4XGQA

Crystal structure of addiction module from mycobacterial species
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease VapC30
publication title Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Toxin/antitoxin
total genus 46
structure length 132
sequence length 132
chains with identical sequence C, E, G
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 4xgqA00
1TAQA 4MJ7A 2LCQA 1W8IA 5ECYA 3ZD9A 3ORYA 1RXVA 1V96A 2FE1A 1Y82A 1UT8A 5SV2A 3H8SA 2HWWA 5H4HA 5HMLA 1MC8A 3ZD8A 2H1CA 5HMMA 1A76A 1RXWA 3H8JA 5L6LB 5K8JB 3ZDDA 2HWYA 3ZDEA 1YE5A 4XGRA 3DBOB 3ZVKA 4CHGA 1TAUA 5ECDA 3Q8LA 1V8PA 2HWXA 3QEAZ 3ZDAA 1EXNA 1B43A 3I8OA 2MDTA 1UT5A 3Q8MA 2H1OA 2IHNA 1V8OA 3H8WA 5ECWA 2DOKA 4XGQA 1O4WA 1UL1X 3TNDA 3Q8KA 3IX7A 3ZDCA 1BGXT 3H7IA 2WP8J 2BSQA 3ZDBA 5ED0A 1XO1A 3QEBZ 1A77A 5H4GA 2IZOA 5L6MB 5HP4A 3H87A 3QE9Y 5HNKA 1TFRA 2QIPA 5FV7A 4WA8A
chains in the Genus database with same CATH superfamily
3DGEC 3M4JA 2XWQA 1UXKA 4GEKA 4KJXA 4RLSA 3ZU4A 4PE5B 1NZJA 2G28A 3I6IA 2RGBA 2JB9A 3EASA 3P9KA 4OGKA 5DN6A 3WGYA 2C7OA 2HRRA 2PO5A 2HMYB 1STOA 5JMPA 1TZBA 3UXHA 3L46A 4W9MC 1LWNA 4BP9A 2IGTA 1JU3A 1OFGA 2VHYA 4ZZ2A 3OHMA 2E55A 2HSWA 2Z3WA 2NXNA 1U8XX 3K9QO 4CM8B 3P52A 3CLTC 1E9SA 4IINA 4NARA 4NU0A 3F1LA 4X92A 2PUGA 2GZHA 4TWRA 5KKNB 3LM8A 3M6LA 4OJMX 3C3WA 2B0JA 5FPYA 1ZFNA 5A6SA 1WUYA 1O0SA 1KR2A 3BXEA 4NK5A 2OM6A 4GZMA 3RR2A 1FL9A 1XCPA 2OPHA 4DIUA 2O8DB 1PUIA 3H1AA 2C7BA 2QTHA 3NJ8A 3OLWA 4GMFA 3R9KA 4EJSB 5HQTA 1KGSA 3KT0A 1AM4D 1LW7A 2L82A 1Y3HA 2ZWMA 3IP3A 5ENVA 1E63A 4YP9A 5BUZA 2GM4A 5IBQA 2I78A 4DQUA 5KTKA 4NESA 1T8WA 2QX4A 1U3FA 4MKRA 1VMDA 2EC5A 2W58A 3A10A 4RNDB 4MVJP 9ATCA 1E7QA 1VYUA 4HXYA 3Q7PA 2XVZA 1I3LA 4X8MA 2ALJA 4E1BA 4WCFC 2YHUA 1WXHA 3S2GA 2ZT8A 3D1LA 4P33A 3RYHB 1O57A 3CSUA 4YPFA 5H02A 4WMLA 3UCEA 2NVUA 3UOWA 4AJHA 1PEAA 5LU9A 4GBMA 1DRUA 4D82A 1ZK4A 1CUCA 1DTEA 4RADA 3JWPA 4OQDA 2KBEA 4FFBB 1IVNA 3KTDA 3OZWA 1XRJA 1JEQA 4L5JA 4MDHA 2JLBA 3EY9A 5IUNC 5K8CA 3R77A 5IVKA 1NF2A 1K08A 4N03A 2HEIA 1JAHA 3BMCA 5F2KA 5HMMA 2ZZKA 4JAVC 1TT5B 3D31A 4WN9B 2B8TA 5M04A 1D3AA 2CT8A 1FP4A 1MGPA 1EHIA 1W44A 3BIWA 1V2HE 1IIRA 2GN8A 1C14A 3GJ6A 1E0SA 4ZO9A 3X2FA 3BK7A 5B6PA 3KELA 5BWMA 5KYVA 3O31A 5HUQA 1P2BA 4XVHA 3U3ZA 3LPLA 5TC4A 2G08A 4BFVA 2HNAA 4CCSA 1YC2A 4LCBA 1KI7A 2XCUA 4AVYA 4DRXB 3AEQA 3X1ZA 3THXB 2CHVA 1PNTA 3RS5A 2NACA 2F00A 3RC7A 1P2DA 4Q4JA 4CUZA 3EQ2A 4PAGA 4EMSA 1N7GA 3VR4H 2PMKA 3IFSA 3JD0A 1Y5MA 3KALA 3GAFA 1QX3A 3PR2B 1T5LA 2IUEA 3KZVA 1ES9A 2D1YA 2WYUA 4M46A 4TLLB 5A4FS 4NF2A 1A9XA 1F9AA 1K8RA 1XRNA 1I1HA 2C2HA 1S2MA 2ERYA 3C45A 3M2TA 3I2IA 3O9MA 3V6LA 4ARAA 4DIKA 3AVTA 4DCTA 2A6PA 3V4FA 3KB2A 2R8ZA 4UVHA 2IHKA 1CQJA 5CIQA 5F1OA 3IO5A 1XMIA 1JLKA 1KI3A 2MSCB 2X3YA 3PLRA 1CY4A 4RLQA 3WVNA 1ZXXA 4YTEA 2HMSA 1MRZA 2PD3A 2UVPA 3H7IA 4I6EA 5C5IA 1KOGA 1Q0ZA 1R50A 1VCNA 2EV9A 4WHMA 5KOYA 5K3DA 1AMNA 3TF5A 1ZGJA 2Y3IA 2A9OA 1WUJS 3EAGA 4LBYA 1LK7A 3KTOA 3RUIA 3LQ2A 3Q9NA 1HZZA 4DIBA 2G1AA 3P5SA 4K0KB 5FOXA 3F6CA 3U3RA 4A2CA 2ZI6A 2B36A 3NTOA 4Q0MA 2H5JA 1G6HA 1UAGA 2W2KB 4RJJA 4P4LA 1OTXA 4RA6A 4AJIA 4D0LB 3KKEA 3A9UA 1HT0A 2K2WA 3GZTB 2M2IA 2OORA 1KK0A 1MA3A 2A84A 3DEZA 1OXXK 3DBRB 3HHEA 1E1LA 2AN1A 3SDBA 1HFEL 1ULSA 3ZHBA 2V0GA 3QU4A 1D04A 1WKCA 1CUDA 2F17A 2HCRA 3WGTA 5HZGA 3N7AA 3R0JA 4RA6B 1NVVR 4IDQA 2JA2A 4MTCA 3REGA 4S3MA 2FNAA 2NVBA 5FI1B 4B6RA 1SCNE 2VPZA 1ZOOA 4Z8XA 5DHTA 5REQA 2X8LA 1N78A 2ZROA 3IHWA 2V8OA 4A9AA 2O3JA 3GFOA 4C6SA 4D02A 4XUCA 2JA1A 2WIJA 1DO8A 1V9LA 1XEXA 1U81A 3VMFA 4XH9B 3P9CA 1HGXA 1KSGA 5CPFA 2GN4A 3F4BA 4ASUA 3FDJA 5LP1A 4WCVA 1N8TA 1ZH0A 2FR0A 2BN4A 4P31A 3W7BA 4LVOA 3HGTA 1KBOA 3L2OB 4E2YA 3CF0A 3W7VA 1N0IA 3RC3A 3QLVA 1I5OA 3ICVA 4I9NA 1ECGA 2ZJOA 5I7UA 3TPFA 4A6EA 2FGJA 3K0SA 1YA6A 4LZOA 2FCAA 3L4BA 3TKAA 1SIUA 3WLPA 1NSFA 4OHWA 5IAGA 3RKSA 4NBVA 4UU8A 3QE3A 4FHZA 2IC5A 3UW1A 1PVDA 3EPLA 1H8ED 4CDNA 1IY0A 4IUBS 5IEJA 2GRAA 3D3WB 2JIBA 3DOEA 5JJCA 1UK9A 4F3TA 4F4UA 3EGXB 2HK7A 5GWXA 5BURA 4IIFA 1LLDA 1CUIA 4MARA 1EFHA 1CUHA 1SBYA 2BAGA 1PZMA 3AEQB 2QLFA 5DISB 1IBSA 4AC9A 3LPAA 4MPDA 5C3MA 1ZXLA 5AI6A 4MVJD 2XNHA 4RVUA 3ILYA 3RFXA 1I30A 2OCXA 2YNMC 4IPTA 4RKFA 1OUMA 3A9CA 2E4UA 3HNPA 5AKHA 2KWIA 3R8XA 1E20A 4II2A 1OE0A 4RGYA 1NXXA 2DLNA 1N7HA 3SBEA 4HH4A 1VJGA 4ERNA 4ZICA 1C9EA 2QNRA 3DD5A 1DPFA 3WL8A 4NH0A 2PLRA 5D5QA 4D3SA 4C0HA 4AYXA 1KERA 2JGFA 5AW6A 4C0WA 1WXDA 3K20A 1M6EX 3I42A 2D7JA 5AKLA 1CP2A 1ZXBA 2P2ZA 1E3DA 3DJFA 5E2BA 3QKWA 5I7SA 1BVUA 3SY8A 4A73A 1Z18A 1SBNE 5BNIA 4UBJA 2XT6A 4XQGA 3SHWA 3G8BA 2HNKA 4JR0A 3MC1A 4ZO7A 4EUSA 3N2GB 2YXLA 1L4HA 1ZD5A 2BZGA 3IXLA 2XQGA 3O2SB 3W78A 4ZN6A 5AVJA 2OTCA 3OQVA 3AR3A 1L7MA 3A9VA 1YQXA 2WF6A 2ZYGA 4J90A 4CM1A 4ZYTA 2GAJA 3W6OA 1KWKA 2B9VA 3ZJTA 5DN6D 5KHLB 1O87A 3U44B 1U4NA 2PH5A 3MCAA 5CNKA 2A1IA 4YAIA 1DUSA 2P2YA 4ZCIA 1XD9A 1U2DC 3C5CA 2OKCA 1N0WA 2OQIA 4QBFA 2W6QA 1E2HA 3D4PA 4MO2A 4BNWA 3JQDA 1MEEA 4GIBA 2VYFA 4Q93A 4UDYX 5CT5A 4L4SA 3U4IA 4YRTA 3BCSA 3G49A 3I30X 3PQ5A 1X0VA 4QJ5A 4RV9A 5B3JC 3V7WA 