAA 2X7HA 4YLEA 1KO5A 3VO8A 5GMOA 4DLZA 3P0EA 4MCHA 5GJCA 3NT4A 3GGPA 2G08A 1JYFA 4GNKA 4HO1X 1PK7A 2VDNB 1YRLA 2A4MA 2AYXA 2DPLA 5ALWA 2DJ5A 4IV0A 3IYLW 2B8WA 1EJ2A 5B2ZA 5JO0A 2YOHA 3C45A 5AKKA 4RTRA 3ZV7A 5JNVA 1QJCA 3TNDA 4PNEA 4JYMA 1H2FA 4PHTA 4BGEA 3KO8A 1SKUA 3MWEB 2HZBA 1JILA 4EJ6A 4EKEA 5BVHA 2CNBA 2KQUA 3BDAA 2GF0A 1G8KA 1UBSB 3FHLA 1Z7EA 2ZRQA 4UM8B 3QFFA 4ZREA 1XTSA 5CNKA 1KEWA 2PLFA 5JYEA 1YB1A 3C7TA 2NZVG 4C22A 5FJJA 2ZVPX 4IKPA 2Z58A 4U7WA 5GM2A 3K15A 4I4TB 4DIDA 4RD0A 4DQUA 3A9RA 5DBIA 1AURA 4TWRA 1A2KC 4J4HA 2QT9A 3D02A 4QDUA 1K7FB 4Q9KA 3GROA 1JEYA 3JQAA 2IEBA 4JJKA 1P7ZA 1PJQA 3DC7A 4IDCA 4YRMA 1ESCA 4GMKA 1X1QA 4IIJA 3ZZ1A 5COAA 1XLWA 5FTNA 1YCGA 1ZK2A 1ZWKA 3O4HA 3ODGA 4MB2A 1IXYA 2ZUWA 3H5VA 3OICA 2IUUA 3UGJA 5EP2A 2EW8A 4JQOA 4K1XA 5LUBA 3T7DA 5EYPB 1E1MA 2C3UA 2ZI4A 4YRCA 3I6IA 1T5SA 2KE5A 4QRHA 1HKHA 4U7FA 3LCRA 1DKLA 1P5HA 2EYUA 4H08A 1MRSA 2VL7A 1MVLA 1F20A 1ZJWA 1P1BA 1I10A 3LC0A 3PKJA 4XLTA 1U2PA 4WCVA 2NYRA 4YY3B 1V7ZA 4J0JA 3SC2A 1JE0A 4EG0A 1OX4A 3QENA 3GA5A 4I1YA 4MV6A 4WK4B 4ER6A 2H31A 1JIUA 1R9JA 3KJGA 3ZN2A 2R0QC 2CLDX 2D4AA 2PSJA 4DBZA 5BVHB 2IP1A 2BHRA 3AP1A 1LQUA 3DDUA 3LQ2A 1FYXA 1WF6A 3EXIA 4CTOA 2VTBB 2UUOA 1SOWA 2OYSA 4B75A 2CYAA 2J46A 4B7CA 5BRNA 1TNDA 2XT0A 4PFQA 4ZCSA 2FPPA 2PA3A 4LHXA 4BNHA 1TU3A 2WZCA 3P45A 1L8XA 2F62A 3IRVA 2HO4A 2OXFA 4HNUA 2O8CA 5U4XA 3UMJA 1SIWA 4C7BA 3T1TA 3MSXA 2VQ3A 4WLFA 3JQAB 2AG8A 1JEYB 1PFKA 2Q5IA 3JQCA 1B6RA 1XZ8A 1T3SA 3UHFA 1OTXA 2X4IA 4B3DA 5J43A 2JHFA 3CN7A 2E37A 1Z6ZA 4Z9FA 1SC4A 1DWOA 3FMVA 3LP8A 5ICCA 2UUCB 3ONDA 4OQLA 1JMVA 1KI7A 1XCPA 4QPNA 3BWVA 1PJLA 1NF8A 5ELMA 2V4ZA 4M60A 2H57A 2FETA 3ESQA 3NV7A 1VDMA 4MUKA 4K3UA 1RRGA 1UOQA 5FBLB 4FEGA 4O4IF 1OBOA 2YJTD 4GSYA 4NJOA 2IUEA 1PT5A 2KMLA 1IEQA 1Z2AA 3RYFA 4MWOA 1KBZA 5ITWA 1AKRA 