4XB1A

Hyperthermophilic archaeal homoserine dehydrogenase in complex with nadph
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
319
structure length
319
Chain Sequence
MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVKESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 319aa long hypothetical homoserine dehydrogenase
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
total genus 107
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb1A01
4MKZA 3UH1A 4AFNA 3KSDO 4DRYA 4RO0A 5LC1A 2GR9A 3H3JA 1RJWA 3D5QA 4YACA 3SEFA 4JXKA 3NTQA 5A04A 2RH4A 3EHEA 4N54A 1ISMA 2CDAA 3A9WA 5B12A 1B26A 3QRWA 3DQPA 1H6AA 1PS0A 2I67A 3PWSA 3I1JA 1GYPA 2UV8A 3GUCA 3HB4X 1YJ8A 5GZ6A 3RJ9A 4ALMA 2PWZA 4HFNA 4LRTB 1ZEJA 4P8RA 1Q7BA 1QV6A 2X9VA 1B8PA 1ENPA 3GPDG 3LF1A 4NIMA 3DONA 1F06A 3WBFA 1DIRA 1ZJYA 1ADGA 4GKVA 2HO5A 4MP8A 4RVSA 3UGKA 2FR8A 1YBMA 3KETA 2EWMA 5DCUA 2TMDA 4NFYA 3RROA 3GEDA 4FC6A 3ZWCA 3X2EA 1ZBQA 5GZ3A 1SPXA 2VRCD 5JYEA 3HSKA 4Y8VA 4XR9A 1YBVA 5TSDA 1DFGA 2QQ5A 4RGBA 3PJFA 3LYLA 3W6UA 5ADHA 1GPJA 2UDPA 3TZCA 2X9GA 4XCVA 3RFVA 2Q4EA 1E1MA 2Y67A 1LJ8A 1VL8A 4WPGA 4IM7A 4FN4A 1QXSA 1RM4A 4YJGA 4ZN6A 1DRVA 3MOGA 5T5QA 2O3UA 2Q1WA 2D5AA 3I6QA 3OHSX 3S2FA 2EV9A 4D0RA 4Z3KA 1M75A 2WEKA 3EDMA 3KEOA 3LC2O 4GX0A 3W4JA 1UXIA 3OQBA 1P1HA 3PJDA 1ZK0A 4TRMA 4MIOA 4EITA 4NI5A 5COAA 4BV8A 3L6EA 3KLPX 4BNKA 4XQCA 4OOEA 5KKCA 3QW2A 3SC4A 3WIDA 4ZRNA 1ADCA 1A72A 3DBLA 3OH8A 4QXMA 3ZWOA 5FI5A 4XDZA 3F4BA 4K28A 5CG1A 1VSVA 4CL3A 3PEFA 2BGMA 4EJ6A 3JQBC 1H93A 1K0UA 1HE3A 4DBVO 1ENYA 1WVGA 4IXWA 3VDRA 3MWEB 2EXXA 1SC6A 1E3WA 3UW3A 3A06A 1HDGO 2OOSA 3TFQA 1D7OA 4YEDA 1DC6A 5K6AC 2GN6A 3B6ZA 4NJOA 2ZTVA 3KM0A 3RIHA 4BHTA 3DMYA 2O4UX 3ZWPA 5BSGA 3WJAA 4Q3BA 3JQAA 1GV0A 2WTBA 4LRSB 4NK4A 3RUFA 1ULSA 4WK6A 3PGJA 1HZZA 3DC2A 4CR7A 4R69A 4EBFA 5EERA 1R4MA 4CUZA 2FP4A 5CDTA 4A73A 3HNPA 1H5QA 2DLDA 1UDBA 2G5CA 2ZJ1A 1BW9A 3RUAA 2XXBA 2G82A 1AXEA 2QHXA 3GY0A 3PZBA 4JJFA 1HSOA 2WJPA 1UAGA 1YJQA 1R15A 3I4FA 5CPBA 1X13A 2ZYDA 5KVCA 3WB9A 1HDRA 4MVJE 1VSUA 3FNFA 1VI2A 2J5QA 2XPCA 3V8BA 2X0JA 1WNTA 2VN8A 1N7GA 1AUPA 3MJVA 4AJLA 2D1YA 2WYUA 3H9GA 3FTPA 2G76A 2WD7A 4G81A 2AEFA 2EW2A 2PH3A 4BO9A 4K1LA 4HV4A 1BW9B 1ARZA 3M2TA 2R00C 1Q0QA 1XU9A 4RV9A 4BGEA 1ZSNA 5F1PA 5JO0A 4ZHSA 1TT7A 4NDNE 5KJ1A 1T2DA 1BXZA 1GCOA 3FR7A 3ZV4A 3JQGA 2C7GA 3VC7A 4PVDA 1NWCA 1WWKA 4L4SA 1GQ2A 1CQJA 2V65A 1PL6A 3E03A 4W82A 3H9EO 3HDQA 1BGVA 3FI9A 1YKFA 3ZNNA 3U5TA 2NADA 1DC5A 5G0VA 3OECA 4XIYA 4CLDA 1UP4A 4FS3A 4TKLA 5DP1A 4E32A 1D4FA 3H9QA 3ZHXA 2HUNA 1DFIA 1PGPA 3G79A 3HG7A 3PHJA 4WOKA 4HY3A 2V6GA 4H16A 3CXRA 4CQLA 2NU6A 4RVUA 3IJRA 5JO9A 4EW6A 4J4TA 3CUKA 2P2SA 4NMHA 3T7EA 5ITVA 4IJVA 3I6IA 1YQXA 1JDJA 3GVHA 4KQXA 1EVYA 1ISFA 5BT9A 4HFMA 3T4EA 1OOEA 1I10A 5TF4A 5EPOA 2VZ8A 4PLTA 1MFZA 3R3JA 4YCAA 2AXQA 3L07A 1Q0HA 1E3WB 1CRWG 3EW7A 5JW6A 4E2YA 4DIFA 2DBZA 1BSVA 3B1JA 1SOWA 1T4BA 1ZIDA 1PGJA 3OSUA 2GYYA 3H4VA 3KVOA 3LZ6A 3ZI0A 1F8GA 1SCUA 4XB2A 5DN9A 3RQSA 4B8WA 2I66A 4R4JA 1PX0A 3U09A 4U8GA 3WNVA 3CIFA 1PJTA 5TX7A 2CVQA 1HYHA 1PJCA 1UJMA 1RM5A 3FBTA 2QZ9A 2E49A 1N1EA 1OAAA 5IDQA 3ZHZA 4E12A 1HDXA 3WTCA 3UOGA 1PS9A 1O6ZA 1YE3A 2VWHA 3BA1A 1FDTA 4QQRA 4Y6SA 3HN2A 2LDXA 3H9UA 2FSVA 2VHZA 1WDKA 2NU8A 5I9LA 2OBNA 3OIFA 4E5MA 3UUWA 1BTOA 1I0ZA 3FD8A 3VPSA 4FSHA 4A26A 3Q1LA 3PYMA 3AK4A 3D3EA 3VPGA 1QYWA 2YHIB 3SC6A 2D4AA 2J5RA 4Y67A 4M89A 5DP2A 3I9JA 2WYWA 4E30A 2O3TA 3VVBA 4OH1A 2JCYA 3KXDA 2PK3A 2IXAA 1BXGA 3NJ4A 1MP0A 5HM8A 3KYDA 2EKPA 4BO5A 4BV9A 4BS9A 4GVXA 2V6FA 2DVMA 5A02A 4J9VA 3W8EA 1ZSYA 4RDIA 2IXBA 1YL6A 3O8QB 1PSDA 4NH4A 2QRJA 5IDYA 4DQXA 3L9WA 3AI2A 1I24A 1YB1A 1PR9A 3JQ7A 4H7PA 1P77A 3JQGB 4UVDA 3W6ZA 1P3DA 5KTKA 3ROMA 4FFNA 1HE2A 4BGVA 4F46A 4ZRMA 4CM9A 4EJ0A 4QTZA 4BUCA 1TA4A 4BQRA 4I08A 5TQVA 4YAGA 3K2EA 4TVBA 2BLLA 3BTOA 3D7LA 4D45A 3ZU2A 4R9RA 1IHYA 1DLIA 1NYTA 5B4VA 2CDBA 2YV1A 3WWYA 4XDYA 1E5LA 4U5QA 1YGYA 1JKJA 1ZCJA 2C2XA 2GGSA 4J9UE 1UXJA 2O3JA 3IKVA 1E6UA 1ID1A 4R5MA 1I01A 1NHGA 3JQAD 1FDWA 2NVUA 2FRDA 1PZHA 3DZHA 4J0EA 3F9IA 4IY1A 4YJHB 2JFGA 4L9RA 3E9NA 4UUPA 5G0WA 3R3SA 3BMOB 3HE3A 7MDHA 4OAQA 3E5RA 2IEBA 1LSUA 3BMCA 4HX5A 1JN0A 1NNUA 4MVJA 1OBFO 2HCTA 2JCVA 4XR4A 1N1GA 4FQ8A 5DOZA 4AL4A 4RF4A 4B7UA 3RSHA 3VOSA 3AU9A 2GN9A 2P5UA 2AQIA 1T24A 2HRBA 1M2WA 5ICMA 1S7CA 3TZ6A 3O9ZA 3JQ7B 1JWAB 4FJ2A 3IKTA 3RI3A 2PR2A 4TROA 1DC3A 1D3AA 3P7MA 1ZK2A 4CMGA 2QYSA 4NFHA 2O3SA 3OICA 3RFXA 1J5PA 4FR5A 2I5PO 3LLSA 1BXGB 1DIAA 4FFLA 4NK5A 2IZZA 1KEVA 3S2GA 2HLPA 1K3TA 5BSFA 1Z45A 3WYCA 1DPGA 3OIGA 4G5HA 1E5QA 4FD3A 4GVLA 3Q0EA 2X0NA 4E21A 1FDSA 4LN1A 5TNXA 4CJXA 5L53A 2CSUA 1OZAA 1E3EA 1HDOA 5IXSA 3DBLB 4W4TA 1ZO8A 3QWIA 3I9MA 4CLOA 1UXGA 4PG7A 4KTTE 4UREA 5TJHA 4ROSA 2P9GA 3AI1A 3B20A 1XDWA 4C7KA 1NPTO 2BELA 4HWKA 4YJFA 4IDBA 3B1FA 3OP4A 1OFGA 2BFAA 3GGPA 5T64A 4IDAA 5A9SA 3GFBA 4GWGA 4U0KA 5CP8A 5KVQA 1EE2A 1SMKA 4OQZA 4PRLA 3PFWO 2YQ5A 3N74A 4FB5A 3K73O 3NTRA 5J23A 1XSEA 3IQDB 4C7JA 1F17A 2Y0EA 1P0CA 5COQA 2PZMA 1D8AA 3DBHB 2EJWA 3AY3A 3EC7A 3NT4A 5EN4A 