1M6HA 4KBGA 5BXQC 2PLNA 2Y1OA 4EEXA 4YYEA 1OXTA 1C7EA 1CDDA 2YN0A 4QDJA 4QFCA 2XTZA 4L9WA 5CW2A 3UV7A 1L7VC 2HI0A 5AVVA 3EZNA 4M1ZA 3MFQA 4MVCA 5THKA 4Y0AA 1M74A 2P8SA 4KN9S 4GDFA 3RNOA 1M0WA 2IYFA 3BGSA 1ZSYA 3L7BA 5T3YA 4YO8A 3TGPA 1GGNA 5TJ9A 1SZPA 5JC1A 4ON9A 1ZK3A 3TQCA 3Q6IA 4F92B 2WU0A 4G01B 1E5DA 4CKWA 2FXVA 5EZ5A 1QHXA 5AVRA 3W6NA 4QD3A 1BWRA 2H4HA 3EK2A 3FNRA 1OU0A 2CUNA 2OCPA 1NHGA 4IJVA 2NUAB 1VKHA 2IDMA 2HF7A 2QNIA 1IQPA 1BXGA 1DQZA 1RBZA 1UZUA 2VYNA 3KJHA 4IXMA 3TXYA 1HE1C 2J0VA 3ZG6A 3ER8A 1K7YA 2JAXA 4ERXA 4R2IA 5K0JA 1OFUA 1LNSA 3HU1A 4NV0A 3ZHUA 3OG9A 4UD6A 4DIFA 4DLXA 4ZI3A 4C3UA 1MNAA 2CXRA 3C1UA 4Q03A 4N82A 5BT8A 1YMUA 1OVGA 2IIQA 2PH3A 4IJUA 3TRJA 3PWKA 2XB8A 3IL2A 2JBHA 1E4EA 3RRNA 3V9AA 1T9BA 1VBMA 2W2OA 3NV9A 1RRMA 4QHYA 4AF8A 3VAYA 1WHTA 4BV2A 3AUYA 4FXOA 2FWAA 2OAQ1 3LXUX 3QXHA 4TTQA 5DIZA 5FIUA 3OSZA 3SOPA 3KWMA 3PE4A 4X7RA 4ZQCB 1ODCA 2CXOA 2PFGA 3GLTA 3W4IA 2F55A 3ESQA 4X6XA 1OD6A 3PGXA 3UCFA 2PWYA 4O2BA 4QDUA 4NNOA 1U3TA 1ARZA 1HDZA 2YKGA 3CU5A 5EG5A 3SJCA 4XLZA 1U94A 2P91A 3GFBA 3QQ5A 4H6VA 4J6EA 2HXSA 4JLVA 5KAMA 4D44A 4NAHA 2Q1SA 4MJ3A 4S1PA 2JC3A 2PJDA 3OQNA 1Z2NX 1P5JA 2J6CA 2X5OA 3KDSE 3N5KA 2QT9A 4FW9A 4E2ZA 4GKVA 5AW0A 2I1QA 1H6DA 2GHRA 1Y89A 4Q66C 2PR7A 1XTKA 1ZMOA 2IY8A 2YZNA 4Q01A 2IVZA 1Q1ZA 4R5MA 5JBIA 2CBGA 4C0XA 1LFAA 2I8AA 4I9HA 4R8VA 3CW8X 5D1NA 5D87A 1DC8A 4OA5A 5L53A 3OM1A 1LX6A 2FEMA 2Q2NA 3BDIA 1ADJA 5M7EA 3MHTA 5H3LA 3DDNA 4KMSA 2WWVD 1C9DB 2FA9A 3DOIA 3EPPA 4L50A 1QBKC 1P81A 3DF9A 1CR0A 3FX2A 3R6LA 3HS3A 1HMYA 3U61B 3ZDCA 3JV7A 5C8YA 1N3BA 3G85A 3VH3A 3DZHA 4BS9A 2DWOA 4RL6A 3UJ7A 1GRVA 3NOOA 3FY4A 3UUGA 3VH4A 1M34E 1Q1BA 2V6GA 2NQTA 4LC9A 2FPXA 3QX8A 4PX9A 4EYGA 1S96A 3HPRA 4P4SA 5FV7A 5FI3A 5LZ7A 3EEFA 4BUCA 4N47A 5H9WA 3QX3A 3OZAA 3GLFE 2QUJA 1P1RA 1Z0JA 5BYBA 2PX0A 5AUPB 1W2WB 5JNUA 3M1LA 1GRNA 3L0YA 5DTQA 4AZ3B 4QJBA 3RUDA 2QD3A 7REQA 2NO1A 1XZDA 2VKTA 2C1ZA 1NXQA 3LT1A 2CWDA 3C7TA 2QQGA 3F6BX 4CMJA 4RQBA 4ZYUA 2EF1A 1LDBA 4NJEB 3A2LA 3DQPA 4YRKA 2H63A 4KYTA 5FQNA 3FRJA 4FQ8A 4MVJI 4HRXA 2WIFA 3QE4A 4Q18A 1N5LA 1W8DA 3PQDA 4C5CA 5IANA 4X62B 2IA5A 2ZBQA 4LQLA 3QEBZ 3CLHA 3LF1A 4R69A 2FPWA 5K45A 4RV5A 5DGTA 3I5XA 6NULA 1E7YA 1CEYA 1BROA 3IQEA 1NFRA 1FEZA 3N2IA 4L8YA 3GRPA 1SVNA 3ZWWA 2Z2YA 1NN0A 4IO0A 3UAVA 1B7GO 4QGHA 2A5DA 1A9PA 3ZDEA 4ZVNA 1QFMA 5EJ5A 2OFOA 3DNFA 1ID1A 3NWJA 3OTIA 3AEKB 4Z5XA 5EXPA 3VNVA 1X7WB 3H2SA 1SU8A 4Q1AA 3ZC3A 3OZ7A 3L18A 2VDJA 4A6DA 4DADA 3NTLA 1W4LA 3FR8A 4GRAA 2PBZA 4AQDA 4DGQA 1TW3A 2MYTA 2RG1A 5MF6A 1TCUA 2IBMA 4KR7A 4L16A 2AR7A 2ORVA 1LPOA 3NM6B 3P0JA 4FPXA 3V8BA 1ZVVA 1A9TA 2YWCA 1NF3A 1YT5A 2ROQA 3SFZA 2IQ5A 6YASA 1GKYA 2J3JA 2FQXA 1Z9BA 2OR3A 3I6ZA 3K31A 3P9IA 4W99A 4JI7B 1W85B 2FFBA 2R4TA 1LPBB 3K9GA 1L5WA 1LF5A 3BH7A 5FBKA 4BVBA 1FJ2A 1KARA 4DYDA 1TJ4A 3AFNA 1NYTA 1YFKA 4MV0A 1PL6A 1N1GA 4WINA 2WFMA 3MT7A 1H9CA 1NVBA 4DM3A 4XSGA 4YP0A 5KJ6A 2IYXA 2AJ8A 1X9IA 4OI2A 3PJGA 5FPKA 4LBZA 2VEOA 2E6UX 3KXDA 4WXHA 1PQWA 3R24A 2ISCA 4ZODA 3OC6A 1DKNA 4MZDA 2CYAA 3MRSA 1FFWA 1T43A 2RGEA 1IHOA 4XSVA 4NE7A 5LIRA 2BR3A 1AGRA 4G5GA 1QYDA 4PSCA 2D6FA 3I62A 1JG6A 2BR4A 1SU7A 3E84A 4TSFA 3S2UA 5CVVA 2OSVA 2NUPB 3CWQA 4NZNA 3EX7C 2Q9AA 1ZUD1 2IEZA 2DUNA 4Q9AA 4ATNA 1MKYA 2GEKA 2RBEA 1GSAA 2QMEA 4I1VA 4F06A 2QPTA 4J76A 5BMOA 4RTKA 2JIZA 3NH6A 4UC0A 2AW5A 1OLUA 1R6AA 1ZWKA 2P65A 1HE8B 1M2JA 3I9MA 1P91A 4LDJA 2FUNB 2X42A 3JPWA 3RRBA 2VBIA 4B8ZA 1OYWA 1DCFA 3LLSA 1DWUA 5DCWA 1ZUIA 1YD7A 4YN3A 2NV2B 3P27A 1UMCB 1A96A 2CVZA 2OHGA 4IILA 3T7IA 5ITZA 5LMNB 4HWTA 4YCDA 3SZLA 1Y6RA 2GPJA 5TQVA 2YZ7A 3A2NA 1NWCA 5BP7A 3ZVMA 3AJ8A 3JR3A 3PDIA 3O75A 5J4KA 3LSYA 3E1KA 4YT2A 1RXVA 2WQ7A 5D5HA 1U1EA 4GF5A 1N6LA 4DY4A 1M10A 1VOTA 3D5TA 3F6EX 4KAJA 4UEQA 1H0SA 4UXJA 4ZO4A 3OFJA 1L8AA 2IHJA 4G5YA 2VJKA 5CDFA 4HGRA 1OOEA 1NUAA 3L04A 1RXUA 1DRVA 3EZ7A 5SY6A 3S81A 4YLEA 3V97A 2OGZA 4RZ3A 2XYRA 4R3NA 2XUAA 4POOA 5BR7A 1NDHA 1QFZA 1Z33A 1XDWA 2FX3A 2PZGA 2TS1A 3P2IA 4JK3A 4N9QA 5B7PA 1E2BA 2HXYA 3OA0A 1LBSA 3OOYA 4IJWA 2DWPA 4RZXA 3EUEA 2E82A 3GJZA 3M3PA 4KZPA 3WWOA 2CSXA 5ICFA 2Z08A 4WK2B 4ZAGA 3W7AA 1VYVA 1TT7A 4UNRA 2HT1A 3C6ZA 2HMWA 2QX6A 4Q4AA 3QOWA 1ORVA 3HCRA 4R98A 2HA5A 3EQ8A 1USGA 1LLQA 1EE2A 3GJSA 4L08A 2WB4A 2X9QA 4KQ9A 3NPAA 1YS1X 4O4JF 4S2UA 3OZXA 3V4OA 3TL2A 1V6CA 2OO7A 2JLXA 4FFVA 1RPTA 4QAJA 3T7CA 3WLJA 2QT1A 5CCEA 1K4YA 1LBTA 4PNEA 2XUZA 2BPOA 3FWHA 3OX1A 3QUTA 1EVIA 4EI7A 1T91A 5HGXA 4UVEA 1BH6A 1NN3A 2NYAA 1PIWA 3OT1B 4CE6A 5LYJB 4CEIA 4F46A 1RAFA 3DDZX 3S29A 1PVVA 3CURA 3G5LA 5IH3A 3CO0S 1VZ2A 3QPWA 2AL7A 4RPHA 3H5RA 5K2MA 3ZE2B 3OP4A 2JHGA 4IDHA 2HSGA 4KXUA 1QQ5A 3GEIA 1UFRA 4N7JA 4BLVA 1E2DA 3I52A 2XJ4A 3VPAA 2W2NA 2QXUA 5LQDA 2UYOA 1JSCA 3F6YA 3QTBA 1DJPA 3IHLA 3MK31 4H17A 3WGQA 1VECA 2K5UA 2PX4A 4WRRA 1GDDA 2H1LA 4E11A 3MT8A 2WKSA 4HD8A 1NDQA 3QP9A 4FX2A 4H35A 4IOKA 4LYYA 4CCWA 1ZCAA 1BVRA 3ZCUA 2CXPA 1XVLA 3IP9A 3UHPA 1PFVA 1I10A 3BWEA 3IPXA 4S0XA 4X94A 4Y2JA 4MVYA 4GOOD 3FUUA 3D6UA 3HG7A 3ETGA 1L7QA 2KJQA 3LH5A 1QXSA 3TBKA 3TXAA 