1PFUA 1T5DX 1VL2A 2L17A 2WMOB 4KXUA 4M0EA 2ZRGA 3O94A 4NP6A 4C4ZA 1I3LA 4RHXA 1DS6A 1JPUA 1V26A 3T61A 3IPCA 3UPTA 3ZUPA 3U4QB 2WWGA 2G06A 1F6BA 3H04A 4NF2A 3I9OA 4OP1A 1KWKA 4CHTA 4XEUA 1YHYA 2BEKA 1Q7CA 3WRYA 4GI5A 2PT6A 5BSKA 4DANA 4I8XA 2A0UA 2XWJI 5L4SA 3GRYA 1P0CA 5TPWB 4BNFA 1R3UA 2EP7A 3RTDA 2Q3LA 3KPVA 3S2UA 3W34A 1Z4LA 1ZH8A 4N7MA 3RFXA 4YRSA 5IT5A 1A0OA 2ZS8A 3HKEA 5B3KA 4OGLA 1DZIA 1E69A 3WL6A 3EQ2A 4FOLA 2C97A 1TF5A 2C61A 2EW1A 3I28A 4BX8A 5KTRA 4M1SA 4X8OA 4HFJA 2B94A 5ALLA 4YHBA 1K0UA 3V4FA 1KC3A 4DQLA 1XZEA 3NJ8A 2ZUTA 4JLUA 3FFWA 1RYZA 2WNHA 4UU7A 4L5YA 5CFMA 2DY0A 3E7XA 4BRUA 1T91A 5JQGB 5A4JA 3TLMA 5AUNB 2QX9A 2BPOA 4P22A 1DBWA 4XLLA 1ILEA 1NLFA 3RBVA 4B9EA 3GWZA 3RYFB 2JF0A 2PGJA 1ZKMA 3ND7A 5AJUA 3OTGA 4N0EA 4YRZA 4Y3UA 2JDIA 1DX9A 1KYTA 1JAIA 1X7WA 4A0SA 2XZPA 4MCAA 1N2CB 2VXBA 3AY3A 1T1GA 1IATA 2VQ6A 2REOA 3DWEX 3U4QA 1XKTA 3G0IA 3EMVA 2COEA 3RVOA 1JB9A 4HRYA 3TTXA 5IHXA 1RM3A 2NXJA 1V1MB 4ZVUA 2WAYA 4F92B 1NIPA 3LPCA 3N39C 4CCWA 1VCMA 5I8WA 3FH0A 3ESXA 1L2TA 1VSQA 3RS2A 3MLEA 5FAKA 3PPYA 3GI1A 2XOEA 2P65A 3LPNA 1ZD1A 1J25A 4O4LF 3SIPA 3AEUA 3AR2A 5JNLA 3B78A 4Q12A 2CSXA 2KPOA 2REXB 2BSXA 5ALZA 2ILVA 3SYLA 1C7EA 4B40A 1HEYA 3KFVA 5AKHA 3HV0A 2Q62A 2Q7DA 5DLQC 4QUGA 1MAHA 3AI7A 1KEUA 1PJCA 3LWDA 4V39A 4DDHA 3NTRA 3JALA 1V1RB 1R6VA 2EZ9A 2SKCA 4KX3A 4PLPA 4KO1S 1R7RA 1UWVA 4ZQBA 3CXUA 2L18A 1T9GS 1Z38A 5IZCC 2RHWA 3ABIA 2ZUEA 1CNFA 3AYZB 3PDCA 2NU6A 4AZ0A 4HZIA 1LDYA 4QUAA 2YRWA 4TOIA 1Q7GA 3ZBPA 3FLAA 3N2KA 3U4IA 2XXAB 5JQGA 1EPUA 2O50A 5FI3A 4E0BA 1SWWA 2YZ2A 1PV4A 4LJ9A 4GYWA 1MC5A 3WWCA 1U7PA 3ER6A 3W5IA 1ECCA 1Y3HA 3N2EA 4LC9A 3ZIAD 5CB6A 4R05A 1LC0A 1GAJA 1HM5A 1RMTA 2VPIA 3NH9A 4JEUA 4PZLA 3AT1A 3T1NA 5F3WB 4XW2A 3E23A 1NONA 4CR7A 1QVWA 2AG6A 4N65A 3F49S 3O1JC 3RC9A 5E38A 4GLFA 4F2GA 