3L0DA 5A03A 5CAEA 1SNYA 2J6IA 3BYZA 4NNJA 4DTIA 1R12A 5ITWA 4FFRA 5B4TA 4J7XA 1HE5A 4QO7A 3DBRB 1ZK3A 3VDQA 3JYNA 4RPGA 1PU2A 4BNXA 3EK2A 4RJTA 3WR5A 3A14A 3I5MA 2A92A 5IAAA 4Q3EA 1B3BA 4RORA 3NTOA 3WBBA 4ZQBA 2GF2A 4CM8B 4WNCA 3C7DB 3WSWA 3JCZA 4CLRA 3AUUA 1O8CA 4ALJA 1V0JA 3U4IA 3EUWA 1LTHR 1GADO 4JNKA 4UEKA 1QLJA 4PLGA 1CERA 3JSAA 4MVJI 1PL8A 3QLJA 3P5SA 5FF9A 3RJ5A 3STHA 4DBZA 1I5RA 4GGPA 1GR0A 3OQ6A 4WLVA 3TNLA 3LQFA 2PZKA 4BKUA 4AG3A 1ZEMA 4IGEA 5ES3A 1NR7A 1NPYA 1VLLA 4Y9DA 1YL5A 1LDYA 3INTA 2Y68A 1LSJA 4MVJG 1ZKMA 2DU8A 1EBFA 1PJ3A 2GN8A 1JVSA 5C7LO 2YZ7A 4ITUA 1Q1NA 3P2OA 3NRCA 4KUEA 3GHHA 3HHPA 3QQPA 3ITKA 4GMGA 4OKNA 4A03A 4IDEA 1DAPA 2BI7A 3TRIA 2B5WA 2PKRA 3GDOA 3ZDFA 3FTNA 1OI7A 1EE9A 3JQDA 1D1TA 1QR6A 3TDKA 5KCZA 5IN5A 1MC5A 4CLXA 3AY7A 4J91A 1DIGA 3E18A 1HYGA 3SJUA 4YAEA 4O5OA 1XYGA 4DQVA 2DTXA 1E6EA 4NBVA 1JU9A 4Z0HO 3LT4A 4GLOA 5KVVA 3ZWAA 1LSSA 1PJLA 2BF7A 2YY7A 4PN3A 4L73A 5BNTA 3GGOA 2D59A 3OEWA 1L7EA 3U4DA 1PJQA 1MA0A 4FJ1A 2VT2A 1ZMOA 2FR0A 2C59A 4DLAA 2FN7A 2J3KA 4M55A 2RHCA 1N2SA 5L4SA 4P4LA 2AW5A 3LLVA 3ROKA 1E77A 1MXFA 2GLXA 3SXPA 1MGOA 1P9LA 4IS2A 3ST7A 3GH3A 4P22A 4UEJA 1ADBA 4CMCA 1ENOA 2AMFA 2C20A 3JQBA 1GYQA 1CIVA 3TZQA 4IBOA 2X86A 2ZCUA 4QO8A 2DBQA 1Y1PA 2Q2WA 2WWRA 5B37A 2JHGA 3KV3O 4IMRA 1AN9A 4XJTA 1PJSA 5I9MA 2JKVA 3TOXA 9LDBA 5I7VA 2CVOA 3NUGA 3GUYA 3BZUA 3SLGA 1E1NA 2DUUA 1NQ5A 2DBVO 2P4HX 9LDTA 1R0LA 1LC0A 4UVIA 4N5MA 1K89A 2NQTA 1LLQA 2EGHA 1QKIA 4GL4A 4IJWA 2Y0CA 1B7GO 1HTBA 1Y9EA 1C1DB 4L75A 4R1SA 4ND4A 4EEXA 4UAGA 1W0CA 2O2YA 4NU6A 3DFZA 4WCFC 3CZMA 3GK3A 3O8QA 4JK3A 1ORRA 1XELA 3WXBA 1WXDA 2Y1FA 2FSSA 2VNAA 4UVGA 4EEZA 4F6CA 1IZ9A 3CZRA 4KQWA 3IC5A 2I3AA 3JQ6A 4ALIA 2BH9A 3CE6A 4G65A 4RVFA 3WFJA 1BMDA 1HDYA 2PKQO 2NTNA 5JFOA 2DPGA 1N7HA 1B0AA 5JMPA 2X8LA 1ZK1A 3UCEA 4DC0A 3F47A 2GZ3A 4DIOA 5IFLA 4ZVVA 4RPHA 3DZIA 1T2AA 5TRTA 1X14A 1Q7GA 2P68A 2X9NA 1PTJA 3ZW8A 4RL6A 1YQGA 5JXWA 1GQYA 1V3TA 2E82A 4H3VA 4I9HA 4D3FA 2X0RA 1XGKA 4I1IA 4RDHA 1TLTA 3IIEA 3LDHA 5F21A 4L74A 1U1IA 5JSFA 2C07A 3H2ZA 4Z3DA 4DC1A 3WMXA 2WD7B 3ZWNA 3DHYA 3WGTA 2VOEA 1LLUA 2IODA 1U8FO 3GFGA 3FWZA 4TVOA 4BOYA 4MVJD 4OQYA 1MC4A 3DFUA 4I8XA 1CDOA 5G4KB 1DLJA 4O0LA 1PL7A 1VC2A 1ZZEA 1RM3A 3PTZA 4BNLA 2NNLD 1A9ZA 3PDJA 1E6WA 2PLAA 2Q1TA 4E13A 5FEUA 2H1SA 4E5PA 1ZNQO 2G1UA 2Q22A 5DULA 4YXFA 1NFRA 4YRAA 2NM0A 4MKXA 5CHEA 1R66A 4IINA 3T4XA 4GBJA 3K9QO 2B69A 3UVEA 4KMSA 4NZ9A 3ULKA 4OO3A 5T8KC 1QYXA 7ADHA 1R4MB 4UEOA 1H9AA 2Y93A 2FPPA 4CMEC 2OHXA 4PLCA 4M49A 3ASVA 5AQ1A 3WWZA 3NKLA 4Q3AA 3I3OA 5H82A 3ZU5A 2YQ4A 4DVJA 3TF5A 5CEJA 3DTTA 4FGWA 3KYBA 3OA0A 4CV2A 1GV1A 1EUZA 1NHWA 3FPLA 1NR1A 3VHRA 4OIMA 4CM9D 3SBOA 3B70A 1F0YA 4RVHA 3JQ8A 4PLWA 1V6AA 1JA9A 3GR6A 4OJNA 3ZWWA 1E3IA 4DLLA 4AJKA 3Q6IA 2WE8A 4FDAA 3GF4A 2A9FA 1C0KA 3ADPA 5A4DA 3JYPA 1NQOA 2WYVA 3R1IA 4UVEA 3U4HA 1GTMA 5KVSA 4FFOA 1YRLA 5IJZA 2NU7A 4GKBA 3K8ZA 2X6TA 5L4NA 2O7SA 2P4QA 3GA0A 4PFJA 3QWAA 1A4IA 1KERA 3WS7A 1FF9A 3AW9A 3CMCO 3GNTA 3ANNA 4CM7A 4MIEA 4L0QA 4WGGA 4LMRA 3GAFA 4ZQGA 3IL2A 3K2BA 4J4HA 1U4SA 5THKA 3ZWVA 1NASA 4B7CA 1P1RA 2GPTA 5HBRA 3ABIA 1JAXA 1EQ2A 5DBIA 3PYXA 4B8ZA 1I2BA 1RKXA 2IYOA 3PI7A 4CLHA 1OMOA 5L4LA 5TT1A 3GZNA 2I65A 3KSZO 2AE1A 3BHMA 4PZEA 3TJRA 3LVFO 3DZGA 3RC2A 3OJOA 3U49A 3AWDA 1C1XA 1X15A 2W2LD 4PG5A 4OSPA 4S1VA 4EDFA 1NVTA 4YT8A 1LDBA 1IOLA 1JAYA 2GRAA 5CDUA 2PNFA 1UZNA 4IJKA 4DMLA 3HQ4O 2PV7A 4L4RA 4J2HA 3OIDA 1ZVMA 3DMTC 2Z95A 2AA3A 1O9BA 2DT5A 3QP9A 1M76A 4I5FA 3FSRA 1IZ0A 3VZPA 3OETA 3HJAA 4WLNA 3G0OA 1GPDG 3GVCA 4PCVA 1PZGA 3RC7A 4GQAA 4Y98A 2X0IA 3ANLA 3WTBA 1GAEO 4GAEA 1FMCA 1PZEA 2DTDA 5IDXA 4DYVA 1DFHA 1LDNA 3L9XA 3P2YA 4XD2A 5ICSA 2Z5LA 1EK5A 4M87A 5F3RA 5KJEA 3E1KA 3EZLA 4MJLA 4E4YA 3C1TA 2VOJA 5JS6A 4BQPA 1ZK4A 1P1JA 4AICA 2HAEA 1FDVA 5EL0A 3O38A 1X1TA 1BDMA 2B4TO 2YHIA 3IS3A 1I30A 1NX6A 3WYEA 1K5HA 1DXYA 4WECA 3I4CA 2PTGA 2BRUA 4JROA 1PR3A 2BGLA 3OQ1A 2CF5A 1CJCA 4CQMD 5DNAA 1BWSA 3QVSA 4ZQHA 1ENZA 3QWFA 1WDMA 2Y1EA 4XYBA 3TZHA 1KEWA 5C5IA 3GVIA 4WCDA 4HNGA 3ZV5A 4OSOA 1Y8QA 1M66A 3U4CA 1IUKA 5GZ1A 3R0IA 1Q2XA 1UXKA 3UCFA 1AHHA 5KJ6A 5ENDA 3O26A 1GEGA 1NAIA 1U8XX 3BXXA 3ICCA 5TLSA 2AG8A 2J3IA 3CMMA 3DZKA 4URFA 2DTEA 1GL3A 1QP8A 4XRRA 2VYND 1VM6A 1X0VA 2VQ3A 3BHIA 5A1TA 2VTEA 1Y5MA 2QYTA 4L76A 2SCUA 3KLMX 1HEUA 1N9GB 4WASA 4A2CA 3AFNA 1U9JA 3L77A 1HKUA 4GX5A 4ZD6A 4GH5A 4D7AA 5FYDA 1SO8A 2O2SA 2BI8A 1MUUA 4XRGA 1RPNA 3LSYA 4AJNA 3CTMA 4RVGA 3RKUA 4R41A 4ND3A 4MVJF 3LC7O 1E7QA 1QYCA 2GDZA 3AY6A 3ETDA 4YAJA 2J3JA 3PVZA 4BMVA 4YT4A 1I2CA 4HFJA 4ONEA 1H9BA 2QIOA 1W6UA 4B3HA 1TEHA 3GHYA 5G0UA 4YVFA 5U1PA 3W1VA 3AOEA 1VRWA 1U3UA 4YQYA 2X5JO 4OM8A 5H83A 3BMCB 4FCCA 3WX0A 4BO3A 3JD1A 4OYRA 3RUEA 5KWEA 5IF3A 1ZSVA 2HK8A 4WLFA 2VWPA 4IQGA 1LRLA 1ZH8A 4XGIA 1UUFA 2HQ1A 3M1LA 2OGUA 3L6OO 3NX4A 2X4GA 4D41A 2V6MA 1U28A 3C8MA 1I8TA 3LT1A 4U6QA 1MB4A 2IYPA 2OBYA 4IZIA 2C5EA 1SZJG 2OP1A 3C1OA 5DDIP 3IOYA 1FDUA 1KEPA 1NFFA 1IULA 1Z73A 1HDCA 3TN7A 4W9NC 4U7WA 1E7SA 2CZCA 3I9OA 4XYGA 4MOWA 1MG5A 3GZ4A 4AJ1A 4JP3A 4BVAA 3PGXA 