4HWKA 4CFZA 5A0FA 5LP6B 2P68A 3ZKAA 2QENA 4IV0A 1SG9A 2P6NA 5CRIA 2HQSA 4JVOA 2YXPX 1XZNA 1SOVA 2DKNA 3AUTA 5ALWA 3ZDYB 1YZVA 4KO3S 1MAWA 3K9HA 2FFHA 3KXIA 1DAKA 4Q3DA 1E0AA 1JIJA 3R76A 2DXIA 3K30A 2RI1A 1Y80A 3QIVA 2ZRMA 3DC7A 1IRIA 3EOZA 1DDIA 3NFRA 1WY5A 2AQHA 3LHFA 2OECA 4NX2A 5AQ1A 2HSJA 2IFTA 3E23A 4LTDA 2HLPA 1HORA 4NEQA 4FWIB 4RGBA 1R37A 3MGGA 4WXRA 1GARA 1JDZA 1F9EA 1OZGA 4GLJA 4GYKA 2HT6A 1RADA 5BSWA 4YCBA 3RYFB 3QVMA 3VYSB 4E46A 1Z4JA 1VHJA 3LOPA 2XI4A 2BDTA 2Y9MB 3K0FA 3WLTA 4G1VA 3H42B 2VSFA 4LYDA 1RM4A 2VJDA 3T3HA 2Q1XA 1AQLA 2XF2A 4OQMA 4DWVA 4EQ6B 3RIMA 1GG8A 3PQ8A 3KG2A 1JA1A 1RJ9B 1TQ4A 2MOKA 1YJQA 5G0SA 1QIFA 3T6KA 1Y37A 2ZE6A 1ZGHA 2R8XA 3QOXA 1RCTE 4IVQA 4A92A 1I6MA 3N3BC 1VMAA 1PQPA 5DSXA 4EYKA 5HZMA 4YRCA 2O0HA 3T4PA 4OX9Y 1GKUB 2CHQA 4TMKA 2NNWB 3IUPA 4EG1A 3K72B 1G60A 1PR6A 1CERA 1IEVA 1GSOA 5EN4A 4EITA 1WF3A 2CXTA 2DBYA 2ORWA 4UATA 3D7RA 3I58A 4RIFA 3CUVA 3D4IA 1H65A 3EEQA 3G9XA 1QHYA 4I3FA 4RS3A 4QYIA 3SBDA 2G8NA 1FX0B 2GCPA 2XDQA 3KYJB 2Y8EA 3OKCA 3PX2A 4M1EA 1RAHA 3HXTA 4ML3A 4EI9A 2H0RA 3L6CA 5HTKA 3ZY5A 3R0IA 4JFRA 3PVZA 4ZU3A 3PD0A 4BX2A 1QHGA 2C5HA 1K88A 3N8DA 4D43A 3CEMA 4F4FA 1E3LA 2WIBA 4C01A 1L7AA 4MMZB 4D3DA 2DYKA 3I8SA 4PINA 3RVKA 1ZQ1A 3VSBA 4L75A 3AERA 1NV8A 1O94A 3U7RA 1ZIOA 2AQ8A 3EFOA 4HOYA 4Y2VA 5TS3A 5DXJA 1HG1A 2X6TA 5E7MA 3UAZA 1XMXA 2XPCA 3WP0A 4A0GA 4KR6A 1H2WA 1AS0A 4ZCLA 5IEBA 2ZBEA 3QE0A 4MGIR 3GGOA 3F98A 3TTSA 4F7DA 3JQAA 4LCJA 1T1IA 3ZHZA 5ECWA 4CIYA 3RHZA 4DR5B 4KKVA 5DTEA 1N34B 2OE2A 3DF7A 3F4KA 1NRIA 2TMGA 4RBNA 4BECA 5JBQA 5CT4A 4RX1A 4AF6A 5CUQA 3DW3X 4R8MA 3DLBA 1K6XA 2FLVA 2HFJA 4CHTA 4E13A 1YCFA 4YDQA 3SX2A 1EDOA 3FMPB 3G0HA 1Y48E 5D86A 1UDCA 2H2GA 1CNMA 3RVQA 5JSZA 3BHNA 2EF0A 4NMLA 1FRNA 3WK7A 2PQ6A 1U0LA 3JVIA 4TKZA 1M2OB 5FKJA 1CLEA 2I2DA 3MQFA 1BSVA 4GECA 3AF1A 1NDUA 2B8NA 5IKEA 4K40A 4HQ0A 3FNEA 3MWKA 4J49A 2QSJA 1MB2A 2ZRPA 4J1SA 4QPNA 3TTVA 2HV8A 4YPOA 3H0KA 2FWIA 3AU9A 1HWYA 1NBIA 1ORRA 4JQSA 1NR7A 2ZJ8A 3D6NB 3LO5A 3LVQE 4FR2A 2WJ6A 5F5LA 1JA0A 3RTGA 3GL9A 3UHAA 5AW5A 3CEAA 1EUZA 4L6CA 4RPIA 2O7RA 4XFDA 2ETXA 3C1TA 2GN9A 4EL5A 1I51A 2CUZA 3N2GA 4ENRA 2X0NA 2W6JA 4W5HA 3KQYA 3VTZA 1M1ZA 3ZWVA 1I2BA 5C1BA 4US1R 2AHRA 4O3FA 4QPZA 1NBMA 3NHWA 3LYHA 1RJ9A 5BW6B 3RC1A 3REQB 2CB0A 2Q5LA 4QWMA 3ZD8A 2J67A 3GX1A 1L5OA 1NLYA 4OUKX 5L3ZA 2FPKA 3ABZA 3FZGA 4D9MA 1A4UA 4Q4HA 3HE3A 5EZQA 4OQYA 1QGUA 1IXRC 1A95A 1ZP6A 2Q6TA 2XCTB 1QHFA 2DSNA 5I7FA 2H1FA 3DBIA 2PX2A 3B20A 1BJKA 1J0BA 5TQJA 2I7CA 2AFHE 2WD8A 1PWEA 1V8ZA 4TTPA 1QKKA 1X13A 1ODTC 1E77A 1TUBA 2GLTA 1SY7A 2P27A 3GI1A 3I72A 4LJAA 4XDYA 1ODKA 4ZANA 1W0CA 1IZ7A 2WA1A 1KORA 3MCTA 4KFRA 3SXUA 4CNQA 1Z82A 2Z2JA 1V26A 2N75A 2PT6A 2AFHA 3TX2A 1KZYC 1O94D 4CMIB 4YACA 2VL7A 1VHTA 2QG6A 3GUCA 5B1DA 1KMIY 3JATA 1P72A 5T4BA 1N9GB 4Y6LA 1WHSA 1RLUA 2D0DA 1F6WA 4I1PA 4JLWA 2X22A 4FHGA 1SCKA 3W6ZA 1EVLA 2CNLA 1V1JA 1J99A 1SBQA 2HZBA 3FFXA 4OHCA 1NBAA 1P1JA 2A5FA 4CG3A 2RGGA 4BO4A 2ZI4A 4EECA 4IIEA 5MDHA 2X8AA 1T1JA 2ZGVA 3DL0A 3WQSB 4CODB 3DB1A 3NTQA 4HB0A 4PBSA 3ROQA 3P0FA 1SVWA 4DMKA 3PUHA 1EBFA 5EPOA 3UHFA 3R6DA 2GCGA 4S12A 1G8MA 3O3MB 4MVJF 4OXNA 2R751 2P6RA 3Q11A 1QGYA 3Q9SA 3GUUA 3I9V6 2VHVA 3LHSA 5I9SA 1P73A 1DWPA 1H66A 3PLNA 4DY6A 1KFKB 3DDCA 4KQJA 3HKBB 2XBLA 3OPYA 1V3QE 4B82A 1PW7A 3NYQA 1RE0A 2IHUA 3NWPA 1NYQA 4YJFB 4MQ6A 4ZJPA 3X1KA 2LXNA 4CTJA 1QU2A 4R41A 4FKBA 1NW5A 2HO4A 3R0VA 4J29A 2G3YA 1FU4A 2PN1A 3H5WA 1B8PA 5ALUA 4MJLA 4AK9A 5I7WA 1KAOA 2QQ5A 4GP7A 3PWSA 1ZDMA 1CNEA 3HUFA 2QMHA 3MERA 5EJGA 4C20A 4E0BA 3RGWS 4A2QA 1S2DA 3LXRA 4FU0A 3N0TA 3Q3HA 2JANA 1J5EB 1AGYA 4UOZA 3LRXA 1Z36A 4BFYA 1ZIXA 2M6LA 1X9GA 2NG1A 1CTQA 2YV2A 3IEKA 1UP7A 1E7SA 3EUWA 1H94A 2CUKA 3OICA 4QUIA 4XX0A 1WUTA 3QVLA 3X43A 2VRCD 5BV7A 3EG9B 5JNWA 3R4CA 3I8OA 4C1NA 3IAM6 4CLRA 2VJNA 4UTZA 2H0QA 5HFAA 1G1MA 1XOIA 4JELA 3RREA 4CFSA 5HZKA 5BSUA 2HHCA 4EGAA 1JECA 2BELA 3AIOA 1JZQA 2XLCA 3ETCA 2XNJA 3Q85A 3EDQA 2QQ0A 5DK4A 2IU0A 3NAGA 3VR6A 5CDGA 4WGFA 2I66A 3RSLA 4EGCB 3NT2A 2CV2A 1IAVA 1XGKA 4EPYA 2QRJA 4JASB 4UM5A 2R84A 4FI3F 2QD5A 4RTOA 4TKUA 5IFKA 5JQGB 2ZRDA 1UQTA 3VDRA 1X77A 4GNRA 1QZTA 3MTEA 4N49A 1W93A 4GMGA 4Z1OA 3HJNA 4EJSC 3BBPA 5EJ8A 5JI2E 2FH5B 1E66A 1HY3A 3EVGA 1J20A 1JRLA 1L7EA 2NN3C 3LDHA 3R3ZA 2VA9A 1I1QB 2H65A 2JAQA 4G8DA 4BN4A 4G4IA 3GNQA 4LXUA 4WERA 2AIRA 2O2ZA 2V5AA 3ZHQA 2V0NA 2JI4A 2RD2A 3OHSX 5CEFA 2CBZA 1QQBA 5JW6A 3S5UA 1E9CA 1M6VB 3WNZA 2C7GA 1EX6A 4RZQA 5CCDA 1M6YA 3WAJA 4PSDA 5CJPA 2AGVA 3AL3A 4AKIA 3R7SA 3S68A 2WAOA 1USWA 3I73A 1MAVA 2OO5A 4EY4A 3V32A 5AD1A 3QTTA 4AD8A 4EO4A 3MTQA 2H1SA 4Q3CA 3S0JA 3K94A 2BRUA 1Y34E 3TWOA 1REQB 2RHOA 4YRJA 4OTZA 4XDGA 5T5QA 3B7PA 3VYWA 3V4PB 1AN9A 2JLAA 3T3GA 3JS5A 3N6VA 1RQNA 3QOYA 5K6TA 4ALJA 5BN1A 1C4OA 4OMCA 2CFTA 2OOSA 3N8GA 4HFJA 5JFOA 3ONFA 1LRKA 4OOEA 4PAOA 5LZ4A 1R9JA 1DO0A 3Q0EA 1Z7BA 2QWXA 4RPLA 1IXSB 3BB1A 4IIBA 4FDVA 1I4DD 3L43A 2XDYA 4LRTB 3K9CA 3PI7A 5HM6A 2RHHA 3JRWA 1L8LA 4EKIA 4P4GA 3EF0A 3DV0B 4KIUA 1X87A 4KGVA 4HS9A 2QRHA 5F64A 5E9JA 1IEQA 3WNDA 