1ZI9A 1UK9A 2GN6A 1GZDA 1QG0A 3FWKA 3RU9A 4BNXA 5I4KA 2OV4A 3BK2A 4YRQA 2Q3MA 3QVXA 1GN8A 3KKPA 1UDRA 3LQQA 4IGEA 3F47A 4RY9A 5DTIA 1Y3AA 5C7LO 2YHSA 2ZIZA 3QZUA 1G8MA 4YJ3B 4DREA 3PX2A 4GLBA 2GJSA 3W8DA 1U8XX 4RVOA 5KX5B 3B7WA 2IHBA 3GL9A 2AXNA 5CA0F 4FINA 1KGDA 3VGPA 5BWCA 3GX1A 2HQOA 1ZJ5A 4Q9JA 4EQ6A 1S4MA 3MB8A 2AMYA 1O8BA 3E9ZA 5AI5A 2GF2A 4QTYA 2UU9B 5IKEA 2GF9A 2XUKA 2ZJ3A 1E1KA 1NUUA 1PQ4A 3D1VA 3IELA 3O3CA 4PICA 3UJPA 4E31A 2XZOA 5LZ4A 4O3MA 3X1YA 1OWLA 2IEDA 2XYHA 1HMYA 3VAAA 2GERA 5A2GA 3FXAA 1W4BA 2VWPA 4K86A 4X92A 3VMFA 4CLEA 3UMCA 1QX3A 3I04M 2WT8A 2NV2B 4JODA 2Z4RA 1BJKA 2QD4A 2PUBA 1VP9A 4UMDA 5AHOA 2IL1A 4CFZA 2YWCA 1LDGA 1TKBA 1B2RA 2GAIA 3I6MA 5KTMA 1XL0A 5JBQA 3KXIA 2QR2A 1HT3A 3F90A 4AJJA 4INPA 1FS6A 4O02B 4XM2A 5JALA 2XVAA 2BGWA 2WNSA 3OZCA 3G13A 2D3WA 1C8BA 1KBOA 3HLTA 4FIDA 3V6LA 2ZE8A 4AO6A 1GPNA 3BL8A 2QRVA 4CT0A 5B36A 3NYIA 3U7QB 1IPEA 2E5WA 4G1BA 4KSYA 4Q66C 3SM9A 2VUSA 4B3HA 4E5KA 1NBAA 1M83A 3NC1C 3ZNNA 1FDWA 2RIPA 1I0IA 1LC3A 2X5XA 3FYHA 3B3QA 2GS9A 3TSWA 4Z7NB 4TT8A 1E32A 1JI3A 2D5IA 3B20A 4TMVA 5IBPA 4QZVA 3EUFA 1JZSA 3DEKA 3LY5A 5FI0B 3TGPA 1RLTA 4L08A 4KRYA 2ZRCA 5TXGA 3T1VA 1P0FA 1OLSA 1RKQA 2GH1A 5JXWA 2HT1A 3I37X 4AG6A 1OFIA 2Q1TA 5B2FA 5G3YA 2ZUCA 1Q15A 3G5LA 2FZKA 3O0TA 2V7EA 4JLAA 2FJ0A 2ZSKA 4M7WA 3GFVA 5KYUB 2NXCA 5K0LA 4NYJR 2O8FB 1WPQA 4CV0A 4WEQA 1KKUA 3KTDA 5A5GA 1WZUA 3GJRA 4A8PA 4B47A 5JEDA 4OKIA 4ENQA 3EG9B 1KJWA 3HEAA 4LHVA 4JZKA 5EWLB 3FM9A 1ZESA 4BNDB 4E4RA 4FFBA 4M98A 1DUSA 2PG3A 1MC1A 2VT2A 5G1OA 3C1UA 1CXZA 3TXXA 3AIKA 2ZIGA 4YO7A 1E89A 3U16A 1CUUA 5CCEA 2P9JA 3VH3A 5FNZA 5KJ6A 3NNSA 5E6UB 4Y7DA 3WI7A 4EEZA 3VR6A 4KFCA 5CA0A 1DZ3A 2XYRA 3LVQE 4QDTA 4ZRNA 3U7QA 5F5NA 1UK7A 5HM6A 3WX0A 2OAP1 3KKLA 1Y4ZA 2C4MA 3P4UA 1NLZA 3ZQ4A 3IT0A 3FMGA 1HO3A 1B41A 1ZISA 