2YYYA 2WSBA 1UR5A 1XCBA 5TC4A 2TMGA 5L9AA 3GDGA 2JD0A 4NQZA 4RPLA 5EQFA 2DM6A 5A3JA 1CF2O 4U0JA 1P1IA 1NBOA 3VH3A 1KBZA 4FC7A 1EQUA 2Q4BA 2Q45A 3H5RA 3HFSA 3RBVA 5HS4A 3WGZA 1R37A 4QFDA 4NBUA 4PG4A 4JQCA 3RAJA 2HJRA 2HU2A 1GUFA 5IG2A 3DOOA 4CLRB 2C2YA 2Q2VA 3JYLA 1EMDA 2PA3A 3C7CB 1W8DA 3D3WB 5HA5A 4IQ0A 4EGFA 2O3RA 4H15A 4WE3A 5T6BA 2I9PA 4NJMB 4D42A 3MTGA 4XB1A 2ZB7A 1TT5A 3G49A 3K5PA 1M67A 4AJ2A 1NTOA 1T2FA 2XXJA 4FIZA 3NT5A 3DBRA 3E5MA 4NBRA 4PLVA 3G1TA 3QY9A 5TT0A 4M1QA 5JCJA 3NJ8A 3GG2A 4WLOA 5DCYA 4YAKA 4CL8A 3DBHA 3RBZA 4KWIA 1LQUA 3G3EA 3JYQA 3FNHA 3PFFA 3L6DA 3E6AA 4CODB 4LMPA 3R6DA 4ND1A 2NWQA 4CM8A 1J0XO 1DHTA 2FHSA 4YJFB 4BNMA 2OMEA 3MJTA 4MPDA 3PK0A 2Y66A 4RVDA 3QE3A 2O4CA 4DIBA 1UDCA 1R4NB 4A7PA 4E6PA 2DQ4A 5HRUA 2BFPA 1Y8RB 4RPKA 2AQHA 1KVUA 2EF1A 4XZ3A 4JGBA 4WJZA 5DOVA 3BTUA 1WZIA 3GVPA 1TVEA 3TFOA 3KHUA 1JVBA 1QV7A 2ZK7A 5JY6A 3MJEA 1HWYA 3RKRA 4YDRA 2D8AA 4FFPA 2BHLA 4DWVA 1C1DA 4R1NA 5F1KA 4MINA 3HWRA 1NQTA 1WDLA 1A27A 3JTMA 1HT0A 4E31A 2DAPA 2GSDA 2RH8A 1YH3A 5L95A 2EERA 2EP5A 1ONPA 2QRKA 4M8SA 2Q1UA 1GU7A 4XIJA 4BNZA 4CV1A 3H7AA 4CM4A 1NFQA 4JLWA 1E92A 2PFGA 1N8KA 1B8UA 1G0OA 2B5VA 3ETGA 3PDUA 5ER6A 4BNWA 2AQ8A 5BSEA 1L7DA 1HLPA 3WSVA 2CF6A 4RZIA 1JWBB 4DMMA 1HL3A 3D1LA 4E5YA 3NDJA 1LRKA 5ILGA 2ZYAA 3IDSA 2NQ8A 1DOHA 3GN2A 3VZSA 1E3JA 5EINA 4PG8A 2D3TA 5BQFA 3Q2IA 8LDHA 2I3GA 2QX7A 3AM5A 2VHVA 2FPIA 4GX1A 2AG5A 1UZLA 4R1UA 3WOHA 1LRJA 3BMOA 4IPTA 4OHUA 5JDCA 1V3UA 1I3KA 1BVUA 5JY1A 2VWGA 2YFHA 5G0TA 3ZNQA 2IDZA 1GY8A 3HADA 1B2LA 3IUPA 4TRNA 3QVXA 3T7CA 2IEDA 1NXQA 1OC4A 1IPFA 2ZQZA 3RBXA 1ISJA 3O03A 2B35A 2J8ZA 1ZW1A 3UXYA 1GYRA 4EYEA 5IN4A 4DYDA 2YV3A 3DWFA 5EJ2A 2EP7A 4NR0A 1NM5A 4BNYA 2PGJA 2Y99A 3A1NA 1LDMA 4GGOA 4DL9A 2V6BA 1VKOA 1X1EA 2NTJA 3WFIA 4XA8A 4IGFA 1BVRA 4XEHA 4UUOA 1R6DA 1VL6A 3DL2A 3OJ0A 3K92A 3ZHBA 3S2IA 4YPOA 2QG4A 5BNIA 1C1XB 1K6IA 4J1TA 5IZCC 4J3FA 1DBVO 5A05A 3D64A 5L7WA 3HFGA 3Q11A 4XYEA 2D5CA 1E7RA 1KIFA 5DBFA 1E1LA 4FGSA 2EIHA 1I3LA 4A27A 1QMGA 4WEQA 3UKOA 5DCWA 2JFHA 5L7YA 3SLKA 4QFCA 4N5LA 3KOUA 2NVBA 4KUGA 4LCJA 2JJYA 2A94A 1W73A 3LK7A 4XGKA 2W2LA 1TB4A 1EVZA 3JQFA 1PZFA 4W7IA 4AJJA 4XX0A 2WM3A 3TL3A 1EZ4A 4P4GA 2CD9A 4CMKA 1DDOA 3WGGA 3WDSA 1I3MA 3NT2A 3I9KA 2I99A 1PS8A 1HSZA 1TXGA 5JYAA 1IB6A 3ROQA 4TMFA 1QYDA 2Y0DA 2X58A 3ZNOA 3FNGA 2OUIA 5I7SA 3INGA 4IQ8A 4N5NA 4X54A 3VZRA 1A4UA 3UFXA 4ALLA 1ZFNA 2I76A 5HWSA 1SB9A 2QRLA 1HZJA 5JPIA 2EKLA 1HDZA 1H0KA 2GN4A 2Q50A 2R6JA 4R1TA 3VH4A 1H6CA 2Z1MA 3LC1O 2ZB3A 4BGIA 4WKGA 1X7DA 4Z0TA 4BL5A 1ONOA 4BO8A 3CEAA 1EFKA 3GN1A 3G1UA 2FMUA 1T2EA 4BKQA 1U5CA 4OXYA 2VTDA 4WEOA 1IE3A 3K96A 1EUCA 3GEGA 3W4IA 4J43A 1E7WA 3GC6A 3F1LA 3F3SA 4KZPA 3TL2A 3AOEC 4AJ4A 1U3VA 5A5FA 3GOHA 5EIOA 2VHYA 5F5NA 3RU9A 1A7KA 3NDRA 2VYVD 3H9JA 2X5KO 4I5EA 5AXDA 5BR7A 2QZZA 3H8VA 2VUUA 4KDFA 3U9LA 1MG0A 1G1AA 4NU5A 1LLCA 1SEPA 3QIVA 1YBAA 4JJIA 5EESA 3ETEA 3TOZA 1DRUA 5G2OA 4PGFA 3F5QA 3GLQA 1U3WA 2HMSA 3DB2A 1TT5B 2CNBA 4UUMA 5CEFA 4TKMA 3ZWXA 1U7TA 3RCBA 4YB8A 3H65A 3OFSA 1KVTA 2D0IA 1Y5RA 2JFFA 4OXNA 3MTJA 3HB5X 3EMKA 4B79A 2GZ1A 3EY4A 3F5SA 1GZ3A 1QSGA 2CY0A 3WQSB 5IDWA 4JJGA 3VPFA 1B16A 1LU9A 3MJSA 1CEQA 3LT0A 4Z9YA 4K6CA 3JQ9C 1NQAO 4BO4A 3KB6A 1YB5A 5T67A 2FR1A 1XG5A 3D0OA 2EG9A 1DAOA 2RIRA 5KIAA 1NVMB 4YAIA 4A0SA 1VJTA 3M2PA 1AXGA 4NHEA 4TRRA 3WGYA 2A35A 4BKRA 5A9TA 4II2A 1GD1O 4MVJM 2AE2A 1YDEA 2HMWA 4J0FA 3PHLA 2ZB4A 4J1QA 4GSLA 3CKYA 5G4KA 2C5AA 3EVTA 3WIEA 3VPXA 2W8ZA 3G17A 4DA9A 1EFLA 4EZBA 5C7OO 1Q0LA 1FJHA 4ZGWA 3D4OA 4W7HA 4OKIA 3KRTA 5TJ9A 4GLLA 2C7VA 4QX6A 3GG9A 4DPMA 3BMNA 5CDSA 4R51A 4YA6A 5TGDA 2R2GA 2IRWA 3ASUA 4GSKA 2I6TA 2PZJA 2E4AA 2GD1O 1T26A 3D4PA 2G17A 4BNIA 1A7AA 1N92A 2FZWA 3I9LA 3MEQA 1X7GA 3ADOA 4XYMA 4GPD1 4QEDA 1E0DA 2H6EA 4OMUA 1JQBA 2E48A 4QUKA 5LCXA 2HDHA 3DO5A 1UP7A 4J49A 3ZCXA 3KZVA 2RBEA 2ZTMA 3OEYA 3DAGA 3M1AA 3ROPA 3VKVA 1YO6A 3S1LA 1A5ZA 4CM4B 3DXFA 4ZA2A 4WLEA 1DEHA 1YWGO 3BTSA 3U62A 3DHEA 2POQX 4XKJA 1JLLA 1N5DA 3DTYA 3RASA 4RQUA 4BNUA 1S6YA 2P5YA 2BKAA 2Q46A 3PLNA 1AE1A 4MO2A 3S8MA 3WGOA 5L45A 3IAHA 1KETA 3QV1A 2PH5A 1RYDA 2EKQA 5T8KA 1F14A 4HNHA 2PGDA 4F3YA 4ND2A 2A4KA 2C54A 4CUKA 5I7FA 5JAMA 2GCGA 3NGXA 2YJZA 3EVNA 3QJ5A 2VT3A 4ZU3A 4XQGA 2NVWA 1Z75A 4B3JA 1H2HA 5I9NA 5JMWA 3WGHA 1DO8A 1V9LA 1GZ4A 3AJRA 4E2XA 1LDGA 4P4NA 4BNNA 3ZU4A 3HUDA 4YBZA 2GO1A 1R0KA 3KYCB 4CMAA 1QLHA 5THQA 4E5NA 5JC8A 1SBYA 5A9RA 1WW8A 4LVCA 1VJ1A 3RC9A 3GMDA 3GRPA 3LT2A 5KOIA 1EDZA 2JCXA 1IPEA 1T2CA 5IZCA 3FCOA 3VH1A 3ITDA 1CYDA 4E33A 1A9YA 5FWNA 1Z7BA 2PD3A 2WD8A 2XF8A 1QYVA 3ZGYA 4YRBA 4KUHA 1C0PA 2QW8A 4JIGA 1U5AA 1LSOA 4CMIA 3KYDB 3KEQA 4NJMA 1KYQA 4D3SA 4CUJA 1Y8QB 2ILTA 2ZKLA 2H5LA 4O63O 4J16A 4RF2A 4Z0PA 2G0TA 2NSDA 4Q39A 4B4VA 5C3MA 1XLTA 3FBGA 3PIIA 2BMAA 2HJSA 1GUZA 5JCXA 5I8ZA 2X5OA 4Z9XA 2Q2QA 5M6DA 3A4VA 1EK6A 3IP1A 2Z1NA 2W2KA 1XU7A 4YWJA 2W98A 5CG2A 1Y81A 5ENVA 3BMNB 4TQGA 1IL0A 2UUPA 2EGGA 1B8VA 3WGIA 4XQ9A 3QHAA 1FXSA 3GZNB 5K9ZA 4HBGA 3BTVA 2DC1A 1K6XA 1UH5A 4KP7A 3QVTA 3SJ7A 3ZH2A 2X1HA 1I3NA 3BAZA 3JYOA 