4HQRA 4EATA 3AHCA 3CLSC 4UUBA 1M7HA 2VNJA 5TT0A 2FZWA 4QG3A 1SULA 5AJHA 1M1YE 2ZULA 4ZOAA 1KYYA 4LY6A 1EK6A 4KMMA 1G8AA 1EYZA 1IVSA 4ZEWA 5EZ6B 1Q7EA 4H7DA 3HVKA 3F7NA 4JGIA 4KQ2A 4Y9DA 5B2EA 4URFA 7YASA 4AW9A 3NGLA 5CLIA 3UMGA 5E6UB 3UCXA 5JROA 4FW8A 4ARCA 3D6VA 4M1TA 1P17A 4TYQA 2I4IA 2QIPA 1R4NB 1G6Q1 3NRBA 3JVDA 4DLVA 2WKPA 1XZCA 4B2PA 4BQFA 2DH6A 2HUNA 2VR1A 3BGWA 3DCIA 4EB0A 5M5BA 3NBQA 4YRRA 2O54A 3G2PA 3O21A 3BWMA 4PXSA 2QSZA 3HB7A 4M8KA 3MD9A 1XZQA 4IJ5A 2CNKA 3HCAA 4JEIA 4UVIA 1CR6A 4DL9A 5C7LO 4IMRA 3O8DA 4Q4CA 2P2NA 5DBOA 5D3KA 2VDPB 3IOBA 5HIMA 2DB3A 2BWJA 4L0QA 3PPWA 2WM2A 1EFRD 2R1VB 3N59A 4H1VA 5FT9A 4I99A 1YBVA 3L4EA 3MUEA 3QTLA 5AOVA 4EA8A 5FUMA 3EPKA 3DLPX 4JR1A 1DFIA 5KSPA 4LDRA 2CLKB 1EDBA 4EL0A 4JMPA 1K0UA 2J7PA 4RV4A 3CCCA 5HNKA 1YU9A 2W6IA 9LDBA 5BY2A 1MJGA 2ZTVA 3AHGA 5E2AA 1PR4A 5HF6A 4YQZA 4B7UA 3CVVA 4UTXA 2AEMA 2EG5A 3F2IA 4OGGA 4BKMA 3IELA 1J4AA 1S7GA 3TLBA 3AXTA 4W8HA 1IMJA 3GRYA 3ZV3A 3D6AA 2VQDA 1J1IA 2NUPA 3QBEA 5FFFA 5M3BA 5IT0A 4AYTA 2AFIB 2Q5CA 4X7MA 4CT5A 1VGRA 5B53A 2FW1A 3C7KA 3BTUA 4G0ZA 4ZHSA 3O4RA 3AV3A 4HX5A 4BFSA 1AMUA 1Z29A 4WV3A 1S2IA 3LGXA 1TKAA 2C92A 5F2EA 1H5NA 3A4YA 4F91B 3RAPR 4ZFNA 4B81A 4GLLA 3AVOA 3DR3A 3K2IA 1B76A 3G82C 1CS4C 3MM4A 4TTRA 1T36B 4QOSA 1I24A 2ZTLA 5KQMA 2Z6QA 4HDKB 2CJFA 4JP8A 1Q50A 3DT8A 4PG8A 3MSCA 3HFGA 5F23A 1ZY2A 2IZ0A 1JSZA 3D5QA 1NW9B 3R3VA 1WCIB 2JHAA 3WY9A 4BZZA 1V7CA 1JHAA 5C81A 2ZUCA 1H85A 2WP0A 4CQMD 2YWFA 5KJCA 1KVRA 1EK5A 2Y2UA 3OQBA 2V1XA 1JBEA 3PFKA 4ZAVA 3U4AA 1ETUA 3PQ3A 2GBPA 4HN4B 4HSEA 5ALMA 4LOIA 1MV8A 3EGCA 1IOZA 1QV9A 1VKJA 2YXBA 4WI1A 3UWOA 1SVSA 4IKPA 4R05A 4JJ7A 4E5YA 3ZZNA 5LXTB 2ZWVA 4IDEA 1Z6AA 1V8FA 4KREA 2WJGA 1PG2A 1G7CA 3ZY4A 5CJJA 4X71A 3H2GA 4LDPA 1X8LA 1WXXA 1UPXA 1FX0A 3DMTC 4JQZA 4BMYA 1DLIA 5ADWA 4W5WA 4K26A 2O06A 2XOXA 1E0JA 1JXQA 3QXJA 3FPHA 4QOJA 3CVUA 2PA0A 4MGYR 1XEXB 2FN8A 3LCCA 2O5CA 2OHHA 4N3AA 1GCAA 3Q8XB 1TAHA 4V0QA 4DOMA 1N5IA 2X4DA 3GEEA 4KIFA 5DF1A 5EE3A 2DG2A 3OOHA 1MFPA 4LSWA 1QTQA 3BFJA 3KSDO 4FNOA 1HNNA 3OIDA 2WUDA 1Z2CA 1QH8B 2OZLA 4HAZA 3E0XA 3GP5A 3GH3A 4MUYA 1YOVB 1ZM9A 1W75A 2BEJA 3V46A 4ME6A 4TQUS 3U7QB 5KMGA 3OETA 4XGKA 3AX6A 3KVVA 5JADA 1K7FB 3T5AA 3PXXA 5BNTA 4GOXA 3H8JA 3OZVA 1BKYA 1NJ1A 4IWNA 5E1DA 3UT5B 4EBBA 2HF9A 2ZIXB 2R48A 3HBNA 3U49A 1K86A 2FWBA 2QM8A 3PNYA 3I0ZA 5LP6C 2BFFA 3HP7A 1E1CA 2BCJQ 4BIIA 5JNSA 3I92A 4D3FA 1ZIDA 5LSAA 5EJAA 1ML4A 4Z49A 1Z5PA 2RARA 2X8JB 1U3WA 3E9YA 1TUIA 5BSHA 2HRCA 1OWPA 2NZVG 1KH1A 4FHDA 4IBOA 2H2FA 4M38A 5CDYA 1RZRD 2NU6B 4M1MA 5AJVB 4EPVA 2I7DA 2WJPA 2CVPA 2UYYA 4QT4A 1XNJA 1NRWA 2YQZA 3U3OA 4HPWA 3B3FA 2J3EA 2QX8A 3CX8A 1DKRA 3I53A 8AT1A 3SKYA 2EARA 3DPIA 5LYJF 1TCAA 4YT5A 2QNBA 3R3HA 4KXVA 3SICE 1LBQA 3AUSA 1J2UA 3QKRB 1TLFA 3T4EA 1UWKA 1Z35A 2PAFA 4KDEA 1OMOA 4XQ9A 5LB4A 4KNVA 4AO7A 1VM6A 1M8JA 4PYLA 4BHTA 1BS2A 4Q9LA 1D1SA 3KUKA 3PPIA 3NKFA 1L9XA 1AGXA 1GQRA 2FZEA 3UM9A 2AH5A 1S3IA 1E6KA 4L4YA 5CA0A 2XIJA 3E3LA 5AM2A 4Q9KA 3SEFA 3CVOA 1G8KA 1IPFA 1S3GA 1VDMA 3PQ2A 5EIFA 5IP5A 3STXA 4BGEA 1NMQA 3BB3A 4U5QA 3FDFA 4F12A 3IB6A 4OU4A 1V1RA 1RC8A 5AESA 2C2GA 3OE1A 2X4IA 5JU6A 4QG7A 1E5TA 4XGNA 1RAIA 4CGYA 4PHTA 3FMFA 1J1UA 2C8VA 5E4YA 2LWIA 3I09A 1OXBB 3OIWA 5BXYA 1FIUA 2H2DA 1DZIA 4J0JA 1TD9A 3A2KA 1T6ZA 2OFWA 1NNI1 5KEIA 4YMHA 1Y8QA 2EU8A 2FG7C 1Q57A 5KU1A 2DFLA 2GO7A 1KAEA 2E1RA 4ZCTA 5IASA 4K05A 4KAXA 2DPLA 9LDTA 5KHOC 2AOTB 3GJ7A 3OKAA 2WPDA 1YS4A 1C9NA 1Y3BE 3B5JA 3CKKA 3EXG1 3NZEA 4W1QA 3S44A 4Z0NA 4AICA 2XUPA 3IQIX 2J5XA 4JUIA 3JQRA 1WV1A 1E9AA 3O83A 4XIFA 3VR0A 1H3FA 3D8TA 1C3LA 1IPHA 4QFDA 2CXQA 2ZQZA 3OX4A 5IBCA 3TYXA 3CVYA 3PWTA 1QO9A 2GEBA 3CUKA 3P4YA 4F5YA 2IU4A 2X1LA 2AN9A 3IHTA 3OMXA 4Z2YA 2AD5A 1D5WA 1DWOA 1FTGA 1AKTA 5EI5A 3ZCPA 3AERB 2FPUA 2AFIE 4GNKA 4IGIA 5IVIA 2EEZA 3RVRA 1ONBA 2F3SA 2ZYDA 3ZK8A 3FVRA 3L8EA 3ZV5A 4H6XA 4JIGA 1KC1A 4C7OA 1FK8A 4Q3LA 1EGMB 1EJ2A 1KE1A 4Q7JB 4GPAA 4IWXA 1TO6A 3RQSA 3HVJA 4LXHA 4IIVA 4OJQA 3ST7A 3WL3A 5I7HA 1MPXA 3M4ZA 4FJ2A 5H4HA 1VPTA 3PDHA 1MIOA 4Q05A 5FD8A 4FYMA 1SR8A 3ZS8A 3LKVA 1IZYA 1EA5A 3D0OA 3R3SA 3FPGA 2D2IA 3NETA 3FMOB 4Y67A 3B3JA 2AXEA 4WSOA 3E3NA 3HFRA 3P0HA 2YUTA 3F73A 3AJDA 2WE7A 2QYTA 3HL0A 3KJXA 1NU8A 3E7WA 3CT4A 2V58A 4LISA 1GVNB 4QUJA 2BKXA 3KOXA 2QQFA 4PRLA 2VT2A 3GK3A 4WFIA 4BLQA 3RVLA 2C03A 2ZT7A 2QTAA 3ZGNA 5ADUS 5P21A 1RQ2A 5BUCA 2EGGA 2VHXA 1KIMA 1KJWA 2JZOA 2O2IA 3CBGA 3L5KA 2RBGA 1QFSA 4A4DA 4AMVA 2X5JO 5JO0A 5AVXA 1GRCA 4EO9A 2XXAA 1RJFA 2HAEA 5FF9A 2XX3A 2IOFK 4Z9BA 2DPGA 3JZIA 1QS0A 3TM5A 3RE1A 4CMAA 4NBWA 4GS5A 1A8HA 3LV8A 4YHBA 2C7PA 1W2GA 1W36C 1NGSA 1UANA 1ZGGA 3EVNA 3G7SA 3GYGA 3LLUA 1P1BA 3RK4A 5EIBD 1V8OA 2LDXA 1EG7A 3FFBA 2HPVA 4KXFB 3BUSA 4MPRA 3AH8A 1CU1A 5IUJC 1JHVA 3ESZA 5IJ9B 1R5BA 2I4RA 2UZ1A 1ADYA 1LTKA 1X8KA 3A9TA 5BW8A 5ES3A 1MNQA 5U4XA 2K7FA 2ZRJA 1AURA 3SKXA 2PX6A 3HWRA 4FHFA 2Z5FA 2EX1A 5ALPA 4LFBB 4I50A 1GLGA 4HDMB 3DZKA 1CKEA 4ZZ3A 3ZV7A 4X8LA 1F2VA 1HTTA 2ZS7A 4B3BA 4Y6SA 4DV7B 5TX7A 2H1RA 2BM1A 1EVKA 1R0CA 3WAKA 4ZXFA 2E21A 4HNSA 