4L0MA 4Y6QA 5CTAA 3EMBA 1L4YA 4M36A 3TECE 1LFAA 4UQOA 2V7VA 3LT1A 4KQ9A 1PWEA 2WAOA 2Q9CA 3N87A 1HLFA 4LWOA 3EIXA 1E4VA 3VNSA 3EBLA 4RL6A 1KFEB 1PSZA 2IT1A 4WPGA 2PXAA 5BSWA 1PGNA 1LV8A 4NYIQ 4RIEA 2BC9A 3G0BA 3TIVA 1ADYA 3ZDEA 4KHPB 1XAIA 1OLSB 1PW5A 2QN2A 2VCEA 3LNTA 4KQ2A 4R81A 4XUGB 3RS4A 2NZWA 4B2IA 2OCXA 3FFTA 2GWHA 4KN6A 1NRJB 1W581 1M6VB 4LK2A 5JH7A 4NFYA 4GZMA 1CUJA 1MC8A 1ZVQA 4ID9A 2MSCB 3DZ8A 3UMFA 1EVJA 2EC5A 3IUMA 5GTDA 3V9PA 3EG9A 4PYRA 1KJ8A 2J5KA 3UIEA 3U44A 3SYRA 3DHEA 1QYDA 4YMHA 1KJQA 4INAA 3IP6A 5C4MA 2HYIC 1LCIA 1TW3A 2AJ8A 4YRRA 2JVKA 5DTMA 3MJDA 2JCSA 3IA2A 1XELA 3S5JA 3D6HA 3L7BA 1NC1A 3IMCA 3B2NA 4I9HA 1VL8A 4RD1A 4B84A 3OLYA 4P81A 1S3IA 1P17A 5BSUA 1MVNA 1J09A 5E6UA 4B6SA 3JWJA 2GK4A 4UJ3A 2ZAOA 1NZJA 5GY7A 3T5TA 1KMCA 1NASA 3G5TA 2JAQA 3EIEA 3OM8A 4GPZA 1K27A 4WXMA 4XPIA 4F4HA 5J58A 2BGTA 4LNUA 4PLWA 3ICOA 4QUDA 3TWOA 5EZ5A 5KTTA 2ETVA 1DC8A 4OI4A 4BLQA 1NA5A 3D2AA 4WY5A 4BX2A 1Y5NA 4IH1A 1I2DA 2XPCA 4CV3A 2P6PA 3E4DA 4RV5A 1G7RA 2I6SA 1XHFA 2IVZA 4D9KA 2IS6A 4Z7OB 4AP5A 3ESBA 1NJ6A 5JJCA 4FD2A 2SNIE 2JGJA 5DGTA 2Q3BA 3PD0A 3E18A 3HYTA 4J94A 5F51A 1MLDA 2VZEA 4X90A 1PX2A 3MCAA 3L7OA 1ZJ6A 2ZTUA 1G2QA 2YYAA 4IW3B 3L1HA 3BCHA 3L04A 3WWDA 3DXYA 4J7XA 3OF2A 1T6ZA 1ORVA 2GLUA 1UT5A 3KJXA 3W9BA 3FYTA 2ORWA 3GZNB 4CKWB 2JPDA 1U5AA 5IKPA 3BD6A 3LLUA 4YJGB 4RHFA 4W5JA 3W5AA 1G20A 3S8EA 1REQA 3STXA 4AY5A 3GRKA 2FSFA 1LS1A 1EM8A 2C5BA 2X7XA 2ECQA 1OZAA 1V2GA 3B51X 3HPRA 5M34A 3U6KA 4E33A 3KQSA 2RHHA 3IQXA 1MAUA 4MO9A 5A9RA 1KKMA 1M2WA 3I92A 4CU2A 3IERA 1A9PA 4OLJA 4JEIA 3CLRD 2FQ1A 2W6PA 3LC1O 4YPFA 2P2NA 3UFXB 3URMA 2A7QA 3FKJA 3P9QA 1ARZA 3G8AA 2CJFA 5BN3A 3KYCA 3RODA 3PEYA 1OLUA 4HGOA 3AOGA 5CEJA 3SXUA 1SG0A 3NBQA 4H4EA 3FCAA 5FNVF 3BXZA 4M9ZA 4DUYB 4EK9A 5EESA 1SCJA 5KNCA 4ND1A 1D1QA 1X92A 