4DUPA 5JYDA 2F1KA 1WZEA 5LDGA 3DR3A 4K9DA 2JAHA 3GAZA 4B7XA 4CMHA 4CR8A 3PHGA 5L7TA 3PP8A 1HF3A 4IS3A 2Y1OA 1HRDA 3VPHA 3HDJA 4E2WA 2PZLA 3VZQA 4YT2A 2F00A 4JX8A 3C1AA 2E6UX 4NBTA 4YRDA 2X22A 4CMBA 3H5AA 4J90A 1ZXLA 1VPDA 3OM9A 4MIYA 3C3XA 2FWMX 5HS6A 1T25A 4BGUA 2JHFA 1DB3A 3ORFA 4ALKA 2UVDA 2B36A 1SB8A 4Y6RA 3I52A 2VUSA 4CLOB 1Z7EA 1KC3A 1U7HA 2VRCA 1B3RA 1H6DA 3DMTA 4LVUA 3CPSA 3WYBA 1KVQA 4RPJA 1MV8A 4CQMB 1XHLA 3MZ0A 4PLPA 4Q9NA 5K6AA 4IMPA 2P9EA 4B4UA 4YYZA 1H6BA 2ZATA 2O7QA 2ZB8A 3L4BA 3IMFA 2B83A 3TZKA 4MKRA 1YOVA 4UULA 3ZV6A 5DT9A 2W90A 4PLFA 2BFMA 1ZXBA 1LI4A 1WAMA 3PXXA 3TSCA 4ALNA 3H6KA 3UCXA 3FN4A 2FY8A 5GMOA 3X2FA 1H94A 3DAPA 3KYCA 3JD2A 3HN7A 2Y1CA 4TWRA 4XGNA 4EJMA 5G0SA 2DPHA 4R01A 1JW9B 2VHXA 1YL7A 2P91A 4IIUA 6ADHA 1PJBA 3FHLA 4O59O 4AJHA 3K30A 4XWYA 2VUTA 3DAFA 5A5EA 3RC1A 3PYLA 4TZKA 3K31A 4K26A 4LSMA 4KWHA 3F4LA 4WCFA 3EZYA 4ZICA 3MWDB 5L51A 2HK7A 2AEJA 3PJGA 1YONA 3H3FA 3ZW9A 3GNSA 4QECA 1LDEA 1GDHA 2CMDA 4B3IA 3VTZA 3GQVA 3V2UA 1YB4A 1HYEA 4JN6B 3DHNA 4WCFB 1NWHA 3DZFA 3OMLA 4MDHA 1OC2A 1XIVA 1F12A 4CV3A 2EEZA 4WUVA 4YR9A 3WJ7A 5AVOA 1YQDA 4HUJA 5KKAA 1I2ZA 2YV2A 2ZCVA 3EAGA 5F5LA 1PJ4A 4FOOA 3W4KA 4BO0A 4HXYA 1LX6A 2XOXA 3GT0A 3D5TA 1XWFA 1C0LA 3NAQA 3GVXA 3O4RA 3TPCA 1Q7CA 2NLOA 5KJCA 3AUSA 1DJNA 1AHIA 5CEEA 3F1KA 2WE7A 4CQLB 3C85A 2LDBA 3VKUA 1K6JA 2Q1SA 4QSMA 3OJEA 3OBBA 4CV0A 4BNGA 1ZUD1 4JCOA 1U3TA 3QWBA 2PKQP 2H9IA 2Y05A 4BO1A 3ON5A 3ANMA 2HMTA 3RD5A 3IUSA 4UUNA 2YW9A 1VL0A 3LF2A 4MP6A 4CR6A 3ONEA 5B1YA 3AOGA 4WLUA 2W2KB 1P44A 1DJQA 3GRKA 3UICA 3KBOA 2Y1DA 1EVJA 4CM3A 3ZN2A 5ER9A 1E3LA 1Y7TA 2JD2A 4CMEA 1ZMTA 4NFSA 4OGWA 4RZHA 4FJ0A 4KTVE 5G4LA 1B14A 3NGLA 4IDDA 5CPFA 5C37A 4LGVA 2ZJ0A 4PVCA 2PY6A 3ZNPA 1O5IA 1EBUA 1PWZA 2FPGA 3VH2A 1T1RA 3LU1A 3MOIA 3W8DA 4WOJA 1WPQA 1KOLA 3AUTA 3JD0A 4OXKA 4HP8A 4J4BA 1DRWA 2NUAA 3VAZA 4F45A 3E9QA 3MJCA 2H63A 1XR3A 3QSGA 5EQDA 5IXYA 5KNLA 1JKFA 1KC1A 1L1FA 4PLYA 3E48A 3NYWA 5LDHA 1PQPA 3UAGA 1WLYA 2P9CA 2HKIA 4PRKA 4LCEA 5DZSA 3E8XA 3JV7A 4ZQFA 5CDYA 1P33A 4GMFA 4R3WA 1KVRA 5TIIA 3RUCA 3DEYX 4MVJH 1DIHA 1LLDA 3WGQA 1M6WA 4PLZA 3CSDA 3N58A 1D1SA 1E1KA 3HDHA 2NV6A 3B1KA 4Q3DA 3W8FA 3UHAA 3VVCA 4CM5A 4I9NA 4NBWA 4EUEA 5JDCC 2CUKA 1BHSA 1YVEI 5DF1A 2W4QA 1PIWA 4J1NA 1XA0A 3Q2KA 4D43A 2AQKA 3HDYA 1P1FA 1GCUA 5AXAA 4BKOA 1UXHA 3DDNA 4EUHA 1DHRA 4G2NA 1LUAA 1C14A 2VYNA 3JD4A 4CMIB 1YDWA 1UAYA 3AFMA 3M6IA 5JDIC 1XEAA 4AVYA 1V8BA 3KTDA 2NTVA 4NPCA 4JBGA 2BFOA 2YDYA 2RCYA 4BNTA 1T4DA 3ZV3A 4I5GA 3QVWA 1NAHA 2ZTLA 5U4QA 3MJ4A 2E37A 3FWNA 3RFTA 4DLBA 1GQQA 4DQUA 2R00A 1EDOA 3OJLA 3JQEA 4J6FA 1U2DA 1G6KA 4R54A 1E7YA 3RUIA 1VJ0A 1Z82A 2UAGA 3PIDA 1E7MA 1Y8RA 5TS3A 1SEVA 1P0FA 2VCYA 1SAYA 3UN1A 3GNQA 4EUFA 2OORA 4GWKA 4OOFA 2UUOA 2VNSA 4PZCA 3RU7A 1ULUA 4FW8A 2YDXA 3PWKA 4OL9A 5JLAA 2DUWA 1C0IA 1GZ6A 2O23A 2DKNA 4BMNA 1ADFA 4O6VA 1J6UA 3RUDA 2EJVA 3C24A 1MLDA 3TWOA 3SX2A 2B0JA 4YQZA 4YJGB 5CFZA 4CPDA 3GEMA 3GGGA 4JP2A 2GASA 2V7PA 3BMQA 4BNFA 4PIVA 2DBRA 2GNAA 2GUGA 1LBEA 4UVHA 4IIVA 4AJOA 1UP6A 4XJSA 1I33A 1CETA 2GERA 4E2ZA 1UZMA 1R4NA 3FR8A 3WQQA 4YTEA 2WDZA 1SOVA 3D4NA 5F1OA 1HLDA 1W4ZA 3A28A 2ZIZA 4R5HA 2ZYGA 1Z74A 3AU8A 4D3DA 3IP3A 4D0SA 1EEHA 2C29D 4J1SA 4FPXA 5L40A 5U9CA 4IXTA 2ET6A 5C7IO 1A71A 3H2SA 2XAAA 4PZDA 3U3XA 5AXBA 4RF5A 1IY8A 2B37A 2HMUA 1M6HA 2OP0A 3PHIA 3V1TC 4MP3A 3V1UA 4QT0A 3F46A 2B4QA 4II3A 5K0ZA 4LISA 1C3VA 1WMBA 3NEPX 3ZU3A 4ILKA 4P38A 5JC1A 4ID9A 4KDEA 1Z6ZA 4J7CA 1LNQA 3RVDA 3BMQB 5MDHA 4D46A 4N18A 4TSKA 4K6FA 2IZ0A 4XYLA 5T57A 2VHWA 2YUTA 3PLRA 3H5NA 1GEEA 1KEUA 5J9GA 4PG6A 3GDFA 5T73A 1U2GA 4CMJA 5KJFA 4HADA 1LQTA 4L8VA 3COSA 5GY7A 1NPDA 3WLEA 4M86A 3VTFA 2NU9A 1B15A 4B4WA 1O89A 4E3ZA 4ZJUA 5AOVA 2UYYA 3C7AA 3S2EA 4BO7A 3GPIA 1NP3A 1ISIA 3V2HA 2VRBA 4BIIA 2FZEA 3QWHA 2ZQYA 2X23A 3AI3A 1NVGA 3AUAA 6LDHA 2OO5A 2DFVA 4DPLA 4IDGA 1PEDA 2D2IA 1J49A 1BXKA 4CLEA 1Y6JA 1KS9A 4MVJP 2PD6A 1WMAA 3ONDA 3PQFA 2WMDA 3L4BC 4GI2A 1YOVB 2HMVA 5B4UA 1J4AA 3WICA 4YJDA 2OXIA 4EI2A 1RYEA 3JQ8B 3U0BA 4AJEA 4IZHA 1F8FA 4LSWA 4R3NA 3QA9A 5BSHA 1ML3A 2AHRA 2BD0A 3CINA 4BB5A 1DSSG 3DOJA 4JBIA 3D3WA 2Q99A 1MFPA 5FI3A 5JDIA 1PJ2A 3IJPA 3Q9UA 1IYZA 1V35A 3ZHYA 4C4OA 5JBIA 1VKNA 1LEHA 1PGQA 3I83A 4IJUA 1WP4A 4JBHA 1E3SA 5A3VA 3WLFA 2OZPA 1MXHA 1QORA 4BNHA 4BMSA 3RWBA 3ZWBA 2EHDA 3V2GA 5FFFA 3ICPA 1QRRA 1HXHA 2OFPA 2J5KA 3ENKA 5DBGA 4ZQEA 4LK3A 3ZWYA 4RLSA 4XQEA 5L3ZA 3PQEA 4N7RA 4A5OA 4BKPA 1KY4A 1BG6A 2O48X 4YJHA 1X7HA 4FOSA 4LW8A 4DPKA 2J3HA 3L4SO 2NVUB 2VWQA 2X7HA 1YS4A 1JKIA 4ESOA 3OF2A 4M54A 1PGOA 3DZJA 3JQAB 3FPCA 1ONNA 5JNLA 2DFDA 2VYVA 1O95A 1XQ6A 1KY5A 4RQTA 3E82A 4D44A 4CM1A 1PQWA 1X0XA 4CM6A 2HK9A 1AGNA 1BDBA 4RF3A 4J7UA 4FFMA 1GFSA 1FK8A 2RAFA 1CWUA 4BNVA 3PWZA 4YT5A 4ND5A 3KO8A 3P19A 5COBA 1HETA 1YXMA 3RUHA 2CVZA 3I9NA 1V3VA 3INRA 4AJPA 3BIOA 2AEMA 4INAA 4DXHA 5BNFA 2FOIA 1XQ1A 2JAPA 4Q3CA 3KUXA 1R0SA 5I8WA 3SVTA 1EUDA 1PWXA 3K6JA 2C82A 2YHUA 4RLHA 3HZZA 4R16A 5A9SB 1PGNA 1TI7A 2EW8A 4F6LA 2JL1A 3WQRA 3ZZNA 4IUYA 4O1MA 4FBGA 3NV9A 4R68A 4TRJA 3GMSA 5HTOA 