5I7EA 1VL0A 4LJLA 2BI8A 5DI3B 3H6HA 2B25A 3AETB 4CIDA 4DBZA 1CE8B 4DIMA 3VKWA 3WIEA 4YMWA 4OGWA 1H4TA 1AA6A 4YGXB 3V8MA 1MP0A 4WDQA 3ZWOA 3LBIA 4MKHA 3JQCA 2ZSFA 4N0DA 1BFUA 3K5IA 3MRXA 3UKOA 1QLHA 1A7AA 4MP6A 5AR1A 4U6QA 4JYAB 5K7SA 2IKSA 3BSWA 5ESWA 5H80A 5CH8A 3T7AA 1NV9A 2XD9A 2Z43A 1MCZA 1M9NA 5HRAA 2C3PA 5LQSA 2QMYA 3B1VA 3A4VA 4FCCA 4YO7A 2OXCA 4WEOA 3U37A 4YXWD 5DNCA 5TMBA 5JVDB 4TMWA 4L5BA 1NVWQ 1RAGA 6AT1A 4IQFA 5AI8A 5ALEA 2HWKA 3DDSA 3LBNA 4H7PA 4IX1A 4LY3A 1NI5A 3NBMA 5KSZA 5G41A 2Q6IA 5KI6A 1JKIA 5JWHA 2WW8A 1LVGA 5DNYB 4KBFA 1Y3FE 3NHPA 3BZUA 4Z9AA 5CNMA 4BQSA 2YDYA 3HB9A 4ZYWA 3K8YA 2JZCA 4BEVA 3I3OA 3FNQA 4RVHA 1YB4A 1D07A 5IARA 5LOVB 1F5NA 2FVYA 3UANA 1SVIA 3W3AD 6Q21A 4A2PA 3EZYA 1UBKS 2XMZA 3VO2A 4YIHA 5JVDF 2UYGA 3UAXA 2C98A 1NVMB 3I9JA 4I1OA 4V38A 2Q4TA 3UTDA 1AO0A 3DVLA 1DAMA 3KAJA 1EX9A 1O03A 4JCOA 4FKMA 1QRSA 3H3FA 3K0AA 4LX8A 1BTOA 3PEYA 1I2ZA 4CKCA 1FDWA 3WTBA 2WAAA 4ZCQA 3ESDA 2IXTA 3K1AA 2X7JA 2JCSA 1ZGBA 5G4KB 4TLAA 4S05A 3L8MA 5DYWA 2JIPA 4CUKA 1SPBS 1RKVA 2WWXA 2D59A 3ICOA 3K0AB 1ZNZA 1C3VA 3NWEA 1XN4A 4E4RA 1DXYA 1KK2A 2VWGA 2WOJA 4RORA 1FZTA 4OEHA 1MJ5A 4ZYZA 1XLWA 1VCOA 1XE3A 3O4FA 3Q10A 4H7KA 4R2HA 5ALYA 1PSZA 2XYHA 3I2KA 1M8KA 3GJRA 3LKZA 4UDXX 2PMEA 4I9GA 3AKDA 3L05A 5DBIA 2DJIA 4I4TB 3FYUA 4GX1A 5K8LA 5A62A 4F71A 5KNCH 5J9FA 1EQUA 1JV2B 1E7WA 4GM4A 4YAEA 2P2GA 3ZHRA 1ONOA 2FJUA 1Z8NA 1G4AE 3ZNPA 4ZI7B 3D4LA 2VATA 1RZUA 2Q9CA 1P80A 2B4AA 2O8NA 2RJOA 3AY6A 3IAHA 3PXEA 4LYHA 4Y9SA 3HDVA 3JQ6A 5THXA 4ZHQB 4JI0B 3EQ7A 521PA 2X0EA 1NW3A 4EM6A 1JA9A 1BEUB 1FPMA 2HQRA 4Q1DA 1PO7A 1T4CA 2HA2A 4P6VF 3ONVA 2UZ4A 4Y2XA 2XVMA 2EAUA 1ENOA 3FJ1A 3S70A 4N41A 1Z25A 2KMLA 2J09A 4FE4A 3TOSA 4A1FA 4BB0A 4G0PA 2X5NA 4BJHB 2OXFA 3L4BC 2RJ3A 3NEPX 4Q24A 5L51A 1YKFA 2JHPA 2QZ9A 2JLZA 5E0KB 5K0LA 3WICA 4P98A 1UJ2A 1XVVA 1SUBA 1W4ZA 5JRDS 5SY4A 4UFPA 2K2QB 4LDZA 1R4MB 4B73A 3VYVA 3I9NA 1QK4A 4LTMA 2XMRA 5LR6A 4BEWA 3DYIA 3W5AA 5LDHA 3UA3A 3H2HA 2BSQA 1U11A 4JQYA 1OJ7A 1UK7A 2ZPTX 3LUBA 1VZ3A 2FUG6 3GAZA 5KCMA 1NOKA 2QIOA 2WU4A 3U31A 4HDKA 3LPMA 2PBRA 2XQIA 5DNWA 5JSHA 1G4UR 2FLWA 1M1YA 1RE1A 2E85A 3Q7RA 3TINA 1D4ZA 2QVLA 4ENQA 3ZI7A 1B3RA 3ZZTA 1Y6FA 3R7FA 4QYXA 3PR3A 4LJ8A 2R6JA 4BVAA 4HQKA 4K6OA 1PWZA 4I3GA 1VSQA 3UC9A 3HJTA 1MO6A 1OBFO 3CRZA 2WF9A 4FMCB 4S0ZA 2FUG1 3IKTA 2HDHA 2H92A 1FE8A 4XCQA 1XMJA 1XC7A 3NB0A 1A8UA 4JKIA 4OP2A 5EUCA 2FMXA 3JATB 4CDMA 2IHNA 3S2YA 3PQEA 1N9KA 1R16A 4L3VA 1F8UA 2WWTA 4NECA 1HDXA 2ID8A 3KQOA 3WMFA 1OX6A 4X44A 4TMXA 1ADGA 2I65A 4X90A 1PX0A 1AZSC 1M8GA 4UOQA 5KWIA 1XQVA 1M8FA 2FY8A 2X7HA 1GL6A 5CDFE 1BEZA 2Q2QA 1MC4A 2F43A 3N05A 3OTWA 1F2TA 4FYXA 1MHPA 1QH0A 1T8TA 2ERCA 4S1OA 2BFWA 2VFAA 5C7IO 1EHCA 4CETA 1AQIA 2WYOA 2P6UA 4KQEA 1NMYA 5BQFA 2CB9A 5B3JA 3SHTA 1UJMA 5FWDA 3V2UA 4DJEC 4IDAA 2ATVA 3K8OE 4H4DA 1NVTA 4YMVA 3B8EA 1BVYF 1GG2A 4EZEA 5LUBA 1AQJA 1LJ8A 3QSGA 1DC4A 2IIVA 3EUAA 3SLRA 1B16A 3BT7A 3HKDB 2DCUA 1JJFA 4LWQA 4QOEA 4TL6A 3CUTA 3U9LA 1HETA 4HMPA 3TR0A 4B3FX 1H0KA 4LJ7A 2GM3A 2BGJA 4CT4B 1OVMA 3ZS9A 2P7IA 3AKEA 2JI8A 1TO1E 1I1OA 2W2MA 4LA4A 2Q7DA 3W2IA 5KVCA 3GXBA 3WOVA 1YIAA 1ZH4A 5A05A 3KBBA 4UBLA 1A5ZA 1EAMA 1PJSA 3DMFA 1ZVJA 3W5HA 1RI5A 2D2EA 3IVXA 2IU3A 2WIGA 2XB4A 4R6WA 4URZR 3TG2A 1ORTA 2VF4X 3EVEA 2G5CA 4MUGA 3BZWA 2VUIB 4XUGB 2A92A 3FYDA 3KFVA 4KE7A 1JDPA 5FPTA 1VTKA 4E51A 1J7JA 3DKIA 3CXUA 1SD1A 2GAFA 1GYPA 2HGSA 2X2FA 4XCXA 3T5GA 3PSHA 3U9SA 2Z30A 2X15A 3GMIA 3VA7A 3USZA 1ZC3A 1VJTA 3TZEA 1OFVA 1LPSA 1TEXA 3EIQA 1Z5GA 4UZEA 1WBJB 3RKUA 3UVEA 2O8BB 2CSUA 3LJKA 2Z57A 4RVDA 2VQSA 4CUJA 2JVIA 2HKIA 3ET4A 4G07A 3FKSD 2I67A 3IKMB 1X7GA 1W88B 4JBYA 1SAYA 2C82A 3ANSA 2QUZA 3WIBA 3S4YA 4Y1RB 1GGMA 2GOYA 3H4MA 2BLNA 3OQHA 1DO2A 1D2EA 1A72A 4BC0A 4C22A 1GCIA 3Q8WA 2JFNA 4IJMA 4R1TA 4NCBA 2QTTA 3HMQA 1PS0A 4MQFA 1J33A 4XSHA 3PNPA 4MVJE 1T9GS 2X8WA 3DMNA 4I5IA 4LJ6A 1W36B 5K8IA 4WNYA 3EDYA 3WGIA 1XXHE 1YB7A 1ZH8A 5E1BA 3KEMA 3MINB 3OP1A 5DXFA 3PFGA 3WGOA 4L0CA 1CUUA 4DWWA 4EQZA 5C7OO 2HCJB 5KOIA 4OFZA 5AK5A 1VHWA 4AECA 2AE2A 4DJDC 1E2QA 3GFVA 4EGJA 4AJ2A 4LXTA 3D6TB 3NIFB 2RI6A 3UAYA 3ZUPA 1JEOA 2QP3A 2X2OA 3HDQA 4GVPA 4A8JA 4PC6A 4RVSA 5F4ZA 4M9ZA 1UXJA 4DLAA 5DMXA 6CHYA 1P1IA 1PZNA 2YRFA 2QHXA 4B6JA 1V48A 2AX4A 2GERA 2ZAMA 4K28A 3JAKB 4C7KA 1J97A 2HRDA 3TOXA 2NU9A 1MG5A 4MWBA 3WMXA 4YAGA 2X2EA 4AJLA 2ZANA 2BDEA 5EFZA 1KXJA 2C1EA 3JQ8A 2CJYA 3CKLA 3HM2A 4UVDA 2FSIA 4CTNA 4FUTA 1BDBA 4IHQA 5EC8A 2SHKA 2JJ1D 1H93A 5TS2A 1SIOA 1X7ZA 4G2TA 5EXDA 3NEAA 4RZ2A 1TAQA 3N7TA 3HCEA 1UXIA 2CFSA 1K8XB 2HMVA 2AFVA 3JQBA 3LQ1A 4YK7A 3P97A 5DTMA 5IN5A 1P9NA 1PSDA 5JI3E 1JEYA 1LVHA 4WZBE 4LK2A 2UKDA 4RE5A 3P0RA 4WD3A 1T9HA 3L7OA 1RCUA 2JH8A 2NUBA 1USUA 4JT9A 3BL6A 3D8RA 1FW8A 2X0DA 1QGDA 1ZUWA 2EJBA 3QMVA 4MR7A 1VHQA 5B2FA 1WLYA 1YJXA 1WLSA 1TVKA 5L7TA 2B61A 2MDTA 1G8YA 1X94A 3C5VA 4NTZA 2BGGA 5FPSA 2FCRA 4W1PA 3LVBA 3NQ41 5FTNA 4F04A 3GGJA 3LNTA 4ZDIA 5KSWB 5KNBH 4IHKA 1F4VA 4TRRA 2Y1WA 3P8ZA 3PJDA 3LP8A 3M0EA 4KK3A 2DC1A 5EUMA 1M2GA 1UBRS 4QBIA 2RGNC 2WDPA 2BFFB 