5DN6A 2HA6A 4ITVA 3S4YA 3KTAB 3WMFA 1N5MA 1IJKA 1B16A 3LI2A 3DMTA 3AUKA 3FAZA 3QVKA 1QIMA 4XXHA 3ROFA 4AJ2A 1ZW1A 4ZCRA 1Z3IX 4MGKR 5H83A 4R0VA 4G2TA 3G9ZA 4ZYXA 1ZCBA 1KK2A 3EDRA 3LTEA 3UOAB 3LV8A 4ISCA 5DWDA 4K28A 1L6IA 5D5QA 2XUJA 1KIAA 2BGLA 2FZLA 2QROA 3VI4B 4ASUD 5A6VA 1IVNA 5AW3A 1L4MA 2CUTA 1DP4A 3MS4A 3VR5H 1J2EA 3O3NB 5KJFA 2IY8A 4OCZA 4UQLA 4EX7A 1AUXA 2EP8A 3EFHA 3K16A 1AHIA 3PPXA 1U7UA 3CG0A 3ZGXA 4BVKA 1UXHA 5AI6A 1ISSA 3I2GA 1QKIA 2A0FA 2PTGA 2XNDA 3GGDA 3NBMA 1XHLA 1KQGA 3K92A 2PVSA 3NANA 3S1SA 3HCNA 3MJCA 1UOOA 3WKEA 1KA9H 1RYNA 2G8NA 5JD5A 2J1LA 4Q1FA 4KPEC 1YJBA 2X8AA 5JNUA 4BXOA 1DTEA 3Q0TA 4ZMSA 2VUUA 4ZCQA 3CUKA 2PNJA 5JXHA 2A5DA 5JE8A 3DEFA 3OEHA 1DX4A 4TV9F 3P97A 2BF4A 3AC0A 4R1MA 3FFXA 2R6CA 4G5HA 3L4KA 2WUGA 2FWPA 2J5QA 2GBLA 5E4FA 4IIBA 3EXEA 4WXPA 3BULA 4INZA 2RBEA 1A96A 2H18A 2RH9B 3BIFA 4XFDA 3ZZNA 4ENUA 2C84A 4LXQA 2B4QA 1YK0A 1G3MA 4LJ4A 4E5NA 1XFAA 1FRQA 1Q0SA 5D6OA 1BN7A 4MUIA 5DT2A 2RI1A 4KYVA 4XWAA 3QJGA 5IABA 1D2RA 1DAIA 1GKUB 2JIOA 3G79A 1LNQA 4BKQA 1GOTA 2Z1NA 3E53A 4W63A 4NL4H 4C14A 1JQDA 3VTFA 1W25A 5ADVA 1E2JA 4Q3KA 1Q1NA 1XA0A 2QKYA 3DZKA 3JQPA 1Z08A 1N6OA 3HABA 2KM1A 3GYGA 3GDWA 4IEIA 4BFWA 2YY6A 2I2FA 4FS8A 3JD4A 3FUTA 3L77A 1K68A 1J20A 1XJWA 5K3CA 2PLNA 3LJKA 2IV7A 3TI9A 4DJJA 2W98A 2XDAA 5KWVA 2BGGA 4OYYA 2JFFA 4FQ5A 3EVDA 4PYNA 1HURA 1QHNA 5TQ2A 2PBZA 2BN4A 1AOXA 2QBYA 5EIEA 3A27A 4BXOB 4GEGA 3SVZA 4NZPA 3LP5A 3GA0A 2J5BA 2RHLA 2EQAA 3A31A 1IE3A 3QTLA 4B0PA 5K6TA 1DG3A 4B2YA 4YMVA 4OKNA 4XM0A 3VU3A 3LP6A 3GO4A 3SZMA 1T3TA 2P7IA 4ZVQA 1HDGO 2DF8A 1VE1A 4JD5A 1O95D 4CTNA 2YS7A 1RE0A 4YCBA 4OB7A 3VU8A 1W93A 3QEMA 5J2TB 1H1LA 2QP4A 4MRMB 3BB3A 2IU3A 4TRMA 1PO7A 3IKVA 1FQJA 1FTGA 2G1JA 4GGMX 3WLFA 2IZ0A 3GELA 4EI7A 3KBBA 1TUGA 3IB3A 1ZA2A 5CGQB 1G6Q1 1ZU5A 3W9YA 3PX3A 2M98A 