3AM3A 3F6YA 2HSDA 3UF0A 4AJIA 1EVIA 4GX2A 3MCVA 3DBVO 2IE0A 3E9MA 5JYFA 4A10A 3WMWA 3PQDA 4BNJA 3CH6A 1DIBA 4IDFA 4BO6A 1QG6A 3JQFC 4E0BA 3V5NA 2GZ2A 3PZRA 1G0NA 1CQIA 3ONFA 4I5DA 4KOAA 3FF4A 5ILOA 5A06A 1P74A 4BB6A 4DREA 5MGBA 4I9UA 4U6SA 4B4OA 1U4OA 2VZ9A 1HE4A 1P1KA 4WNIA 1XKQA 2OL4A 4D79A 3QVOA 4L4XA 2Q49A 2HRZA 2ZTUA 4W9NA 3I23A 1T1SA 2Y1GA 1I32A 2C0CA 4J2OA 3ZWMA 1KVSA 4Z6KA 2JD1A 4HKTA 1K2WA 5H81A 4BO2A 3EYWA 1LC3A 1LA2A 1R16A 3AM4A 1ISGA 4RCVA 1UDAA 2RHRA 5JAIA 5JE8A 3WG9A 5AYVA 1GUYA 4IDCA 1PQUA 3JQCA 3DZBA 1ZJZA 4Z9FA 2CFCA 1JTVA 1IHXA 3FRJA 2PGLA 3V1YA 1O0SA 1N9GA 3OA2A 1RWBA 3PHHA 2O3QA 2PD4A 4TZTA 2YFQA 1H2BA 5JAQA 5I7EA 2Q3EA 3PPIA 2O50A 3NDIA 4CQMA 2VZ0A 3S55A 1MX3A 1BRMA 3PJEA 3KSUA 3N7UA 3FNEA 4R9SA 3Q3CA 4W99A 3TQHA 1DC4A 3OJFA 4Q3NA 1P31A 4W6ZA 5JCJD 4PLHA 1LXCA 3PRJA 5EMHA 1I36A 4Y6PA 2BGKA 4DGSA 1P45A 2CDCA 3JQ9A 4NG5A 3BHJA 4E5KA 5CDGA 2B4RO 1RM0A 3EGOA 5JAZA 2IZ1A 3Q9NA 8ADHA 1Y9AA 3JD3A 5AXCA 1VE9A 3WNQA 3DOCA 4HFRA 2NACA 1O94A 3ENNA 5IZ4A 4S3MA 1ISHA
chains in the Genus database with same CATH superfamily
1AQ6A 4N0PA 1KDPA 5H59A 1SIOA 4QNRA 2GLTA 3ABRB 5BQXA 1E2IA 1SOAA 2GEVA 5HHTA 1R88A 5LC1A 1Y34E 2COKA 3A9UA 1EWKA 4YACA 5ECGC 5IH7A 1XTSA 5BYJA 2N47A 4NQRA 4QM7A 1N32B 1QVRA 2RH4A 2VQSA 4ZVRA 5J4YA 4N54A 3K70D 1ISMA 1F9EA 5B12A 1U0SY 2WKQA 4MV1A 2R7MA 4KBFA 4B45A 1H6AA 1PS0A 3B2NA 4R7TA 3A1TA 4ACAA 4EZEA 4JL6A 1JFTA 4PF1A 3HCAA 1YZFA 4HB3A 3N2LA 4R3UC 3A6GA 4EWLA 4LXIA 1DQYA 1CBUA 4HFNA 4I9GA 1Q7BA 1J25A 1QV6A 2DQSA 2Q27A 1AHNA 1W5BA 5JZOA 2I2BA 3LF1A 4LA4A 3N07A 3TI9A 2O7NA 1TZMA 5FUQA 2G06A 4P0TA 2HO5A 1HYQA 1TC1A 1FLAA 4IIJA 4F56A 2G1PA 2CUNA 3RC3A 1V26A 3TQRA 1MENA 2DE0X 2P9ZA 2FOXA 2FUKA 1J7KA 4COKA 1SXJA 2KBEA 2WU0A 1ZBQA 3AVOA 3X2EA 2UYQA 5KNDA 2BZSA 1JAHA 5D6OA 2DCUA 1DFGA 2QQ5A 4X0EA 4CFZA 3AJDA 2ATVA 5KKNB 4ISCA 4F11A 3HP4A 4JR0A 4ZT4A 5K3BA 3DCYA 4WL0A 1E20A 3KE9A 4JP5A 4HVAA 4IW3B 3KXPA 3NHYA 1QVAA 1W93A 4MH0R 4YJGA 5DT2A 5EGNA 3CLTC 2ODAA 1JJIA 3OZUA 2WZDA 3T7SA 4E94A 1KO4A 2A3RA 3KWMA 3V1KA 1P4JA 2VRWA 1NZDA 1N5MA 2MIIA 3STXA 4D6PA 5KUTA 4BKMA 1M75A 1QFSA 3LC2O 3KEOA 1TC2A 3CE9A 5DJ5A 5EQJB 2HRCA 1JX6A 3IB3A 2J9XB 3TJZA 1ZK0A 1Q6ZA 2EIXA 4F04A 1Z4JA 3IB6A 4EB6A 2H1HA 2ID8A 1U1CA 1XT6A 1UBJS 2IA5A 2Q6LA 5DWQA 4XQCA 3SC4A 4GIBA 3HACA 2GDJA 4KB5A 6AT1A 1ZN8A 2LCIA 5C4GB 3GJTA 3ROXA 4OQDA 1K6MA 4KR9A 3A4TA 3GELA 3WADA 5K99A 4G4SP 1SN7A 3PX2A 3COYA 1TNDA 4JJAA 2O19A 1W2GA 1G66A 2AJCA 4JUDX 5BRAA 3F4BA 4K28A 3C8ZA 4AZTA 2WFMA 2NZVG 3IUBA 1JDUA 3DAYA 3PEUA 3L8YA 4JOCA 1BQ3A 1D6JA 2D2VA 2BGMA 3IX7A 4IUDS 4LDNA 3RJZA 3T94A 3TQOA 3S5UA 1NURA 1WVGA 2C77A 4ZQIA 2R8OA 3Q85A 1N6KA 1DDIA 3SI7A 3VDRA 2H4JA 2EXXA 1NM5C 1SC6A 3A06A 3UW3A 2GJAA 4P31A 3U37A 4B6JA 2IZ5A 4NDAA 2GTPA 4DE5A 2P11A 4YEDA 3KQVA 2ZTVA 2ST1A 2IOQA 5BSGA 4E7OA 1WQ3A 4LUCA 2ZW9A 3UKJA 1WJGA 4PX5A 3ZZ1A 5LM3A 2J6BA 4LRSB 4NK4A 3KB1A 2W4MA 4N3NA 1ULSA 4WK6A 3PGJA 2YVQA 1SHZA 4G01B 2I1QA 3D0RA 4NOMA 3TQTA 1RZRA 4HJXA 4UKDA 3CLTD 3ZQUA 4ZAWA 2QK4A 2Z04A 2ZPUA 2FP4A 3FTQA 2ZZKA 4CUZA 3U4MA 1KEEA 4EFDA 3PGKA 4ARCA 1V1RA 1RTTA 1UBFA 3KCNA 2ZJ1A 4B3TB 1G8HA 1NUQA 4UBMA 4EF6A 4I50A 1AXEA 2PBLA 1XMXA 1E1YA 3WZMA 4C5AA 2QR5A 1WKBA 2HF8A 2OZLA 3LUBA 3PQ3A 2A78A 4LGMA 1R8SA 1OE0A 1U11A 3HCPA 4NABA 3QKRB 5CPBA 3WB9A 1MT3A 3PUZA 1L5RA 3USCS 2JGJA 2ZE5A 1D2MA 1EJ6A 3FNFA 4IH4A 1RRKA 1I7SB 2G0AA 3H8WA 4PTZA 2JFVA 4YO8A 2B4KA 2VDLB 2VN8A 3QPBA 1A98A 1N7GA 2P0YA 3M1YA 4UMEA 3NORA 4ZO9A 2RGCA 4GM0A 4TV8F 3JRWA 3TRHA 2ACWA 2G76A 4JKIA 5BNWA 3D7SA 1Q1AA 1UDWA 5TGTA 3DG9A 1BW9B 1R0RE 1Q0QA 1SHLA 2QSJA 2CJFA 4TVSA 5DIZA 5K5EA 4LRQA 1P61B 2RJNA 4UE6A 4MB2A 1ZQ1A 3N7TA 4NDNE 3BD6A 3FJ1A 3UJDA 2FMFA 3HY6A 5GADl 1XMIA 2WW8A 4FMPA 1U8YA 3QYFA 3B9PA 3QOFA 1ZJ6A 3GJSA 5C18A 4BMDA 4IG9A 5A4IS 1OZHA 4MJ7A 1E0JA 3HSYA 1FDOA 3HA5A 5J43A 4JP8A 3VYWA 5DBEX 1R2QA 2BUBA 2CB0A 1WWKA 2IE8A 5EKUA 4B74A 3U5ZB 3ZHQA 1GQ2A 3EIUA 3TGPA 1DGQA 3E03A 1DRJA 3OCVA 2R2AA 3TDMA 4EMSA 4KSCA 1AH2A 4FDLA 3I73A 4KDRA 8ABPA 1NVUQ 2NADA 1DC5A 1NDQA 1TQ6A 1VJGA 1G20B 4GC5A 4ZOLF 2H7YA 5DTMA 3CUSA 1N4DA 1XOIA 3VSDA 4QOFA 4M1EA 3ZBQA 4YCSA 4QATA 1NW8A 4GQIA 2HUNA 4CF5A 4JEHA 2TMYA 2IX3A 2NZ8A 2VPWA 1FRQA 4LJ7A 3PHJA 4ZU6X 3QEBZ 3DKVA 4MEAA 4HY3A 2V7BA 4E22A 3PDIB 4RIIA 1NMEA 1EWRA 2LXNA 3KQSA 3GRVA 3DVRX 1G9SA 3WBKA 4EO7A 4NMHA 5KC8A 3T7EA 1JIQA 3MLBA 3JR7A 3FCCA 4K88A 4N0EA 3QBJA 4MUFA 4WHMA 3K2QA 1EVYA 5IBPA 4MAFA 4L3VA 3T4EA 1EGMB 4WSOA 3WLAA 1MF7A 3RJMA 4Q00A 2IHVA 2PYIA 3L07A 1BKDR 1P8JA 1Q0HA 4RYDA 3EW7A 1ZXXA 5JW6A 2H2IA 3I37X 1VKJA 3L8ZA 4Q4HB 2B21A 2ZEJA 4F2DA 1COWA 5FHRA 1FRVA 3WNBA 3B5IA 3P2MA 4QASA 1CQIB 1ZIDA 2J7KA 1I2AA 4FLEA 4OHPA 5LWQA 3FYCA 4WA8A 3LZ6A 4FI3F 1Q0TA 3RRXA 3SX4A 4QGAA 1CHNA 5HRCA 1TO2E 3TPFA 5FLYA 5C35A 6YASA 4YASA 4DQKA 9MHTA 1NKTA 3U09A 1EUYA 2W9XA 3K8YA 3K32A 3WNVA 5C1PA 3CZPA 2UZ0A 5TX7A 1HYHA 4YHHB 1A4RA 1BROA 1L7NA 1UJMA 2H5EA 3KUUA 5AOBA 2RAVA 3T3IA 4MA5A 3FPEA 2IT1A 3R7AA 1RFGE 1YNOA 2E49A 2PEZA 1BYIA 1RAHA 1N1EA 2ZRQA 5KNDH 2YMQA 3K4QA 3GAMA 