5K9ZA 3EXHC 4C2TA 3KDPA 4PVDA 2X3FA 4Y2GA 1OLXB 2H29A 1WQ4A 2VHWA 1XPUA 1II8B 3HRIA 3HQ4O 1T2EA 1R6UA 1Z63A 5C4GB 1U2TA 4F4HA 2XUJA 4B1FA 3BWCA 2GEFA 4AYWA 1JB1A 1JFLA 3T1TA 4YV7A 2RKOA 2IYVA 4W5NA 2UVDA 4HLCA 4BRUA 2Z8YA 4MUXA 1N2OA 1FUUA 4QGFA 5C53B 3X2EA 1Z2DA 3K0HA 1ZL2A 2C88A 4HMQA 4ZVSA 2HTFA 3AF4A 2PPVA 2QSUA 3HBMA 1Q44A 3UKDA 2IDZA 1DI0A 1HRDA 3SIRA 1V37A 5HFJA 3SIXA 1YI0A 1B4DA 3K6JA 4Y0NA 3VGJA 3TOZA 4HUTA 1N2XA 1SK8A 3ETHA 1LTQA 3FCEA 5FBVB 3GPLA 5JAHA 4MYUA 1NG9A 1IM8A 1P7ZA 2FPMA 4KRGA 3QV2A 4F2GA 5H9VA 4X61A 4QIHA 3RS7A 5KNDD 1UJ4A 1C4WA 1LJLA 3KR2A 2VWPA 3AUFA 4G63A 1KOFA 4J2HA 3SYTA 4UNPA 1SA0B 2QP9X 4ZAWA 2YJTD 2GJAA 2PVSA 3K70B 2ES4A 1TU3A 3GCZA 3V3KA 4PZAA 2RB4A 5ICGA 1YR7A 2WFZA 2V0CA 3MD0A 4U7DA 4AZ3A 2JAWA 2K4MA 1L5HB 2IODA 2Y0BA 4PO9A 1EUCB 4YIKA 2COEA 3TAXA 3KIPA 4YJHB 2NPOA 3GBVA 4B34A 4YJ2B 4B5LA 1EFVB 2YOFA 1HX7A 3G6KA 2XJ9A 3QITA 4OQXA 2EP7A 3IEVA 2Q62A 1JIQA 1XDSA 2AZTA 4MKZA 3UOGA 3WLMA 3BSSA 5EE5B 3SHOA 3G79A 3E3MA 3BFXA 3NHRA 3MS7A 4JYCA 4OQFA 1EWVA 4PSKA 1AKRA 5A7HA 2WT9A 4NICA 3VR4A 1ZZGA 4D9IA 8ATCA 3I23A 2BE9A 4A6PA 4W5QA 2HU2A 3F3KA 2C5AA 4NCHA 3B78A 4UXHA 1OI4A 4GVXA 4DMUB 3TVTA 1RWVA 1K6EA 2R85A 3AEZA 3ES9A 4UM9D 3NJRA 1X1TA 3ZHCA 1KYIA 1Y6JA 2OM2A 5KNCA 4G0UA 3GEHA 2WAXA 3HXPA 5DT9A 4G89A 1PLKA 1JH8A 1RP7A 4XGQA 4BNIA 5AKKA 1XI2A 1TMGE 2VDRB 4HYQA 4F2WA 1GDTA 3G02A 2PRJA 3NHSA 1X7HA 1TM3E 5IXSA 3R09A 1OWOA 1NI4A 1O9HA 1R5NA 1YQ9A 2WWGA 1P1FA 3YASA 4MRMA 4WA8A 4ZVVA 3ZH9B 3K8ZA 3WGLA 5JDIC 4UDOA 2JIOA 4DQLA 3VVCA 4F9FA 5JXGA 2YOGA 4C4PA 1K4KA 3CMMA 1T15A 3QHAA 2A5GA 3OECA 1X1SA 1SXJE 3QLJA 4I4IA 2GUGA 3Q2OA 3UAWA 3KYCB 1ZJWA 3C3PA 3AVUA 3HCCA 1TKCA 4PWZA 3ROFA 3X3HA 1CBUA 4D42A 5DWQA 2QUHA 1FUEA 1TW2A 4DXDA 1HEYA 1HRKA 4HGZA 1WPXA 3TOVA 4TQAA 1CEXA 3B9PA 3EDMA 3LUKA 4NPCA 4YP5A 1GR0A 2GQ0A 4Q1EA 1SCBA 4OKSA 3ISTA 3AHIA 3AZQA 5B6IA 2UVPB 3INGA 1SPXA 1SBHA 3NBZC 1U7UA 4PLHA 4UAGA 1MH1A 1QM5A 1JR4A 2AYYA 3TTXA 1F6BA 2H16A 4O2AF 4W4TA 4PYRA 2WABA 1BRTA 3MELA 4GAEA 2BSAA 4OLHA 4HAUA 4DA7A 3Q8LA 1U2SA 4TV8A 3KKNA 3D0RA 4J8PA 1H5QA 1VIVA 1V9SA 3EXG2 5IJAA 4ASUD 4M9RA 3QLEA 1YJ8A 2A88A 1O6BA 4B3XA 1BGXT 1C0KA 3HYTA 3TR6A 1CS0B 4F86A 5KQRA 2D2FA 4W5TA 4J3FA 5IPFA 2R44A 4TTSA 3A3YA 1FYXA 2B1RA 2QRNA 5AVOA 1FRQA 2MSLA 1ETHA 1OI7A 3KEOA 4JFAA 1SRRA 2QZJA 4OOFA 4RTSA 1W5AA 3THXA 1E64A 4MRSA 4I1YA 4YJHA 3H3JA 2XDAA 1EFTA 1O89A 1KJYA 3B1YA 3MGKA 8GPBA 3QJGA 4X1IB 3CM0A 3I4FA 3LQYA 1YO6A 2I4OA 3O8LA 1L4MA 4FGZA 4LBVA 1MENA 4RJKA 2I8CA 1P7CA 2AD1A 2ORED 3PHCA 1GPKA 3QYPA 4MYTA 1G5HA 1LQTA 3MGBA 4BO1A 1RQLA 2REOA 4KAAA 1JH9A 3GAMA 1Y8RA 2HUPA 2I6TA 1UBMS 1Z0FA 4MICA 5AM3A 2WJAA 1FXUA 3N28A 5HQJA 3DULA 4TWBA 4FFMA 4P53A 2GZRA 4FD2A 3TQHA 2VZLA 1E1MA 3FUTA 5BN5A 4FSHA 2CLFB 2ONCA 1S2LA 3BILA 4NZMA 3ACBA 5LUAA 3C85A 4C3ZA 4EKNB 1EIWA 5JYEA 3PUKA 4J9UE 4GPBA 3GD5A 2R65A 4ALMA 1QE0A 1LCIA 3GVHA 2HM7A 3QKSB 4XVQA 2JCGA 4EUFA 1WDWB 1NASA 3RT1A 1EZ4A 3SK0A 3TE6A 2JK1A 4WY5A 3OZTA 2BBOA 1TJ5A 1Z75A 2QRUA 3JTEA 2WVJA 3V7FA 3HCDA 1T35A 3L7DA 4E6EA 2QX9A 5FWYB 5JPCA 5KJFA 5BO5A 2IYLD 4QX6A 4OLBA 1OHHD 5AJZA 4AJOA 4P4NA 2IOHA 1NVUQ 2YJ3A 3OT4A 3W34A 2QMOA 1JMVA 1PVOA 3WGKA 1GNRA 3EVTA 1E92A 2X8JA 3AM5A 3CEHA 4FGLA 3DOJA 1J23A 1E6WA 2RCNA 4BNHA 5LPNA 3FF1A 4C76A 1AK1A 3T4UA 1DEKA 2XCSB 4NATA 5D7NA 2ZVQX 3I8XA 5BNWA 5CVEA 4JP2A 4DM4A 3E4CA 1NRXA 5KVAA 1PJ8A 3OJWA 1OI2A 4HEA1 5EKXA 2HLHA 1F1JA 2YZMA 3D43A 4FN4A 2XMBA 1B8UA 3I9LA 3QV1A 4F85A 2J3LA 1SVMA 1NATA 4E88A 4NE2A 4BNLA 1KS2A 2IPOA 3C48A 1Y82A 4DT1A 3ZYZA 3ITKA 4HPXB 3D8SA 1FQWA 5K0TA 3ZXUB 4D0RA 1WRBA 3U48A 3LY9A 2BP7A 2D00A 2Q3DA 1NVVQ 5IRCD 4C0SA 4TTJA 4NH4A 3C15C 1N6PA 1XN1A 2V4UA 2V97A 4J94A 3R44A 3RCBA 4CTKA 4D0GA 4BWVA 2PSSA 4PZUA 3CLVA 1O08A 3LUCA 1O8CA 2P9TA 1MV5A 3C4JA 3L9XA 1XX6A 4DR7B 1V39A 4NNPA 2XE8A 1JSRA 4D8UA 3MWLA 2IUUA 3UT6A 5A5EA 3JAWA 4G1MB 1JKXA 1FVFA 3HA5A 4AXXA 1CUZA 3S28A 3GLHE 2WHQA 2LCQA 2DHCA 1T26A 4YX9A 2ANCA 4NV3A 1VG0B 4X65B 2PT5A 2ZSIA 2V9ZA 2GI4A 2H2AA 5DLQC 1NR5A 2JLWA 1O8BA 4PAMA 4U7TB 4Q9HA 3TQRA 5FOSA 3G88A 4CIAA 1CSEE 5B1IA 3O9VA 2PJZA 2P3LA 3WK8A 2AVDA 4I2VA 5KYXA 1SQSA 5AVWA 2RIRA 1DQSA 3B3QA 4TRNA 5JZBA 4DA0A 3KHSA 4G09A 4LC0A 4B32A 1QGAA 5KZMB 4P36A 5K8UA 2B30A 3HDJA 2FPPA 1LPMA 3EIUA 5FOUA 2YICA 1KK3A 4LF9B 5GGYA 4Z0PA 3S1AA 4OXIA 4P32A 4YUYA 2ZB3A 3M6IA 2J9FB 3D6HA 4GRDA 2ZYSA 4FCWA 5CVDA 2QZ4A 1DARA 1AZTA 2E9SA 2KE5A 1R4AA 4QQRA 4R1OA 5G1PA 3HY3A 3HLTA 2YWHA 1IM5A 1IHXA 1RC1A 4RFVA 2CE7A 4ER7A 2TYSB 2BUBA 5SYAA 3RBZA 3E9RA 4TV9A 1QE3A 2NTYC 4GZ3A 4XEUA 1M67A 3ISJA 3L6BA 1IN1A 2VZ0A 1GTRA 4QDZA 2BBSA 3MJDA 2DHQA 1G38A 2DT8A 3BD8A 2JATA 2ZAIA 1WCV1 2BFDB 2I3ZA 1MJNA 1ZGZA 3C3EA 3K53A 5LNK6 2J8ZA 1PQ4A 4C6HA 5C8YF 2VO1A 3WDKA 3LUJA 5BVHA 3L82B 3NVMB 2XVAA 5DLPA 1LK0A 3O0DA 4CL3A 2IOYA 5AOCA 1E2NA 2NZ8A 4WX2B 2XW6A 3HEMA 1LLFA 2R1ZA 1UFKA 3VR1A 1QJ4A 2RB5A 3LGSA 4AZWA 4YMUA 5HZHA 1RKBA 3HR8A 1D2AA 3E3AA 2BYTA 1JPNA 5JH7A 1D6NA 2D0OB 5CA0B 3CF4G 2GM9A 5EA2A 3VHXA 3F49S 3MAGA 4FBGA 4ANFA 5JC8A 3PFHA 1W2HA 2UZIR 