3DCIA 3QWIA 4BFVA 5EAIA 4X1YB 4C7OA 2CDAA 4F1WA 3OQNA 1JH8A 3EGDA 5KHAA 2I4OA 3DEAA 3PWZA 1MABA 2XGSA 4GC9A 4LMRA 3MGKA 5LPNA 5P8WA 3NATA 5ELLA 2CK3D 4OU4A 3TSYA 1BA3A 1QAOA 4QWMA 5CU7A 2WFZA 1A98A 2GZMA 4FSDA 2GM4A 3JZMA 1ZIPA 1K2WA 2GD1O 4KWEA 4RQTA 3I01A 3O47A 3ODPA 3DV9A 3SJCA 2NUPB 3WBBA 1VPVA 2BP7B 3WB2A 2AVDA 2X8LA 5HF6A 3HXKA 1G60A 4QFMA 3I4FA 4AWBA 1CZOA 1UH5A 3S27A 1JF8A 3SSMA 5JI2E 3F7MA 1X13A 3A6EA 1IM8A 2OC9A 3IOYA 4U39A 5JCPA 3VYVA 3Q40A 2OGWA 2D0DA 4KLCA 4RLHA 4L4XA 3H99A 2FPRA 4P93A 2P2YA 2YN2A 1GFWA 4DZRA 1XB2A 5IM5A 1JJFA 2JIDA 2QI9C 3K0CA 4ROSA 4U6SA 4HQLA 1OPRA 1YCFA 3K5IA 3T9BA 1A5BB 1NQAO 4G23A 5TR9A 3RHZA 4BB0A 4EENA 1WBDA 2FY8A 3OFJA 4QGFA 3GK3A 1OMOA 2G25A 5IN5A 1PD1A 2CC2A 2DTDA 2A8YA 3AETB 4A0HA 2C4WA 3WIEA 1P1JA 1VMKA 2QMHA 5A9TA 2EDAA 4W6QA 2VP0A 1TPZA 4POAA 3SE7A 3WICA 5AVYA 1B00A 2ZBDA 3OM9A 2XCQA 1NW6A 2PWPA 4M6WA 1RCTE 2EYQA 3O8OB 4MROA 4HWRA 5TPZD 4DE5A 5LFAA 3LC2O 1WQ3A 1PJSA 2QTRA 3I8OA 5D85A 1GUYA 5HKKD 1GDHA 3LF2A 4JC8A 5AR1A 1MJFA 1V16B 4LE0A 4PIVA 1LRKA 3ZHVA 2HREA 3C6XA 1GFIA 1U1FA 3KR1A 2ECOA 1NBWB 1RADA 1TC2A 1X7YA 3FOAA 3ZHRA 1GLNA 1ZVKA 4DSUA 1MA0A 2C8JA 1H3FA 4BNVA 2NO6A 2PT7A 2BP7A 3CZQA 1ZR4A 1JG4A 3EA5A 2FMFA 5IAGA 2XQJA 1J6UA 2I6XA 1Z0KA 1U2SA 3GYBA 3KOMA 3PI6A 3HCWA 3TIIA 3OC6A 2CVOA 1M1UA 1Y7LA 4FFNA 3RRBA 2CNWA 3PDJA 5JTUA 2WLTA 4GMGA 4JVSB 1PFYA 2XZDA 4LVNA 4BLPA 4ER0A 1XRQA 4POOA 5K1ZA 5B6JA 2R68A 3HI6A 3VDQA 5EQFA 3PL5A 2XHZA 4D3SA 2ABWA 4TXHA 1OI4A 2KBFA 2RGCA 1C7QA 3COWA 3FLMA 1U3UA 3FWYA 3L01A 2DHCA 5DXAA 1K4YA 4FUTA 1COWA 1D9XA 4M9QA 4PZYA 1QV6A 5JADA 3I1JA 4ZOQI 5DI9A 5ADHA 1AGPA 4EMTA 4DNFA 3IHKA 2YMQA 1X9IA 2QGNA 1D0SA 2FGJA 1K08A 3OF3A 1HLGA 1HSZA 2YL2A 4CDMA 4MAFA 1LKZA 3WKBA 3O8OA 3KCNA 3I1IA 1FB5A 3HTXA 2E89A 1JIJA 3O2JA 5FQNA 1NVVQ 1KOLA 4DPMA