2HA4A 1HEYA 1PS9A 3IP5A 4BMOB 1DJLA 4JHXA 1XDSA 3HN2A 2LV8A 1RS0A 3KPJA 5EJEA 4PO1A 2F8TA 1H3NA 2NU8A 3OIFA 1OWMA 3KUKA 1CP2A 1YV9A 3N3AC 4GKJB 3DZ3B 2HXGA 2WYOA 3QXJA 1L4KA 4DR2B 3Q1LA 3PYMA 3AK4A 3D3EA 4XPZA 1QYWA 1OKKD 5K6RA 3SC6A 3WHIA 3CH5A 3ZW7A 2OM2A 2WSMA 1SY7A 3A1UA 3PV0A 2D4AA 4X24A 2QORA 4Y67A 4ZI7F 4M89A 3BXGA 4DDMA 3PQ6A 1QO0D 1F8YA 3L7DA 2HX1A 1C5KA 5HF9A 1J22A 4MA0A 3VVBA 1H66A 2GSWA 3KXDA 2PK3A 3VU9A 4EGQA 4R1QA 3QFSA 2XXAB 1MP0A 1QB8A 2CLIB 4TWZA 1U80A 5HM8A 4AZSA 4BS9A 5CFLA 1NF2A 2AKYA 2V6FA 1Z26A 4MW5A 2QD2A 1ZSYA 3N6XA 4LYGA 1RMTA 1YL6A 3C43A 4UNPA 5IK2A 4C4TA 5L6MB 1JBKA 2Z3WA 2FCRA 3AHJA 4NH4A 1YC5A 3R0JA 4LEIA 1PR9A 3NHSA 4RHUA 3MJFA 1EFTA 2ZRAA 4PXSA 5NLLA 4H7PA 1P77A 1XTIA 1QIDA 3JQGB 4NCJA 4UVDA 3BSSA 5IRCD 5CCBA 1A5BB 5BY2A 4MV6A 1WPXA 4D4MA 2J31A 5ALQA 3T7AA 4X20A 4OB7A 4HDNA 5GONA 2CCGA 3PS9A 4QTZA 3UKDA 4BUCA 3EAFA 4JR2A 3Q3HA 4OF4A 4I08A 4YAGA 4FMCF 4BC1A 3B3GA 2CZGA 3AIMA 3BTOA 1PZXA 5LPNA 2ZUFA 4MS4A 2HMAA 5B3AA 4D45A 1RHJA 4R9RA 4R31A 1AK1A 2H57A 4GKAA 5B4VA 2CDBA 3VZCA 2AC2A 3DLTA 4LHEA 4YP9A 2C9YA 1CU1A 2V4MA 5BW6B 5DHUA 4TZ0A 1JKJA 1UXJA 1E1DA 2O3JA 4QUJA 1E6UA 2N3ZA 3PQ4A 3W2EA 4Q7EA 1I6WA 1U1EA 2I6XA 3GEBA 5ED4A 2PYZA 3CBQA 3F9IA 2DJ5A 2R44A 2NTYC 1NE2A 3DYIA 4L9RA 4BJ5A 3RU2A 3P0JA 4OAQA 3CNNA 3GLVA 1LSUA 1AA6A 1JN0A 2ODEA 5EUCA 4R7GA 1G3QA 2QTZA 1ECFA 5DNWA 2JCVA 5A4KA 3PICA 5JALA 2N0SA 4XSVA 3QVKA 3EY9A 1F4LA 3L93A 4JEIA 3ZYZA 4RF4A 3HMQA 4E07A 2B6HA 1FMFA 3AU9A 3BE8A 3NH6A 4GRDA 3VVLA 4B1FA 3M6AA 4A5SA 2J0QA 1S7CA 1LVHA 3H1FA 4DR4B 3O9ZA 3SBXA 3E2IA 1WSWA 3IKTA 2VHUA 3GPLA 1WMDA 1D3AA 3P7MA 4M0CA 1ZK2A 2LNDA 4XASA 4XEUA 2PDAA 4GUDA 4RPCA 3RFXA 1YRYE 2WJYA 5DM0A 1AOXA 1BN6A 3IAM6 3VKHA 3LLSA 1BE1A 1BXGB 4DMGA 1DIAA 1SRRA 1UBRS 3OU7A 5ARCA 3R75A 4EI8A 3HWSA 4DW8A 2IZZA 1KQOA 1SUWA 2WWHA 3U7RA 2D5LA 3JVDA 1SUIA 2OQIA 4K5QA 3OX3A 1ZC4A 3MWFA 2Q6TA 3AXTA 3AERA 2V7UA 2GRUA 3K15A 1IWPB 1U1FA 4UNIA 4G5FA 4BV3A 1VBMA 5TNXA 4CTJA 3EEYA 2CSUA 2VUHB 4UM9D 3W5HA 1P91A 2I7VA 3FPAA 4ZT3A 3GOQA 4W4TA 3COZA 1Y6QA 1J8FA 1ZI9A 3QWIA 4U7FA 2OXTA 3R7NA 3VC3A 3IPXA 3V8MA 4J7AA 4PG7A 4UREA 3T1HB 3B20A 3O8NA 1XDWA 3HYRA 3HJBA 1NPTO 2B4YA 2JRLA 3BRSA 3OE5A 4M0FA 4M7RA 4GRAA 1MOSA 4HWKA 3QUSA 1UKVY 4YJFA 2OFXA 2OD7A 3HU3A 4YCBA 3MS4A 3PQVA 3OP4A 3A8TA 1P4RA 2QTCA 4HNRA 4O4IF 2E4ZA 2Z5GA 1A97A 2HYDA 3ITNA 4RQBA 1QB7A 1EE2A 5J2UB 3LOUA 4Q19A 1RW4A 3LGXA 3K73O 3NTRA 3H2YA 2WTNA 4BEVA 4HUTA 3Q8KA 5EUMA 4IYJA 3IQDB 1F17A 1TVKA 4P7BA 1Z39A 2BFCA 1N2JA 4A82A 1Q3TA 5CD9A 4BPBA 2W0MA 1WUTA 2PKWA 2R7KA 3EBPA 3VO9A 1M1UA 4DN6A 4M6WB 2FU5C 5AVXA 2WZBA 1FFXA 4NNJA 3BYZA 2C96A 3DTVD 4M53A 4CYMA 4DTIA 3T1OA 4HQRA 3EXIA 3X2SA 3NAGA 3JYNA 3WL4A 3P4XA 1PU2A 1KU0A 3NLLA 4RPGA 1XBTA 4RJTA 3WR5A 5BSRA 4ZALA 2YYAA 3DV9A 5DGDA 4DR7B 3WBBA 4AX4A 1P1BA 2PKYX 1PTJC 2GF2A 2J32A 3K16A 4WNCA 3WRYA 4KZKA 2ZI4A 4P33A 2DWUA 5DI3A 1ORVA 1CZOA 1O8CA 2P40A 2YOFA 3KJXA 4MMYB 3HCOA 5ISMA 3U4IA 4J3NA 3V3KA 1Q91A 3ZIAD 4UEKA 1QLJA 1ZGAA 1YU6A 3QLJA 3R7SA 3R74A 3L79A 4AKSA 3WC4A 3SD7A 4BLWA 4H6VA 4K8OA 1ZESA 4GXTA 4BKUA 1JH9A 3S4YA 2PQ6A 1O94D 4MVWA 1XZ8A 2XW6A 5ES3A 1HI9A 4W8HA 3UMFA 1CW2B 1NR7A 4BP8A 3EN0A 4PHTA 1ZLXA 4DV6B 2FDCA 1LDYA 1SZDA 2O20A 2PO7A 4QJIA 3KEMA 4V1CA 1VG8A 1TJNA 4F8YA 5LIRA 1Z5ZA 1A2BA 3LY9A 2ZSIA 5C7LO 5L6LB 1NC3A 2OCGA 3LXXA 3Q98A 4PPNA 2M6LA 3GLGE 3IUNA 5TEWA 1JZQA 1UEIA 2PL5A 3DD1A 3GEPA 5F3WB 1RXUA 2C0PA 1QU2A 4KX5A 1L5WA 4X97A 1LS6A 4A03A 5F12A 2P6UA 2BI7A 5BOSB 5C9ZA 3A9SA 3H19A 4B3RB 2V58A 1QG0A 2VL7A 4ZVNA 3DVQX 1OHHA 3OIVA 1F0NA 1QUFA 1OI7A 3FTNA 3G1WA 1WZCA 2HHAA 3JQDA 3QVJA 1QR6A 5CCDA 3TDKA 4BUZA 2H9AA 2QP4A 3AC0A 1IEQA 5GONF 1UBSB 3HO1A 3AY7A 3IR6A 1ZU5A 4XFKA 3O8LA 3CNEA 2FVXA 3F3KA 4L72A 1A50B 3R3HA 4O5OA 3JVEA 2PLRA 1E6EA 2AX3A 2CXUA 2FWPA 1SIBE 2JAQA 2HNAA 4TL6A 3E84A 4YMGA 3HKEA 3VNSA 1WXXA 1P8AA 3FUVA 4JJ8A 1XA4A 2FPUA 4KAJA 3WL3A 4EA9A 5I5EA 1IZYA 4J0GA 2W6IA 4N01A 5CU7A 4OMCA 4CTMA 2NU6B 3KTAB 2YIJA 2QUJA 2D59A 4M21A 1W0JA 4PC3A 1MA0A 1XTZA 2FR0A 2FN7A 3II6X 5H80A 2J3KA 4UPEA 1A1VA 3A10A 4DEVA 3ZE9A 5J1SB 4QRHA 4FGJA 2DWPA 4W63A 1WU7A 5G3ZA 1NSYA 4FHEA 3CQ9A 1SK9A 4I3FA 2VDQB 3C6XA 4IS2A 3ST7A 3ANXA 2XMGA 3IP6A 3PGMA 4OVKA 3EARA 3EG9A 2EFYA 1ADBA 4UEJA 4CMCA 1D4ZA 1URPA 5LP6F 1D7AA 3LUAA 2BKVA 2AMFA 3PFGA 5K05A 1B4DA 1T2NA 1Z4KA 4GXQA 3FMFA 3OLZA 1I7DA 3G7NA 3O84A 3FJYA 4QO8A 2ZCUA 4I4IA 1QH1B 2F48A 1D5WA 3CRQA 5FWYA 1KAEA 2WWRA 3L6CA 4GM4A 5B37A 3KV3O 1JU3A 1RJEA 3HKDA 4OB6A 5T7BA 2P4SA 2JZNA 2JKVA 4IDHA 2V7QA 5I9MA 3TOXA 2Q8QA 2P3QA 1G42A 5I7VA 4XIYA 1VMKA 5B64A 2YICA 5AHRA 1NULA 4BQSA 3IR7A 3HBMA 1U63A 2ZVQX 4MDYA 3OOEA 1VIAA 5E7QA 3GUYA 3RM3A 3BZUA 3SLGA 5BORA 1KY2A 2DUUA 1NQ5A 2DBVO 1SVKA 2AFIA 5GV8A 1PVVA 2NNWB 2XKKA 2WJGA 3I5XA 1PD0A 4JVSB 4ZT5A 2BUAA 3C15C 2AFHE 2EGHA 4KH0A 1QKIA 4MPPA 3RH0A 4IJWA 2V45A 2XUZA 1B7GO 4D9HA 3PC8A 1O7JA 5HG0A 5BWBA 5HUHA 3UMMA 1W0CA 3MPUA 3W8NA 2QMEA 1NATA 3O8QA 4J76A 4PIPA 3UAYA 2VHJA 4MUJA 3KPWA 4LNUA 3DZ6B 4TYYA 1Z5GA 1WXDA 3IHKA 1X7XB 3GRYA 2VAXA 4QGFA 