4MULA 1XQYA 4F9EA 2SNIE 3ACCA 2IJGX 4ESVA 4JB8A 1Q3HA 1J0AA 3IJRA 2GETA 1Y0BA 4MMYB 4BO8A 2RSLA 1JI3A 3EVAA 1TOAA 3HNOA 4G0YA 4PFQA 5F35A 3RPEA 3RUEA 1VG9B 3K4PA 1KO8A 2Y6UA 4AG3A 3CGGA 4DMRA 2WJ3A 1H3EA 3BXOA 1OKKA 1PDOA 1GQ2A 1V5FA 2EERA 4MLPA 5KVQA 4RU1A 5A3SA 3R3YA 2HYIC 3CRMA 2EDAA 4TX1A 1PK9A 4GKJB 3L6OO 5KREA 2G7ZA 4JI3B 1HNZB 1IJKA 4BYGA 1K66A 3ABRB 3H8WA 4HAWA 2WLSA 4Q21A 4CM9A 1NVAA 4JLSA 4F9GA 1OLXA 5CLGA 1YBHA 3H7AA 4ZOQI 1VIYA 3E5HA 1N4AA 1BWQA 1YQDA 4PZEA 5JR3A 3NANA 4HTFB 3WADA 4Z8YA 5B37A 3L79A 4Y1RA 5E1OA 4CLRB 1N5DA 2D74A 1U02A 1RRPA 2E4ZA 1RI4A 2Q7XA 2VNIA 2YRXA 4MP8A 5DHAA 3WHKA 3F46A 4YAOA 1ENPA 3ZUGA 2QLLA 3AF5A 1ORIA 2WJZB 1JW9B 2GWRA 4D3XA 2QL9A 1US8B 2BH9A 2ZSHA 2FMIA 3G9TA 1YBFA 2B92A 3H6GA 4BO7A 3KLOA 1T4BA 3M6UA 1O3YA 3SR3A 3LLCA 4CI0B 3FDIA 3QFCA 1JHXA 5FBZA 3VH1A 4D98A 2C7QA 2DH5A 2V7VA 3DAGA 1XMSA 5KUTA 5LU8A 2GPAA 5EXXA 4BE4A 2XAAA 3GFSA 4MAMA 1O0BA 1RLTA 4L0MA 4W5JA 3NHJA 4UULA 2R7KA 1MXFA 3VOSA 3PTZA 1DINA 4O2RA 5DN9A 4OY3A 1B0AA 1MORA 2ZRBA 4H3HB 3BYZA 1PHRA 4GBED 5AFSA 1ZK1A 3EOBI 1MVLA 5EPUA 1YI8A 5ITWA 1O0CA 2GPBA 1QF6A 2BOVA 3LP5A 4HWRA 1NW4A 2WUWE 4TXNA 5DU2A 2G70A 4EFNA 5I9IA 1FYDA 2BKUA 4B43A 2A0FA 2P5YA 3JAWB 1NW6A 2CLLB 4MI3A 5LBIA 3VOBA 2BT4A 3F7MA 5K0CA 1BDHA 3NDBB 1CJSA 3K15A 1VHDA 2RFLA 2JJQA 3T9DA 5L4LA 4X97A 3WR5A 4PLVA 3DPUA 2W2TA 2AFRA 5EHQA 3HM9A 2FSUA 2NUAA 3JD3A 4E31A 5HHTA 4MLDA 4RENA 1Z6ZA 2F1OA 2VUHB 2AHOA 1JIUA 1KKMA 4N3GA 1MOQA 1Q5PA 1RKQA 1NVGA 1PQUA 2HDWA 2FG5A 2XTAA 1Z3CA 4MA4A 4FCVA 3II6X 1Z83A 2G0AA 2QAGB 1S7CA 2IYOA 4MUAA 4HVAA 3COZA 5TE9A 2BKAA 2X1VA 4IOJA 3FPAA 4ND1A 4ND8A 3VVBA 3WL6A 3WO1A 4LZZA 1KYXA 1OV4A 2R47A 1J22A 4P2BA 4TQ9A 5CX1B 1TVCA 1E89A 3ME5A 4Z86A 3E6AA 4B7XA 5I7OA 5KSOA 1L9KA 3BB4A 1X7XA 1BHSA 1V4BA 3R20A 1LZKA 1XNQB 4JITA 2PKYX 1EB8A 1E3EA 2W43A 3BWBA 4ZZ1A 4BNTA 1WU8A 2BI7A 5LB2A 5FTJA 5MN4A 2V9CA 1HK7A 1G3UA 1EXNA 3O7WA 4DZZA 4YONB 3INYA 4HFRA 4DPMA 4CKCB 3UMCA 2NO5A 1AB5A 1QONA 4DSUA 4XX0B 3PXBA 1MJHA 3NXKA 3UJ6A 5A1TA 4QJ4A 1EAYA 2YZKA 1FDTA 3RWMB 3ZQKA 2JLYA 3U7FB 3ZE9A 4I1RA 2I6QA 4BP1A 1IWOA 4KQWA 5GY7A 3T5BA 4AUNA 3U1BA 3LWBA 1A9SA 3FHCB 5F3DA 4YQFA 3V8RA 4CGZA 4MIOA 1R7RA 4F0JA 1IATA 4BAUA 1UMCA 1KYQA 2QRPA 5KOJB 2IW3A 3QYFA 2E3JA 1ADFA 4LV5B 1Z39A 2WVAA 4CYMA 4KQ1A 4ARSA 1MD9A 3QMMA 4IIDA 4FZ5A 4XLTA 4DR1B 2RAVA 4U7WA 1B2RA 5EMMA 4Z0HO 3TQQA 4NLLA 4CM4A 1I6LA 3ZXYA 3ABQB 3DTTA 3RW9A 3SE7A 2JVJA 5A6VA 2XHZA 1BGWA 1MB3A 4LOHA 1Y5NA 4Z1MD 4CEJB 5EUBA 1SHTX 4JI2B 4YI3A 2J6BA 4FCTA 5TARA 3AW9A 2PZJA 4JWKA 4XM1A 4AS1A 3I45A 3KZKA 1IHDA 4M7WA 5AT1A 1ZWLA 4DDMA 4URWR 5JCOA 4RWZA 5CB8A 5CP8A 1T4CB 1MABB 1NOJA 2VP9A 4Z2AA 2EBWA 4B2YA 1UKZA 3BGIA 3Q98A 1DBQA 4GGPA 3GEMA 4EY5A 4XVCA 3ROMA 3PE3A 1KEEA 5JDCA 3CY6A 1P0IA 3WYCA 1K27A 2ZAGA 3BORA 2LW7A 1VDZA 1GG9A 3TPCA 3B82A 4YRDA 4M21A 2VSYA 1M5UA 2UUBB 3TNFA 3G8AA 3SLGA 1N8SA 3M49A 5FFNA 2ZRHA 5SYNA 1WZCA 3UB2A 4X54A 1NVDA 1V5GA 2UAGA 1AGPA 1BRMA 3ZWYA 3HB4X 4B44A 2VDOB 3ZEAA 2NM0A 5HE9A 2AQKA 1C1YA 1Q17A 3UK2A 1R9GA 2PUDA 4IXTA 2W2QA 3RJ9A 1QPZA 4PNZA 4C0QC 1R0WA 1SKMA 4K9NA 1NE7A 4DSAA 2RGXA 5EP1A 4BUJA 4RFSA 2WMNB 3PXDA 2MYPA 4JL8A 4LV8B 3TAUA 3FSEA 2F7SA 3WIDA 4U02A 5AHWA 1VB3A 4HNAB 3SFVA 4ARIA 1K3UB 2ZBFA 4D99A 4Z3DA 1OXKB 1UF9A 1LV8A 2OHIA 1ZD3A 1H8HD 2HEGA 3F5DA 3PUIA 5E6SB 3L1VA 4OK3A 2GXQA 2ZPAA 1TRHA 4KPEC 2A1TS 3AEUB 2VK8A 2R00C 2ONJA 2DQZA 3OY7A 1P8AA 2VPTA 1SXJA 2MTBA 4QUBA 2O2SA 2VK2A 3UGKA 1ZJJA 4OJTA 1W5SA 1PRYA 2A1UA 5UKDA 1MH9A 2ZJBA 3UWSA 4BAGA 1XZMA 1ZM7A 4OHKA 5LOVA 4LYFA 1OH6A 3SLKA 3WKBA 4AULA 3AJRA 1XZGA 1PZXA 3IP1A 4IFBA 2Y1KA 1BXKA 3ZDXB 3HU3A 3KM0A 2FUCA 1FNDA 5FV4A 2ZI7A 3OURA 1P3DA 2C97A 3TDNA 2LIVA 2IUTA 3N2KB 3ZBPA 2VDLB 1CFJA 2NO7A 4QDXA 2FETA 1R2QA 3OT1A 1GZHB 2P5SA 4KVZA 1RHQA 4U4AA 3VR5H 4N5DA 5BW5A 3HPQA 1CUSA 1MB9A 2BGTA 2IPAB 2R8BA 3CRVA 2PVPA 2H48A 3DT6A 4HSGA 4ZV7A 4IGEA 5EQTA 4PQFA 4RSGA 3RO7A 1TQDA 2FWNA 5FP0A 4BRZA 4DUYB 1Y6GA 3M3HA 3H0CA 3TLGB 4ZVRA 3DVRX 1QWOA 4F6RA 2IP1A 2P41A 3KL2A 4HTFA 1NKVA 2OBFA 1LK5A 1XCGB 1WY7A 2WNHA 3RS2A 2AWNA 4BJ1A 3P9SA 4HYTA 1GA6A 4X6YA 4OYHA 4RESA 4B3TB 4GLBA 4NYMQ 1M72A 3GUYA 1A2QA 2OG2A 3FBTA 3RUFA 4OBBA 3V1UA 1SC6A 5HOQA 1UPAA 1UWCA 1Z8FA 2IE8A 3KKQA 3QXGA 3FWKA 3OEHA 4RKQA 3TEFA 3VZBA 4B35A 4BMPB 1WHSB 3KQLA 3ZIDA 4J9VA 4AL4A 2J7PD 1DT3A 4O02B 3AR8A 3GNTA 4ZP1A 4BE9A 5FRDA 3D6JA 3FAZA 1NQUA 1MC5A 4UTOA 5DGIA 1U28C 2Q5EA 1ZW6A 5FR2A 4L9SA 2SKEA 4JOBA 4MGEA 3IEMA 1AX9A 1D2RA 4QBGB 3W9YA 3D7NA 2QTGA 4NVRA 5AJYA 2M98A 5F51A 5AK6A 3QEAZ 2VPWA 3OTQA 1JJBA 1PLLA 3IT1A 2WWIA 3PPVA 1IC6A 5KDLA 4HUJA 1WO8A 1YFZA 3HU2A 4Y6GB 2J3HA 3RFCA 1DHTA 3ZLJA 1L7DA 3ZWXA 4FSXA 3NTRA 4DE5A 1PLJA 1S9HA 2EKBA 2V59A 3I6YA 4NG5A 2O05A 2A4MA 2YVUA 4DCSA 3L4KA 5ARDA 4HZIA 1FC0A 2I7XA 3BK1A 2GYUA 5B2ZA 1CVRA 3W0LB 5E7JA 4CIVA 1KEWA 3DO5A 2HWWA 3DMYA 4PICA 4R31A 3Q5DA 1I7LA 2JIDA 4TZ0A 2RAUA 3CJQA 3CUYA 4C7JA 1ST3A 3LA8A 3O2NA 3LBHA 3UGQA 2R4UA 3MMPA 3D6MA 2RK6A 1P0CA 1P9OA 1QG4A 4OFXA 4PZ0A 2OWEA 4EJSA 1PFQA 3MWEA 3CR3C 4Q48A 