4RFLA 4EHFA 4ALIA 2I3AA 4RVFA 4Y1RA 3RDPA 4JAVC 4JA0A 1FNCA 2NTNA 1N7HA 1B0AA 1X74A 1NZJA 3UCEA 1ZK1A 1KEEB 2YNMC 4DC0A 1ZRSA 3RUPA 4DV4B 3MN1A 4Z51A 3SIXA 2VP3A 4GPTA 1YHYA 5F2OA 5IXJA 3I0NA 3I2FA 1ZGCA 4O4IA 3DZIA 4LXGA 1I1HA 1VIDA 1T2AA 1G4AE 1GKKA 5TRTA 4NCBA 2JDID 3H05A 4RL6A 1A9XB 1CE8B 1YQGA 4MB6A 4Z5XA 5I3ZA 2AKEA 1V3TA 1XGKA 3IOEA 4AKHA 5F21A 4ZTZB 4MWGA 4L74A 4MYDA 4L78A 1U1IA 1U6JA 2C07A 4KR0A 5K0CA 1SVWA 2IH2A 3SYRA 3WL8A 4BVHA 2WD7B 1K3UB 2O8FB 4DJTA 3N8GA 2IODA 5E1MA 1NVWQ 3LWZA 3LD9A 3D8NA 4XAQA 4P2GA 4QJ3A 1R18A 3U7IA 4IEIA 2HLNA 4E11A 4O0LA 1WO8A 3PTZA 3WLJA 1RM3A 1US8B 2FEMA 3KOMA 2NNLD 3NNDA 2BTQB 1ISRA 3OPYA 2O07A 3OUZA 4E13A 2Q1TA 3DLIA 3Q5EA 1XUOA 1EZ1A 1R3DA 3AJ9A 4WK2B 4F3CA 1AO0A 1K5PA 3IQXA 1F5NA 1N5LA 4GLBA 2VH1A 4OLHA 3C2QA 3HR4A 4CFYA 1E9CA 3T7JA 1E2QA 1MB9A 3PUYA 4DG9A 1EP1B 5DKFA 3DZ4B 1ZOSA 5ALSA 3S5JA 3GAAA 4POOA 5KMGB 5T8KC 2X8WA 1ZJWA 5JJLA 1E2KA 5EXSA 3BB4A 2OHXA 3U3DA 3H1PA 5DN6A 5AQ1A 1NW4A 5BOVA 3CXUA 5H82A 2YQ4A 4DDWA 2MSCB 5CEJA 3H8JA 3DTTA 1XAIA 2H51A 2F43A 3FPKA 3KYBA 3OJXA 2H1RA 3LYAA 4P3NA 4BQQA 1G9TA 1NR1A 3DEIA 2Y77A 1KZ6A 2R751 5SZKB 2JASA 5AK6A 2C5BA 4JB0A 1JQJC 3EJWA 4BTEA 4CNBA 3DZDA 5I7WA 1VPLA 5AW1A 2WRZA 4NE7A 2CFRA 4LYFA 4OJNA 4O8ZA 5FWXA 4FDAA 2MYTA 2ZT7A 2R48A 4J0DA 3GU3A 1LBTA 3ADPA 2AXNA 1OW3B 4H1VA 2UUBB 3KB2A 3R1IA 3AR6A 4EFKA 2IGBA 5KVSA 2JIZD 3Q3EA 4FFOA 1YRLA 3H0WB 2XKBA 4QZVA 1Q1GA 2DPLA 3VPCA 3L7LA 4D6YA 4MYRA 1VTKA 4IOMA 3V4FA 4UU7A 1SUSA 2O7SA 3SXJA 5P21A 2PS1A 3GA0A 3A6ZA 3DTVA 4PFJA 2NUAB 3OD1A 4LDPA 5D5QA 5H1YA 1R3UA 3L8GA 1GU0A 1ZL2A 2VSQA 5SZHB 1Q3KA 3R6LA 4UTNA 4MYHA 2X0FA 3GNTA 2CFOA 3JATB 3MTIA 1CB7A 1LVUA 4MIEA 1V2GA 3DV0A 4OHRA 3W5IA 2VK4A 3BCUA 4JJEA 1RWKA 1T3HA 3QYAA 3S0JA 2OO3A 1I4OA 2QW0X 1WX1A 4R2XA 3ZWVA 3I0ZA 4HAWA 3PWTA 4B7CA 3PTAA 4NOLA 1UBUS 4DLZA 1VLVA 4F3TA 1XTVA 3DD5A 3RSFA 4MR8B 2WUGA 4LF7B 4B8ZA 1G5PA 2VNIA 1G8FA 2XUIA 3NS7A 3PDHA 4B35A 2G72A 4V1CB 1XVAA 1YRHA 4V39A 3NBXX 5E4TA 1GXSB 1ZN2A 1J5EB 2QD1A 2Y1LA 2AE1A 2E85A 4H6XA 4PZEA 1NVDA 5BV7A 4LC1A 2ZSUA 3RC2A 3IGFA 3U49A 2H7CA 3AWDA 1X15A 3ILYA 4JI0B 1IPHA 4OSPA 3O1JC 4EDFA 1NVTA 2V8OA 4YT8A 4QUHA 5LNK1 3DMDA 1X1SA 5CDUA 4WK4B 1UZNA 3RTEA 2AOVA 3HQ4O 4L4RA 4J2HA 3HTXA 5KYGA 1TVMA 3DMTC 1WQ1R 2QX9A 2Z95A 5H3HA 2ZCJA 1S8FA 1O9BA 3W9BA 1M76A 1X1QA 1VE1A 4V0OA 5JZSA 3OIUA 2P41A 3G0OA 2A59A 1K8YB 1BOFA 3RYFB 2B9EA 4W9RA 4TKVA 2VQDA 4G0OA 3U6KA 1PZGA 3CIOA 4L5JA 2QRUA 5FNVB 1IEXA 2X0IA 3ANLA 2W83A 5J3JA 1PLKA 2DHRA 4JBXA 4PE5B 1T1IA 1XVUA 5D51S 5AIBA 5BMOA 2OV6A 2Z0MA 5KTSA 4LYAA 3ACDA 3SR4A 1DEAA 1DFHA 1G8SA 4PYMA 3UUEA 3L9XA 3P2YA 4RIHA 4XD2A 3TD2A 2Z5LA 3SEAA 5GGXA 2QT0A 3OWHA 2F6RA 5BMVA 1UBMS 2VOJA 2WF9A 1FFXB 2ZRNA 3GQBB 4AWXA 1C2YA 1K7CA 1NJ1A 1P1JA 5JAHA 1HV8A 1VOTA 4LYDA 3ZDYB 4YJKA 1MC8A 1HDEA 1Z56C 5EL0A 1XMQB 3NV7A 4C4RA 2Y71A 4AW9A 4RESA 1VCIA 2E6KA 2QJFA 3OZAA 1RAEA 3WV4A 4RTLA 3HZHA 4IFEA 1T4MA 2C7PA 3B3FA 5HSGA 1YS7A 1K75A 1IIRA 4JROA 1PR3A 3G9XA 4DR3B 2CF5A 1SQ5A 5LZ8A 3V6MA 1QK3A 1BWSA 3I6ZA 1CJUC 1RLUA 1Q0SA 2BW0A 3EW9A 3KLOA 3DDSA 3WY9A 2P9TA 1QPGA 1DWUA 4GMKA 4L51A 4MWZA 1WDMA 4M1MA 5LXTB 1NC1A 3SX0A 3TZHA 5C5IA 4IYRA 1S1MA 4RTJA 4HNGA 4PWZA 4R8LA 5H9WA 3CKMA 3PEWA 4HDKA 5JMOA 2XUJA 4FUQA 1X7WB 4W5NA 5C1OA 3BFVA 3G2QA 1UINA 3R9IA 4D82A 1EFPA 2J3IA 5CB4B 3GA7A 2J7PA 3ETLA 3QMPA 2Z4RA 4ZVOA 5C81A 4F1KA 4I55A 1SVIA 3JQQA 1QRAA 3LECA 1SUPA 3GLUA 4GT1A 4NU8X 2ODNA 2RE8A 1PG5A 1Z7GA 2GKGA 4JENA 5ESRA 4B9EA 3K6SA 2XRZA 3Q2OA 5C32A 1HEUA 1AZWA 1N9GB 2XB4A 4NPHA 4C4PA 3AFNA 4Z53A 1B43A 3PSHA 1HKUA 4ZD6A 3PUWA 3TI7A 2XWSA 4G97A 4D8TA 3D1VA 3KKKA 2BI8A 3DV0B 1JEEA 3HDTA 4A6XA 4FKZA 4TS1A 1ZGBA 4ATNA 5JJCA 4TLDA 1L4LA 1YRBA 2VVTA 3D6HA 4RVGA 3KKZA 5DXJA 3WBJA 3KJEA 4ND3A 1ODSA 1QYCA 5FPQA 3ETDA 3TJMA 4YT4A 3TSYA 4LX8A 2J3JA 1M72A 2ROQA 5CA0F 4ONEA 3TUXA 1Y7IA 3AKCA 2K7ZA 3OPVA 1W6UA 2TECE 4Q7JB 2A1TS 1TADA 3OQJA 3PNOA 2Y2VA 3AOEA 1VRWA 5U1PA 1U3UA 3RR2A 2QRGA 2B0CA 4PZLA 4NS1A 2GPYA 3TE7A 3LY8A 4C04A 2OLKA 5HR5A 1G7RA 1QIHA 1QX4A 2Q2OA 3JD1A 4KGDA 4M83A 4WLFA 2JK1A 2NZWA 2REOA 2VWPA 3LFHA 4IQGA 4ZV7A 3RS4A 1O97D 4ENTA 1ZH8A 2CLEB 4QSHA 1UUFA 2I2DA 4OAPA 2V1UA 1J2UA 1B00A 2OGUA 3L6OO 4R2IA 4RU1A 1P81A 4AYXA 1U28A 3C8MA 4QPDA 5KNDD 3HB1A 1MB4A 1GRQA 3TMKA 1FPQA 4JLOA 1VSTA 3G7UA 4LWQA 3MSCA 3NONA 5BN4B 3R5FA 4I55B 2FMTA 1O57A 2PUFA 5A4JA 3AJAA 4LQCA 3U3MA 2GF0A 3UANA 3IUEA 5DDIP 1NJ5A 5KQGA 4BRWA 5KVAA 1B6SA 1C7RA 1HDCA 1UT6A 2XRFA 3TN7A 5EIFA 5BN3B 5HKKA 4YUVA 2ZR8A 3SYLA 3ZHOA 4W9MC 4BPRA 4V0MA 2ETVA 3GFPA 4P54A 4CI0B 2CZCA 2K6GA 4XYGA 1K4MA 4H7KA 5ALDA 4JP3A 3PGXA 3SKVA 5DHQA 4JY7A 5AK4A 4JMPA 1X8XA 2TMGA 4KXUA 1P2VA 3GDGA 5TC4A 3VZBA 3MAAC 1X77A 3AHGA 3HGTA 2YZKA 1P1IA 3QPUA 4D80A 1EQUA 5BQOA 4ZI2A 2PUBA 3LHIA 5FPHA 1QIFA 3TBKA 1KI1A 3KKEA 1WVMA 3OFKA 2IIQA 2JFNA 3G5MA 3WGZA 2IUFA 1R37A 4XLZA 1Q7RA 1DT5A 1YR8A 4DCGA 2FWJA 4PG4A 3W2FA 3OCWA 5JS8A 1US8A 3RAJA 4L7VA 4ECAA 4YPVA 2JA1A 3DOOA 1W1IA 5ESWA 2C2YA 4CLRB 3YASA 2Q2VA 2DYKA 2I3ZA 1DG9A 1W8DA 3QKTA 1AUVA 2WIBA 3W3AA 4WE3A 4NJMB 4JX9A 1RP1A 2ZB7A 4N12A 5CT4A 4NESA 1AKQA 3BILA 3G49A 5ALWA 1WTCA 3ZX5A 3BORA 2XXJA 1IATA 2RK4A 3AV0B 4FIZA 3NT5A 1C7JA 4PLVA 2BFNA 5BYAA 1C80A 2P77A 3LO5A 4M1QA 2XYRA 4B6PA 4I3HA 4NY1A 4IRXA 4AYTA 4CL8A 3DBHA 2Z98A 1JA1A 4KWIA 4RKYA 4JOSA 4M9QA 3T3MB 1NYQA 4OUDB 3ZD9A 3L6DA 3E6AA 1NMXA 4LMPA 3R6DA 4JYCA 1TUEA 1MDFA 1XZPA 2R6DA 3DOHA 4DM4A 5AVVA 4BNMA 3IHTA 1YVRA 5JS2A 2HA2A 1Z35A 2KLBA 1TK3A 3Q88A 1CCWA 4CRWB 4D4HA 4DIBA 1TYBE 4NBLA 1AKVA 5EWLA 1R4NB 3EAQA 5KYUA 2C7BA 2BFPA 1Y8RB 4LTDA 4NF2A 5CYPA 5LLTA 5C0OE 3OLCX 1XCOA 1OASA 4WJZA 3BTUA 2Z4SA 2GXAA 1JVBA 1YI1A 2UKDA 1QV7A 2OCYC 4MITA 4DSNA 5FWAA 3C5EA 1F8XA 5EJFA 2HLDA 3GJQA 1DUSA 4FFPA 1C1DA 1Z5OA 5F1KA 2VLBA 5LL6P 4MINA 3GFFA 1WHSB 1PZNA 2IEIA 3P26A 4J1TC 4NMMA 1WDLA 2R8ZA 5B2ZA 4BLPA 1A27A 2PGNA 1MRSA 5B1EA 5JSHA 5KTYA 2GSDA 5EIEA 5L95A 5FPTA 3TCXB 1SBHA 2QRKA 3AHEA 3LCVB 1N3IA 5FEMA 4Q21A 2QR3A 4R98A 1UKBA 2IOFA 1E92A 1II9A 2V03A 2FQQA 3IT3A 4KFSA 4YECA 3I5YA 1B8UA 1G0OA 2OO5C 3ETGA 3EXFA 4MA4A 1TEXA 3BH7A 1P1CA 5FOWA 1JIKA 1L7DA 1HLPA 4AS1A 4PXYA 2VJQA 1B1AA 4FGLA 4KI0A 4BN0A 2WICA 3W9SA 3AWIA 3UWOA 2K5UA 4DMMA 3MMPA 4TTTS 2N1MA 4TXHA 2OB2A 1C3LA 1Q11A 2RHBA 5D7NA 2YV5A 3R76A 2RJ3A 4F60A 2FDXA 3IDSA 1IXRC 1T4GA 1ML4A 4PAQA 5CDHA 5EINA 4PG8A 2I3BA 4REQA 3N2IA 2I3GA 4HH3C 221PA 4QDKA 1Z2CA 4ZI5A 1TEZA 4C06A 5G3YA 1ZHOA 3COVA 2AG5A 1UZLA 1YDMA 4X90A 2EQBA 2AF4C 3FMIA 3STYA 3UGJA 2FMKA 1A2QA 1LRJA 4OHUA 3TM5A 3U26A 3WOHA 5JDCA 4ZQCB 4BBAA 2JG3A 3ZE8A 3GLRA 2XVZA 3SQXA 4DLKA 2H1WA 1BVUA 3N0VA 3LCJA 4F0JA 1WABA 2XZOA 1EJ2A 3OF3A 1V48A 2WVAA 2QROA 4TRNA 2NYVA 2ZJ7A 2QZ4A 1ZD1A 3NKVA 3T7CA 4DZRA 4XVCA 1OC4A 2ZAGA 2ZQZA 1ISJA 2JLRA 2ZBGA 2QVXX 3OEHD 5BQ3A 2ZE6A 4LJSA 1ZW1A 1XK6A 2QTVB 3D59A 4RQAA 3QTTA 1GYRA 1F3OA 5CIWA 4EYEA 1YCDA 1UT5A 3IH5A 2EBHX 3SVZA 1ZI6A 2X0KA 1N77A 3ELWA 3ZDXB 4Q34A 4DUYB 4YS6A 3U3OA 5D84A 4BNYA 2PGJA 3LPNA 5IM4A 3P96A 3UG7A 2ZUSA 3QX8A 1LDMA 4DL9A 4K9RA 4ENWA 4I50B 1VKOA 2JKYA 3F5DA 1GPNA 1EVLA 1Z4IA 4UUOA 3IBTA 2VI5A 2XJ9A 3IAUA 3RF6A 3ESQA 2K4MA 4YPOA 4HH1A 2EZTA 1JG6A 5DNYB 3UO8B 3SHOA 2RHOA 5BNIA 1C1XB 1K6IA 3OOWA 4IRUB 1NNSA 1MCZA 4J3FA 4UCWA 1YIDA 3S6JA 1KPIA 2R6FA 3PDWA 3TIGA 2ZKIA 2CXHA 3CLKA 3HFGA 4K81B 1UAAA 4O8CA 1MD9A 2D5CA 2GZHA 4G9EA 1D6SA 5DBFA 5HEKA 1VLZA 2YV4A 2YY6A 1QMGA 4WEQA 4ZC1A 3VQTA 5FTNA 5H0IA 1YC2A 2ZR9A 2ZR7A 4EA6A 1KSHA 1OPRA 5T4HA 3WRYC 4L9AA 2AT1A 4LCJA 4ZOLB 3WYNA 1G3RA 1MV5A 3OURA 1FL9A 4B3CA 3WK6A 2Q6KA 4OSEA 3OPNA 3GROA 4BFSA 2O8BA 2AUMA 4IICA 3K71B 4HQNA 1TB4A 1EVZA 2GM5A 1QH9A 4TT8A 4UBKA 1VGRA 5EIBC 2FP4B 4AJJA 3G2NA 1CUJA 2AV6A 3KU1A 2ZRJA 2HA3A 4RJIA 2XRMA 1JNXX 3FY4A 2CD9A 4C3VA 3WGLA 3NXSA 3WDSA 4OQMA 1DU4A 1QHFA 2J0UB 5JZMA 2GBCA 2R68A 2WMOB 4O4HB 2I99A 3AG5A 1UKZA 1XMPA 2IYTA 3ZJYA 4DR5B 1GTSA 4Q9LA 1IB6A 3P9IA 4E03A 5DGTA 2ZIXA 3MGKA 2X58A 4RD0A 3L3BA 2Q21A 3FNGA 2OUIA 4U63A 4ZCMA 5LOVF 1M7BA 3IAS1 2H54A 4IQ8A 2RGBA 4N5NA 5ALHA 1E9AA 3ZDZB 5K20A 2CJPA 4QA9A 1E5XA 4QUIA 4WBNF 3CLHA 1QTQA 1KJJA 1SB9A 1OGIA 1P7ZA 5FQOA 4N76A 4GZLA 3GJZA 1N57A 4R1TA 3C14C 5EFOA 5AKHA 1H6CA 3HH8A 1OU4A 4A2WA 3LC1O 5TE9A 2JIQA 1PT8A 4WDRA 5I45A 2NMVA 1W35A 1VB3A 1PT7A 3CEAA 2Z83A 3BGVA 1SJ9A 1EFKA 3IPYA 3LKBA 3OTWA 2HCJB 4MCIA 2F17A 3QVUA 4FHZA 5BYKA 4P81A 1OBHA 5HCNA 4FP9A 1RE0A 3ZIAA 3KFXA 1AKTA 3HXOA 2DFNA 1YA6A 3NHPA 5FFNA 2HU8A 1SXPA 3G2LA 1U8CB 3EZGA 1RBZA 1EUCA 5WRFA 4CIXA 4UTVA 2ODWA 1E7WA 1FDRA 1L1EA 1MTZA 5E6SB 1LW6E 5I9SA 3F3SA 2AOWA 1XDBA 3WIBA 3WOVA 2A3NA 1E2UA 3WGMA 1N9KA 3M6FA 5K8TA 3O2NA 3BJZA 1U2TA 1W0JD 4YAOA 1A7KA 1GKUB 1UK6A 4I5EA 2D8MA 4E5SA 2Z5FA 2ID7A 3MT7A 3KOYA 1KMHA 1PE0A 2H1IA 2VUUA 1KWGA 3G2PA 3EP3B 3U6BA 1X1RA 1VLHA 3CLRD 1LLCA 1SEPA 1N1MA 2NGRA 3QU2A 4FDVA 3EG9B 4D57A 1NSFA 3H5LA 4KXFB 3IRUA 1WUIS 3JWGA 3IIMA 4IV5A 5G2OA 4PGFA 1P0PA 1U3WA 5HYVA 4OFWA 1TT5B 3ZTTA 4B6SA 5CEFA 2XI4A 3OE1A 4TKMA 5TVKA 1NP7A 3NRJA 3EGDA 1FFWA 1SQ6A 2JGDB 3IAXA 3JSXA 3JZFA 4YB8A 4MGKR 2CLHB 1JI0A 3H65A 3M7IA 2D0IA 4BJHB 1Y5RA 1KI3A 3HB5X 4OXNA 2MSLA 2DFTA 5DSXA 3EY4A 1R9MA 3DYBA 4C43A 1QSGA 2CY0A 4JJGA 1TIBA 1GFZA 1TO1E 1VDMA 1XRJA 4IXNA 3IDZA 3LT0A 2JGKA 4EY5A 5JWHA 5CVJA 2OE2A 8MHTA 1CVIA 4NYJQ 5IAJA 2FR1A 5LBIA 2QWXA 5T67A 13PKA 1YQUA 5LB2A 2EG9A 4RCZA 3U1TA 3W3AD 3DUFB 5KIAA 4DY6A 4YAIA 2PIAA 1UF9A 4FINA 2C4MA 2GEFA 3ZCVA 3KS9A 4S24A 1P75A 2A35A 2WJAA 2QTMA 2NSYA 4K6MA 1YJ5A 1L4BA 2FN4A 2ENUA 2PAFA 2JANA 3E81A 4Y1FA 5A9TA 2ZM6B 1GD1O 4MVJM 2FLVA 1YDEA 4J0FA 4LJ9A 1TMKA 2WJ3A 3QKUA 4MAMA 4RTQA 2J3DA 1ZONA 1F4VA 2QVZX 4UJ3A 2IPXA 5TDHA 2C5AA 1P9WA 3G17A 4ZDJA 5IDVA 4OHMA 3TB4A 1RC8A 1X80A 3RIXA 5C7OO 2ZYIA 1Z8NA 1NTRA 2AR7A 3CCBA 1JDSA 2AD1A 4W7HA 3IESA 1J2YA 3D7RA 4ETMA 3GG9A 4DPMA 3L0CA 3RO7A 3W3ZB 4R51A 5IM4F 2PE5A 5IAGA 1CVLA 4IHAA 1OD6A 1H2YA 2ZRMA 1ESCA 5IASA 1TM5E 1TZ2A 5IVKA 1SU4A 1A7AA 1N92A 1XYVA 2FZWA 4PV7A 1G5IA 3TQSA 1W34A 4GPD1 2XTMA 2DXIA 4PM4A 2HWUA 1E0DA 1FMTA 2LKDA 4MW7A 4OMUA 3PPVA 4W1PA 2DCMA 4CBVA 1XRSB 2QPTA 5IEJA 1Y9ZA 4QLOA 3HKCA 4M4SA 4BFYA 4JI8B 4KQEA 4DJJA 4R0NA 1SVNA