4WL0A 4LQDA 1MB0A 4DDKA 5AW3A 3GLIB 3PV0A 1KH2A 2WSSD 3R7AA 4XWKA 4RMGA 3CWCA 5HK9A 2QMQA 4OF4A 2IWHA 1WB5A 3C6YA 4M9SA 1WPGA 3D2LA 1G8SA 3FUVA 4NPAA 2C42A 3FPKA 3OM8A 4OKIA 3OX2A 4JEMA 4GQAA 3K96A 4ZOLA 2BFCB 1D6MA 3A1SA 4G41A 2ZS8A 1UC5B 2FMKA 1XBTA 2ZUUA 3DR5A 1I2DA 2X1HA 1V71A 5C5DA 3VH2A 4EVIA 3ZCVA 1GUFA 1GPWB 1N0VC 1S8OA 1V0JA 1WOYA 1X80A 2VJBA 4ARZB 5JYDA 5LP6A 4DV4B 4E30A 1FFSA 4U8HA 4ZOLB 4E2WA 1O2DA 2PT7A 4CW7A 3WSWA 1IDOA 1UZNA 5LQNA 1EFUA 3K70C 1QG0A 3D3QA 2OCKA 4RHEA 1VLJA 1NF8A 1JQAA 4G26A 2ZAOA 1N2HA 2DZDA 3M81A 4MW9A 4EABA 1ZICA 1W88A 1XJQA 5DT2A 3S2FA 2IUYA 3PXUA 3TSOA 5CG2A 3AXSA 2MSNA 2RHGB 1N32B 3IQFA 4HC4A 1EVZA 1LD3A 4XDZA 5DBFA 5E7QA 4AIRA 4AMZA 4DARA 2F3QA 1D0IA 3V00A 4OMFG 4EF4A 5KIAA 2I1VB 2EZ4A 1DQYA 3A3KA 3PPYA 3QXCA 2I9PA 2IZ5A 4Q4JB 4B0OA 5GZ3A 2WILA 1CJKC 3KYBA 1ADBA 3ROEA 2HW8A 1WF6A 5HEKA 5K8JB 3TB6A 2PQ0A 4AURA 5ALDA 5KKAA 3IVAA 2OLJA 3PNLA 1R00A 3GLVA 2H1OA 1F14A 2X40A 1ML3A 3E1GA 3FPEA 3L0CA 3COYA 1QVWA 3V1LA 1N0HA 4N3NA 4UHFA 5KYNA 4NYJR 3CPEA 4NJMB 4L78A 1WD7A 1AJEA 2YZGA 1V1RB 3R23A 2ZB8A 2POQX 1J0EA 3LQKA 3KSZO 4KPUB 4LGMA 2H3HA 1DAFA 1EX7A 3IILA 5F78A 4EJ0A 1GUAA 1ZIPA 3DHEA 4MGHA 4P9NA 1FFYA 4FE3A 2P3SA 1XTSA 1PJLA 4TLBA 4P4SB 4D46A 4S24A 3EZXA 4RDIA 2CVOA 2PPLA 4Q3OA 5ERGB 3VKFA 1Y9JA 5KJEA 1QRRA 2W2KA 5FWXA 1T5HX 1R4ZA 4KO1S 1C30B 5DWVA 1P3JA 2CLSA 1JAZA 5LMZA 2BFEB 4DLSA 1PJRA 2XGOA 5D7BA 3SJBA 4DA9A 3KKKA 1INLA 2RHDA 2H9AA 1U3DA 4OH1A 4QTZA 1JHUA 3AESA 3F5SA 3JZFA 4WCFA 1CDOA 2HWUA 2YYYA 1RM5A 4BQEA 3GLGA 3U56A 3Q3CA 5ULLA 5JQWA 1CLUA 4EEZA 1DKQA 3VHQA 1RYNA 1JFRA 5AICA 1PG0A 2OGUA 5AXCA 5LA6B 1CF2O 3RYCB 3AM1A 3SXUB 2N0SA 4HNAA 3UV3A 5FWYA 1U2QA 5T41A 2RDMA 5AJTA 1A4IA 1YB6A 1CC1S 2IGBA 1HG0A 4ZVLA 1FFDA 1KFEB 4LVCA 5HS6A 3Q8MA 3QVWA 3TLKA 4NYMR 1FYVA 5HUJA 1OA1A 2P4SA 3ZXSA 1ECFA 4QASA 3M1AA 4EG0A 4TT3D 2AEJA 2CK3A 1NFQA 1NUHA 3HXOA 3Q7TA 5TQ2B 1QAOA 4YCCA 2YMQA 5HP4A 4B6SA 1ABFA 1FFAA 3MPUA 3NIBA 3ZGYA 1GNVA 5CK4A 1CIJA 1C1XA 4JN6B 1P6UA 1UMBA 4FMBB 2NPFA 1QRAA 4G0WA 2H11A 3CSSA 4PSUA 1XD8A 2QROA 1XRMA 3JQ8B 4FYVA 4FHCA 4YJGB 4R01A 2AZMA 5DBGA 3QX9A 3ZY3A 4GI5A 4JJKA 3ANXA 4IFEA 3C3YA 4JLNA 1L5GB 4D41A 5LZ9A 1NJ5A 4NCJA 3WJ1A 1QP7A 2WBLC 3WIOA 1VL6A 4ND2A 5G3ZA 5HW0A 1J8FA 2I4LA 3LAWA 5I01A 3C98A 2FSSA 4FFBA 3NU1A 4K9SA 2DE0X 4PF1A 3SZMA 3CX3A 4M49A 1CEQA 3PFCA 4IZIA 2P4EA 4OCZA 5K3SA 4AP9A 1F17A 3HV2A 2EDCA 5HIKA 4C4SA 3BFVA 4Y98A 1KTIA 1FP6A 2ZJ2A 4DJ5X 3PC8C 4BYMA 2P9ZA 1IN7A 3IAS1 3E27A 3NJ4A 1MEJA 3PRYA 4GE0A 4RZHA 1OF1A 4HB2A 2O23A 4IEIA 5AHKA 2B0CA 3VOAA 3N9IA 2WMOB 3BSYA 2UXDB 2UXBB 4PYMA 2GN6A 1OAOC 2DUWA 1RXCA 2JJ2D 4MAAA 1CUBA 2C94A 5E0OA 4D4JA 3H5TA 3UJAA 2ZWAA 4DVJA 3HN7A 4QZVA 2IYAA 5EGSA 3UQZA 4P92A 5JDIA 3FLAA 1G5TA 1Y6QA 2O4CA 4OXXA 5LBTA 1MC1A 2WWWA 2UZ1B 3SZ3A 1N77A 4JB2A 4ND3A 1XAJA 4N7MA 4LE2A 4XLLA 2K87A 1OIWA 4R7TA 1UMKA 1N5MA 3C6QA 1WXFA 1T1GA 4J6FA 2RGRA 2YY5A 3KJQA 1RJGA 2GR9A 4UHBA 1B23P 4HXGA 4P7FA 5AK3A 5F33A 5HJ7A 1V41E 1QDUA 5ALOA 5EGNA 3GGCA 1JR3A 3IV9A 4BKRA 3HUEA 4JC0A 3W9UA 1NPDA 1T8UA 2C4KA 2QM7A 4WVLA 3DXFA 4XX1A 3PGKA 4Z6KA 5CLJA 1U0BB 4JA2A 1BIFA 1GU0A 4EI2A 3LYLA 1HQKA 4WLFA 3WK6A 1RXWA 4MSUA 2HRBA 4TPKA 1OI3A 1XWIA 3NOXA 4S1NA 3DG9A 1OBHA 2ZQ5A 2PKQO 1KY2A 3DCYA 2Z1MA 4FNMA 2B35A 1GFWA 1R15A 2ZXFA 2BTOA 1YUMA 2OGTA 3ET5A 5ALRA 1P1CA 3MCWA 4PXYA 4P2GA 3T7JA 3ZWNA 3SHVA 4ARBA 4ZK6A 2JFYA 1N57A 3BF7A 1ZISA 3LC7O 3EPJA 6ABPA 2C58A 4TT3A 3PYMA 1KQOA 3ZE7A 1G2PA 1W30A 5D01A 3RG2A 3UZUA 5LD2B 2ISQA 3DVAB 3EXEB 3HSYA 3K9NA 3NDIA 2RE8A 4LF5B 5HCUA 3F0TA 3DMHA 7MDHA 2H3EA 1KSFX 4D0NA 1T34A 1SOAA 4BMCA 4MB6A 2VUSA 4UZSA 1VBFA 2EIHA 1S2NA 3KV3O 3OWHA 1TEHA 3WO0A 4CMEC 1YH3A 3ORSA 1L7OA 3FPLA 3HA2A 1B42A 1DUVG 2BLLA 3IAM1 1B15A 1JFTA 4XFJA 4LHXA 3M70A 2R8PA 1ESEA 1KFCB 4GEGA 1EXDA 5BVHB 4J0FA 2I4TA 4X1KA 2SCUB 8MHTA 2JFXA 4UU1A 3RYIA 4II3A 5IAKA 1GZSA 5EYPB 4TWJA 4LDQA 2WE8A 2F1RA 1WMBA 2B4RO 3ZE8A 4MKGA 3EBOA 1N6RA 4KV7A 1FTQA 3H9UA 4TKMA 4NJOA 1LZLA 3FZEA 3KS9A 1SBZA 3Q15C 3WQBA 1R8SA 2Z58A 2VG8A 4TTVA 5F7JA 2LDBA 3WWCA 5AHOA 1ENZA 1L5SA 5TPWA 3B1JA 5T57A 2C5SA 5DASA 4B5KA 2YVLA 2AG8A 4B79A 4UASA 4Q34A 2B2XA 4AFNA 3A1UA 2PCLA 1MMFB 1XELA 1G3IA 2GX6A 1EBUA 3JYLA 4IZHA 2GAOA 3BJIC 4EHDA 2ZUSA 1Q74A 1HBJA 2GASA 3GA0A 4C29A 2R8EA 2PS0A 3DOOA 3P9RA 3FWPA 4P3YA 3MTBA 3SPXA 5FDFA 4FZRA 1H1DA 2WG2A 4HP8A 3HLYA 3MUOA 4OQNA 3DMRA 3JQEA 4M4SA 4DQVA 4KE8A 4WBXC 4I50B 1X7WA 3IBCA 1ULBA 4GICA 4FOSA 1GV0A 4NIMA 5IBRA 3STHA 4XGIA 2VXBA 1GN9A 4A82A 4EUKA 5J43A 3IIJA 3TECE 3VKHA 5I45A 1QH9A 1W48A 4G86A 4KHZA 4M8SA 4HNTA 5KHAA 3O8QB 1KYZA 3NUQA 2DGDA 3P71T 3OJLA 4HZUA 5AW7A 5JATA 4CU5A 4LN1A 2Q07A 4G0MA 3KTFA 4L3OA 2EBFX 3NMUF 1UDAA 4IICA 4EMTA 3QJYA 1VRVA 2XUFA 1G9SA 4J4HA 3VU3A 3T35A 2JBAA 3ONEA 5L95A 3KQNA 5CLLA 4DBLE 3MAJA 3WRVA 2W42A 4HZUB 3AP1A 4AWXA 4ODIA 1Y8ZA 4X60A 2LD4A 4N9WA 1SA0A 2FSVA 2JG3A 4KRFA 1GNLA 1GTVA 3MFYA 3MTGA 5F2OA 5IDQA 3PSAA 2RGWA 1W9HA 2B99A 2NO6A 1YQQA 4R54A 3ZWCA 4LBWA 4EA6A 2XWPA 4MI1A 1QRDA 4CCAA 3N8NA 2C59A 1XNHA 3SY